Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= F28D9_2
         (1806 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|7500077|pir||T21503 hypothetical protein F28D9.1 - Caenorhabd...   379   e-103
gi|25143299|ref|NP_492875.2| pre-mRNA splicing SR protein relate...   379   e-103
gi|25375097|pir||H87917 protein F28D9.1 [imported] - Caenorhabdi...   379   e-103
gi|39592411|emb|CAE63488.1| Hypothetical protein CBG07956 [Caeno...   330   5e-89
gi|47087423|ref|NP_998607.1| zgc:63802 [Danio rerio] >gnl|BL_ORD...   171   4e-41
gi|49522807|gb|AAH74646.1| Unknown (protein for MGC:69349) [Xeno...   171   7e-41
gi|50414757|gb|AAH77771.1| Unknown (protein for IMAGE:4885186) [...   169   2e-40
gi|23274133|gb|AAH36187.1| Serine/arginine repetitive matrix 1 [...   169   3e-40
gi|42542379|ref|NP_005830.2| serine/arginine repetitive matrix 1...   168   3e-40
gi|3005587|gb|AAC09321.1| Ser/Arg-related nuclear matrix protein...   168   3e-40
gi|7949115|ref|NP_058079.1| Ser/Arg-related nuclear matrix prote...   167   8e-40
gi|13879541|gb|AAH06751.1| Unknown (protein for IMAGE:3256899) [...   167   8e-40
gi|12842373|dbj|BAB25575.1| unnamed protein product [Mus musculus]    166   1e-39
gi|19526266|gb|AAL89660.1| SRm160/300 splicing coactivator [Taki...   162   2e-38
gi|50759930|ref|XP_425775.1| PREDICTED: similar to Ser/Arg-relat...   159   2e-37
gi|34872074|ref|XP_233556.2| similar to Ser/Arg-related nuclear ...   154   7e-36
gi|47219559|emb|CAG09913.1| unnamed protein product [Tetraodon n...   153   1e-35
gi|24663664|ref|NP_648627.1| CG11274-PA [Drosophila melanogaster...   149   2e-34
gi|31212783|ref|XP_315376.1| ENSANGP00000020934 [Anopheles gambi...   137   8e-31
gi|34902084|ref|NP_912388.1| SR-rich pre-mRNA splicing activator...   127   9e-28
gi|9843651|emb|CAC03679.1| SRM102 [Arabidopsis thaliana]              126   1e-27
gi|30684163|ref|NP_180484.2| splicing factor PWI domain-containi...   126   1e-27
gi|37926799|pdb|1MP1|A Chain A, Solution Structure Of The Pwi Mo...   120   8e-26
gi|25408026|pir||G84693 probable proline-rich protein [imported]...   117   1e-24
gi|49070482|ref|XP_399530.1| hypothetical protein UM01915.1 [Ust...   111   7e-23
gi|19075555|ref|NP_588055.1| putative splicing factor [Schizosac...   110   9e-23
gi|50259720|gb|EAL22390.1| hypothetical protein CNBB5630 [Crypto...   108   4e-22
gi|23957752|ref|NP_473225.2| hypothetical protein [Plasmodium fa...    98   6e-19
gi|7494217|pir||T18467 hypothetical protein C0465c - malaria par...    98   7e-19
gi|23480880|gb|EAA17323.1| PWI domain, putative [Plasmodium yoel...    98   7e-19
gi|48099865|ref|XP_394950.1| similar to CG11274-PA [Apis mellifera]    96   3e-18
gi|38104142|gb|EAA50754.1| hypothetical protein MG04513.4 [Magna...    94   8e-18
gi|32420555|ref|XP_330721.1| hypothetical protein [Neurospora cr...    89   3e-16
gi|49091210|ref|XP_407066.1| hypothetical protein AN2929.2 [Aspe...    85   7e-15
gi|46108430|ref|XP_381273.1| hypothetical protein FG01097.1 [Gib...    76   3e-12
gi|50422775|ref|XP_459964.1| unnamed protein product [Debaryomyc...    69   4e-10
gi|50549681|ref|XP_502311.1| hypothetical protein [Yarrowia lipo...    69   5e-10
gi|48104908|ref|XP_392986.1| similar to CG11274-PA [Apis mellifera]    64   1e-08
gi|46437278|gb|EAK96627.1| hypothetical protein CaO19.9493 [Cand...    56   2e-06
gi|46437338|gb|EAK96686.1| hypothetical protein CaO19.1938 [Cand...    56   3e-06
gi|46228634|gb|EAK89504.1| PWI domain containing protein that is...    54   1e-05
gi|7549210|gb|AAF63787.1| 200 kDa antigen p200 [Babesia bigemina]      53   2e-05
gi|46136181|ref|XP_389782.1| hypothetical protein FG09606.1 [Gib...    49   5e-04
gi|21355513|ref|NP_651272.1| CG13625-PA [Drosophila melanogaster...    49   5e-04
gi|437639|gb|AAA72295.1| [Plasmodium falciparum 3' end.], gene p...    48   7e-04
gi|12003272|gb|AAG43511.1| fast skeletal muscle troponin T [Mele...    48   7e-04
gi|23619293|ref|NP_705255.1| reticulocyte binding protein 2 homo...    48   7e-04
gi|13345187|gb|AAK19244.1| reticulocyte binding protein 2 homolo...    48   7e-04
gi|44917423|tpg|DAA02048.1| TPA: GRP21 [Arabidopsis thaliana]          47   0.001
gi|47228073|emb|CAF97702.1| unnamed protein product [Tetraodon n...    47   0.001
gi|21355931|ref|NP_648931.1| CG11915-PA [Drosophila melanogaster...    47   0.001
gi|31198741|ref|XP_308318.1| ENSANGP00000010717 [Anopheles gambi...    47   0.002
gi|50545139|ref|XP_500107.1| hypothetical protein [Yarrowia lipo...    47   0.002
gi|586120|sp|Q07283|TRHY_HUMAN Trichohyalin >gnl|BL_ORD_ID|13043...    47   0.002
gi|9858781|gb|AAG01128.1| BAC19.13 [Lycopersicon esculentum]           47   0.002
gi|32363162|sp|Q8HZQ5|EZRI_RABIT Ezrin (p81) (Cytovillin) (Villi...    47   0.002
gi|5031925|ref|NP_005798.1| proteoglycan 4; megakaryocyte stimul...    46   0.003
gi|13559026|emb|CAC36090.1| bG174L6.2 (MSF: megakaryocyte stimul...    46   0.003
gi|37725922|gb|AAO38039.1| reticulocyte binding-like protein 2b ...    46   0.003
gi|45550734|ref|NP_650019.2| CG14692-PA [Drosophila melanogaster...    46   0.003
gi|124730|sp|P24710|INVO_GALCR Involucrin >gnl|BL_ORD_ID|1873056...    46   0.003
gi|12004997|gb|AAG44258.1| fast skeletal muscle troponin T isofo...    46   0.003
gi|4505285|ref|NP_002448.1| mucin 2 [Homo sapiens] >gnl|BL_ORD_I...    45   0.004
gi|1160355|gb|AAB00542.1| UNC-89                                       45   0.004
gi|25141314|ref|NP_491290.2| UNCoordinated locomotion UNC-89, PH...    45   0.004
gi|46226679|gb|EAK87658.1| Low complexity protein with large Glu...    45   0.004
gi|31746683|gb|AAP68958.1| Uncoordinated protein 89, isoform b [...    45   0.004
gi|32412236|ref|XP_326598.1| predicted protein [Neurospora crass...    45   0.004
gi|107112|pir||A37232 mucin, tracheal (AMN-22) - human (fragment...    45   0.004
gi|7511618|pir||T29757 protein UNC-89 - Caenorhabditis elegans         45   0.004
gi|38260630|gb|AAR15447.1| pollen coat oleosin-glycine rich prot...    45   0.006
gi|586122|sp|P22793|TRHY_SHEEP Trichohyalin >gnl|BL_ORD_ID|21738...    45   0.007
gi|46116454|ref|XP_384245.1| hypothetical protein FG04069.1 [Gib...    44   0.010
gi|17027049|gb|AAL34070.1| elongation factor-1 alpha [Chimarra r...    44   0.010
gi|6679060|ref|NP_032722.1| mitogen-activated protein kinase kin...    44   0.010
gi|22788859|ref|NP_690573.1| hypothetical protein HZV_154 [Helio...    44   0.010
gi|33413776|gb|AAN39446.1| normocyte binding protein 2a [Plasmod...    44   0.013
gi|27881492|ref|NP_775081.1| zonadhesin isoform 5 [Homo sapiens]...    44   0.013
gi|15721997|gb|AAL04412.1| zonadhesin splice variant 5 [Homo sap...    44   0.013
gi|47213005|emb|CAF95397.1| unnamed protein product [Tetraodon n...    44   0.013
gi|15722000|gb|AAL04415.1| zonadhesin splice variant 2 [Homo sap...    44   0.013
gi|27881488|ref|NP_775079.1| zonadhesin isoform 2 [Homo sapiens]...    44   0.013
gi|25148106|ref|NP_741868.1| apical Junction Molecule AJM-1, Jun...    44   0.013
gi|17568591|ref|NP_509536.1| apical Junction Molecule AJM-1, Jun...    44   0.013
gi|32416354|ref|XP_328655.1| predicted protein [Neurospora crass...    44   0.013
gi|33413782|gb|AAN39444.1| normocyte binding protein 2a [Plasmod...    44   0.013
gi|17568587|ref|NP_509538.1| apical Junction Molecule AJM-1, Jun...    44   0.013
gi|27881494|ref|NP_775082.1| zonadhesin isoform 6 [Homo sapiens]...    44   0.013
gi|15721998|gb|AAL04413.1| zonadhesin splice variant 6 [Homo sap...    44   0.013
gi|7496462|pir||T15597 hypothetical protein C25A11.4b - Caenorha...    44   0.013
gi|7496461|pir||T15598 hypothetical protein C25A11.4a - Caenorha...    44   0.013
gi|27881486|ref|NP_775078.1| zonadhesin isoform 1 [Homo sapiens]...    44   0.013
gi|15721995|gb|AAL04410.1| zonadhesin splice variant 1 [Homo sap...    44   0.013
gi|27881490|ref|NP_775080.1| zonadhesin isoform 4 [Homo sapiens]...    44   0.013
gi|15721999|gb|AAL04414.1| zonadhesin splice variant 4 [Homo sap...    44   0.013
gi|16554449|ref|NP_003377.1| zonadhesin isoform 3 [Homo sapiens]...    44   0.013
gi|27924006|sp|Q9Y493|ZAN_HUMAN Zonadhesin precursor >gnl|BL_ORD...    44   0.013
gi|17568589|ref|NP_509537.1| apical Junction Molecule AJM-1, Jun...    44   0.013
gi|49095256|ref|XP_409089.1| hypothetical protein AN4952.2 [Aspe...    44   0.017
gi|28856212|gb|AAH48067.1| Unknown (protein for IMAGE:3818911) [...    43   0.022
gi|28829317|gb|AAO51859.1| similar to Homo sapiens (Human). Muci...    43   0.022
gi|38110499|gb|EAA56207.1| predicted protein [Magnaporthe grisea...    43   0.022
gi|38112042|gb|EAA57517.1| hypothetical protein MG10192.4 [Magna...    43   0.022
gi|50548313|ref|XP_501626.1| hypothetical protein [Yarrowia lipo...    43   0.022
gi|38092079|ref|XP_283024.2| envoplakin [Mus musculus]                 43   0.022
gi|45382523|ref|NP_990253.1| troponin T variant TnTx7-e16 [Gallu...    43   0.022
gi|46369471|ref|NP_079552.2| envoplakin; 210-kD protein; 210kDa ...    43   0.022
gi|50759764|ref|XP_417771.1| PREDICTED: similar to CDNA sequence...    43   0.028
gi|47224421|emb|CAG08671.1| unnamed protein product [Tetraodon n...    43   0.028
gi|22775647|dbj|BAC15501.1| early nodulin 75 precursor-like prot...    43   0.028
gi|2072290|gb|AAC60120.1| XL-INCENP [Xenopus laevis]                   43   0.028
gi|38260684|gb|AAR15498.1| pollen coat oleosin-glycine rich prot...    42   0.037
gi|20514774|ref|NP_620610.1| putative cell surface antigen [Ratt...    42   0.037
gi|462702|sp|P16884|NFH_RAT Neurofilament triplet H protein (200...    42   0.037
gi|17221648|dbj|BAB78478.1| preproMP73 [Cucurbita maxima]              42   0.037
gi|33413774|gb|AAN39445.1| normocyte binding protein 2a [Plasmod...    42   0.037
gi|205686|gb|AAA41695.1| heavy neurofilament subunit                   42   0.037
gi|29789026|ref|NP_036739.1| neurofilament, heavy polypeptide [R...    42   0.037
gi|2136504|pir||I47141 gastric mucin (clone PGM-2A) - pig (fragm...    42   0.049
gi|32414699|ref|XP_327829.1| hypothetical protein [Neurospora cr...    42   0.049
gi|6979936|gb|AAF34661.1| split ends long isoform [Drosophila me...    42   0.063
gi|24850117|ref|NP_733763.1| misshapen/NIK-related kinase isofor...    42   0.063
gi|6467825|gb|AAF13218.1| Spen RNP motif protein long isoform [D...    42   0.063
gi|24580581|ref|NP_524718.2| CG18497-PB [Drosophila melanogaster...    42   0.063
gi|15241428|ref|NP_199231.1| homeobox transcription factor, puta...    42   0.063
gi|24580579|ref|NP_722615.1| CG18497-PA [Drosophila melanogaster...    42   0.063
gi|7657335|ref|NP_056531.1| misshapen/NIK-related kinase isoform...    42   0.063
gi|24580583|ref|NP_722616.1| CG18497-PC [Drosophila melanogaster...    42   0.063
gi|29427834|sp|Q8N4C8|M4K6_HUMAN Mitogen-activated protein kinas...    42   0.063
gi|27436917|ref|NP_722549.2| misshapen/NIK-related kinase isofor...    42   0.063
gi|28316334|dbj|BAC56950.1| hair follicle protein AHF [Mus muscu...    41   0.083
gi|34858177|ref|XP_227373.2| similar to trichohyalin [Rattus nor...    41   0.083
gi|15600941|ref|NP_232571.1| conserved hypothetical protein [Vib...    41   0.083
gi|6433936|emb|CAB60727.1| aczonin [Homo sapiens]                      41   0.083
gi|39592280|emb|CAE75501.1| Hypothetical protein CBG23510 [Caeno...    41   0.083
gi|47214480|emb|CAG12485.1| unnamed protein product [Tetraodon n...    41   0.083
gi|29830262|ref|NP_824896.1| hypothetical protein SAV3719 [Strep...    41   0.083
gi|92538|pir||S02003 neurofilament triplet H protein - rat (frag...    41   0.083
gi|1076802|pir||S49915 extensin-like protein - maize >gnl|BL_ORD...    41   0.083
gi|2081630|gb|AAB54079.1| unknown [Dictyostelium discoideum]           41   0.083
gi|38073487|ref|XP_355243.1| similar to This gene is isolated by...    41   0.083
gi|17566006|ref|NP_505150.1| putative protein (5I806) [Caenorhab...    41   0.083
gi|7209719|dbj|BAA92310.1| This gene is isolated by means of dif...    41   0.083
gi|32399111|emb|CAD98351.1| hypothetical predicted protein, unkn...    41   0.083
gi|684940|gb|AAB54078.1| unknown                                       41   0.083
gi|41019528|sp|Q9Y6V0|PCLO_HUMAN Piccolo protein (Aczonin)             41   0.083
gi|9910376|ref|NP_064623.1| inner centromere protein antigens 13...    41   0.083
gi|21221961|ref|NP_627740.1| integral membrane protein with kina...    41   0.083
gi|3135306|gb|AAC78790.1| zonadhesin [Homo sapiens]                    41   0.083
gi|24374290|ref|NP_718333.1| tolA protein [Shewanella oneidensis...    41   0.11
gi|42781280|ref|NP_978527.1| hypothetical protein BCE2215 [Bacil...    41   0.11
gi|41400384|gb|AAS07044.1| plus agglutinin [Chlamydomonas reinha...    41   0.11
gi|21357267|ref|NP_649312.1| CG6014-PA [Drosophila melanogaster]...    41   0.11
gi|34880471|ref|XP_213903.2| similar to This gene is isolated by...    41   0.11
gi|485883|emb|CAA83869.1| glycoprotein [Human respiratory syncyt...    40   0.14
gi|38181902|gb|AAH61522.1| KIAA0220 protein [Homo sapiens]             40   0.14
gi|47117902|sp|Q92617|Y220_HUMAN Hypothetical protein KIAA0220 >...    40   0.14
gi|42660743|ref|XP_375313.1| hypothetical protein MGC9515 [Homo ...    40   0.14
gi|28829968|gb|AAO52458.1| similar to Dictyostelium discoideum (...    40   0.14
gi|42660947|ref|XP_375330.1| similar to MGC9515 protein [Homo sa...    40   0.14
gi|23270703|gb|AAH36263.1| MGC9515 protein [Homo sapiens]              40   0.14
gi|49257511|gb|AAH73943.1| Unknown (protein for IMAGE:5396010) [...    40   0.14
gi|49070144|ref|XP_399361.1| hypothetical protein UM01746.1 [Ust...    40   0.14
gi|86460|pir||A31957 troponin T, skeletal muscle, isoform 1 - ch...    40   0.14
gi|34536310|dbj|BAC87606.1| unnamed protein product [Homo sapiens]     40   0.14
gi|7710058|ref|NP_057922.1| mitogen-activated protein kinase kin...    40   0.14
gi|30851421|gb|AAH52474.1| Map4k6-pending protein [Mus musculus]       40   0.14
gi|34874497|ref|XP_224295.2| similar to KIAA0853 protein [Rattus...    40   0.14
gi|48860436|ref|ZP_00314361.1| COG2730: Endoglucanase [Clostridi...    40   0.14
gi|23613038|ref|NP_703360.1| interspersed repeat antigen, putati...    40   0.14
gi|15030181|gb|AAH11346.1| Map4k6-pending protein [Mus musculus]       40   0.14
gi|42660957|ref|XP_290670.4| KIAA0220 protein [Homo sapiens]           40   0.14
gi|24647644|ref|NP_650611.1| CG4090-PA [Drosophila melanogaster]...    40   0.14
gi|28882060|ref|NP_795712.1| mitogen-activated protein kinase ki...    40   0.14
gi|29428007|sp|Q9JM52|M4K6_MOUSE Mitogen-activated protein kinas...    40   0.14
gi|37360046|dbj|BAC98001.1| mKIAA0687 protein [Mus musculus]           40   0.18
gi|34852250|ref|XP_228031.2| similar to differentially expressed...    40   0.18
gi|32413314|ref|XP_327137.1| predicted protein [Neurospora crass...    40   0.18
gi|485904|emb|CAA83863.1| glycoprotein [Human respiratory syncyt...    40   0.18
gi|9630030|ref|NP_046248.1| unknown [Orgyia pseudotsugata multic...    40   0.18
gi|1708493|sp|P53352|INCE_CHICK Inner centromere protein >gnl|BL...    40   0.18
gi|47219369|emb|CAG10998.1| unnamed protein product [Tetraodon n...    40   0.18
gi|586121|sp|P37709|TRHY_RABIT Trichohyalin >gnl|BL_ORD_ID|29628...    40   0.18
gi|15676451|ref|NP_273590.1| conserved hypothetical protein [Nei...    40   0.18
gi|45190780|ref|NP_985034.1| AER177Wp [Eremothecium gossypii] >g...    40   0.18
gi|44888879|gb|AAS48177.1| merlot proline-rich protein 2 [Vitis ...    40   0.18
gi|48861108|ref|ZP_00315013.1| COG1418: Predicted HD superfamily...    40   0.24
gi|46437644|gb|EAK96987.1| hypothetical protein CaO19.9760 [Cand...    40   0.24
gi|995765|gb|AAA75589.1| mucin                                         40   0.24
gi|128127|sp|P19246|NFH_MOUSE Neurofilament triplet H protein (2...    40   0.24
gi|15779123|gb|AAH14625.1| Unknown (protein for IMAGE:2960670) [...    40   0.24
gi|7493836|gb|AAF07822.2| multidomain presynaptic cytomatrix pro...    40   0.24
gi|30173132|sp|Q9WU62|INCE_MOUSE Inner centromere protein >gnl|B...    40   0.24
gi|47224238|emb|CAG09084.1| unnamed protein product [Tetraodon n...    40   0.24
gi|1519534|gb|AAB07542.1| ORF DG1007; initially derived from a p...    40   0.24
gi|32566623|ref|NP_506134.2| splicing factor PWI family member (...    40   0.24
gi|41400381|gb|AAS07042.1| minus agglutinin [Chlamydomonas reinh...    40   0.24
gi|29826103|gb|AAO91768.1| IRF4-binding protein [Mus musculus]         40   0.24
gi|27734752|ref|NP_081461.1| differentially expressed in FDCP 6;...    40   0.24
gi|40788877|dbj|BAA09488.2| KIAA0139 [Homo sapiens]                    40   0.24
gi|47212948|emb|CAF92625.1| unnamed protein product [Tetraodon n...    40   0.24
gi|30851505|gb|AAH52414.1| Inner centromere protein [Mus musculus]     40   0.24
gi|26349413|dbj|BAC38346.1| unnamed protein product [Mus musculu...    40   0.24
gi|39586313|emb|CAE66724.1| Hypothetical protein CBG12070 [Caeno...    40   0.24
gi|4503509|ref|NP_003741.1| eukaryotic translation initiation fa...    40   0.24
gi|10048483|ref|NP_064483.1| multidomain presynaptic cytomatrix ...    40   0.24
gi|46125725|ref|XP_387416.1| hypothetical protein FG07240.1 [Gib...    40   0.24
gi|7508963|pir||T25437 hypothetical protein W04D2.6b - Caenorhab...    40   0.24
gi|32566621|ref|NP_506133.2| RNA-binding region RNP-1   and Spli...    40   0.24
gi|50555876|ref|XP_505346.1| hypothetical protein [Yarrowia lipo...    40   0.24
gi|7508962|pir||T25438 hypothetical protein W04D2.6a - Caenorhab...    40   0.24
gi|284667|pir||A43427 neurofilament triplet H1 protein - rabbit ...    39   0.31
gi|31209753|ref|XP_313843.1| ENSANGP00000011728 [Anopheles gambi...    39   0.31
gi|38074111|ref|XP_355284.1| nasopharyngeal epithelium specific ...    39   0.31
gi|34875366|ref|XP_221129.2| similar to envoplakin [Rattus norve...    39   0.31
gi|50554851|ref|XP_504834.1| hypothetical protein [Yarrowia lipo...    39   0.31
gi|6320845|ref|NP_010924.1| Non-essential subunit of the exocyst...    39   0.31
gi|42658037|ref|XP_291247.3| similar to Piccolo protein (Aczonin...    39   0.31
gi|37790512|gb|AAR03407.1| attachment protein [Human respiratory...    39   0.31
gi|24620455|gb|AAN61519.1| 1MDa_1 protein [Caenorhabditis elegans]     39   0.31
gi|6754576|ref|NP_034869.1| lymphocyte antigen 64 [Mus musculus]...    39   0.31
gi|24620454|gb|AAN61518.1| 2MDa_2 protein [Caenorhabditis elegans]     39   0.31
gi|32420087|ref|XP_330487.1| predicted protein [Neurospora crass...    39   0.31
gi|2367400|gb|AAB69637.1| GrfA [Dictyostelium discoideum]              39   0.31
gi|21231078|ref|NP_636995.1| unknown acidic aa rich protein [Xan...    39   0.31
gi|46124235|ref|XP_386671.1| hypothetical protein FG06495.1 [Gib...    39   0.31
gi|29835191|gb|AAH51076.1| BC051076 protein [Mus musculus]             39   0.31
gi|50425997|ref|XP_461595.1| unnamed protein product [Debaryomyc...    39   0.31
gi|10835055|ref|NP_001778.1| cell division cycle 2-like 1 (PITSL...    39   0.31
gi|24620453|gb|AAN61517.1| 2MDa_1 protein [Caenorhabditis elegans]     39   0.31
gi|205680|gb|AAA41692.1| high molecular weight neurofilament           39   0.31
gi|584042|emb|CAA83859.1| G [Human respiratory syncytial virus]        39   0.41
gi|39594923|emb|CAE70791.1| Hypothetical protein CBG17547 [Caeno...    39   0.41
gi|31540577|gb|AAP48996.1| cellulosomal scaffoldin anchoring pro...    39   0.41
gi|28569857|dbj|BAC57901.1| gag-like protein [Anopheles gambiae]       39   0.41
gi|37790510|gb|AAR03406.1| attachment protein [Human respiratory...    39   0.41
gi|50233899|ref|NP_956587.2| hypothetical protein MGC56488 [Dani...    39   0.41
gi|32418656|ref|XP_329806.1| hypothetical protein [Neurospora cr...    39   0.41
gi|28972433|dbj|BAC65670.1| mKIAA0845 protein [Mus musculus]           39   0.41
gi|47229372|emb|CAF99360.1| unnamed protein product [Tetraodon n...    39   0.41
gi|39588050|emb|CAE57282.1| Hypothetical protein CBG00187 [Caeno...    39   0.41
gi|7494097|pir||T14608 hypothetical protein - Trypanosoma cruzi ...    39   0.41
gi|32423201|ref|XP_332038.1| predicted protein [Neurospora crass...    39   0.41
gi|16332370|ref|NP_277027.1| cell division cycle 2-like 1 (PITSL...    39   0.41
gi|46442359|gb|EAL01649.1| hypothetical protein CaO19.2739 [Cand...    39   0.41
gi|34905224|ref|NP_913959.1| P0672D01.14 [Oryza sativa (japonica...    39   0.41
gi|21429606|gb|AAM49796.1| heavy neurofilament NF-H [Rattus norv...    39   0.41
gi|24182481|gb|AAH38663.1| 1110018J23Rik protein [Mus musculus]        39   0.54
gi|45384506|ref|NP_990661.1| class II INCENP protein; class I IN...    39   0.54
gi|16306780|gb|AAH01584.1| LOC124245 protein [Homo sapiens]            39   0.54
gi|26330358|dbj|BAC28909.1| unnamed protein product [Mus musculus]     39   0.54
gi|11559966|ref|NP_071531.1| involucrin gene [Rattus norvegicus]...    39   0.54
gi|34495238|gb|AAQ73469.1| erythrocyte binding protein 3 [Plasmo...    39   0.54
gi|47225554|emb|CAG12037.1| unnamed protein product [Tetraodon n...    39   0.54
gi|34495237|gb|AAQ73468.1| erythrocyte binding protein 2 [Plasmo...    39   0.54
gi|34809534|gb|AAQ82688.1| Epa4p [Candida glabrata]                    39   0.54
gi|34871052|ref|XP_239247.2| similar to misshapen/NIK-related ki...    39   0.54
gi|38112010|gb|EAA57489.1| hypothetical protein MG10164.4 [Magna...    39   0.54
gi|50547897|ref|XP_501418.1| hypothetical protein [Yarrowia lipo...    39   0.54
gi|7710040|ref|NP_057901.1| inner centromere protein [Mus muscul...    39   0.54
gi|2497280|sp|P55875|IF2_STIAU Translation initiation factor IF-...    39   0.54
gi|31377595|ref|NP_653205.2| hypothetical protein BC001584 [Homo...    39   0.54
gi|46442117|gb|EAL01409.1| hypothetical protein CaO19.10253 [Can...    39   0.54
gi|31560788|ref|NP_065254.2| bromodomain containing 4 isoform 1;...    39   0.54
gi|50400639|sp|Q9ESU6|BRD4_MOUSE Bromodomain-containing protein ...    39   0.54
gi|28829276|gb|AAO51818.1| similar to Kaposi's sarcoma-associate...    39   0.54
gi|38085199|ref|XP_140742.4| expressed sequence AI646761 [Mus mu...    39   0.54
gi|28273142|dbj|BAC56934.1| FLJ00419 protein [Homo sapiens]            39   0.54
gi|50547317|ref|XP_501128.1| hypothetical protein [Yarrowia lipo...    39   0.54
gi|23508673|ref|NP_701342.1| MAEBL, putative [Plasmodium falcipa...    39   0.54
gi|3978441|gb|AAC83664.1| PITSLRE protein kinase alpha SV9 isofo...    39   0.54
gi|49477529|ref|YP_036302.1| conserved hypothetical protein [Bac...    38   0.70
gi|20562927|gb|AAM22757.1| unknown [Deschampsia antarctica]            38   0.70
gi|34880946|ref|XP_222907.2| similar to Nasopharyngeal epitheliu...    38   0.70
gi|47226687|emb|CAG07846.1| unnamed protein product [Tetraodon n...    38   0.70
gi|24580684|ref|NP_608540.1| CG2839-PA [Drosophila melanogaster]...    38   0.70
gi|34879649|ref|XP_214402.2| similar to hypothetical protein FLJ...    38   0.70
gi|40786396|ref|NP_955370.1| FLJ35171 protein [Homo sapiens] >gn...    38   0.70
gi|38570282|gb|AAR24594.1| troponin T-3 [Drosophila virilis]           38   0.70
gi|124733|sp|P14590|INVO_LEMCA Involucrin >gnl|BL_ORD_ID|1468131...    38   0.70
gi|24649095|ref|NP_651074.1| CG17622-PA [Drosophila melanogaster...    38   0.70
gi|46227023|gb|EAK87973.1| ubiquitin C-terminal hydrolase of the...    38   0.70
gi|7022030|dbj|BAA91467.1| unnamed protein product [Homo sapiens...    38   0.70
gi|631650|pir||S41080 calcium channel alpha-1 chain - mouse            38   0.70
gi|6680822|ref|NP_031605.1| calcium channel, voltage-dependent, ...    38   0.70
gi|23102692|ref|ZP_00089193.1| COG2905: Predicted signal-transdu...    38   0.70
gi|41147656|ref|XP_168583.4| similar to intestinal membrane muci...    38   0.70
gi|27806009|ref|NP_776819.1| myosin X [Bos taurus] >gnl|BL_ORD_I...    38   0.70
gi|38570281|gb|AAR24593.1| troponin T-2 [Drosophila virilis]           38   0.70
gi|24582272|ref|NP_609058.2| CG11098-PA [Drosophila melanogaster...    38   0.70
gi|6166049|sp|O55017|CCAB_MOUSE Voltage-dependent N-type calcium...    38   0.70
gi|42407352|dbj|BAD08813.1| unknown protein [Oryza sativa (japon...    38   0.70
gi|38570283|gb|AAR24595.1| troponin T-5 [Drosophila virilis]           38   0.70
gi|38570284|gb|AAR24596.1| troponin T-4 [Drosophila virilis]           38   0.70
gi|5852139|emb|CAB55383.1| hypothetical protein L7836.08 [Leishm...    38   0.70
gi|39581967|emb|CAE73829.1| Hypothetical protein CBG21394 [Caeno...    38   0.70
gi|31238307|ref|XP_319744.1| ENSANGP00000017160 [Anopheles gambi...    38   0.70
gi|38570285|gb|AAR24597.1| troponin T-1 [Drosophila virilis]           38   0.70
gi|24582274|ref|NP_723198.1| CG11098-PB [Drosophila melanogaster...    38   0.70
gi|50742710|ref|XP_419726.1| PREDICTED: similar to Mtap7 protein...    38   0.92
gi|24647168|ref|NP_650467.1| CG6118-PA [Drosophila melanogaster]...    38   0.92
gi|6322209|ref|NP_012284.1| GPI-anchored cell surface glycoprote...    38   0.92
gi|17505713|ref|NP_492684.1| dauer or Aging adult Overexpression...    38   0.92
gi|38109002|gb|EAA54936.1| hypothetical protein MG05727.4 [Magna...    38   0.92
gi|4322936|gb|AAD16137.1| HPK/GCK-like kinase HGK [Homo sapiens]       38   0.92
gi|45550477|ref|NP_611565.2| CG18375-PA [Drosophila melanogaster...    38   0.92
gi|27819843|gb|AAO24970.1| RE13301p [Drosophila melanogaster]          38   0.92
gi|2134123|pir||I51618 nucleolar phosphoprotein - African clawed...    38   0.92
gi|3327188|dbj|BAA31662.1| KIAA0687 protein [Homo sapiens]             38   0.92
gi|29561775|emb|CAD87780.1| SI:dZ258D18.1 (novel protein similar...    38   0.92
gi|22035602|ref|NP_004825.2| mitogen-activated protein kinase ki...    38   0.92
gi|27370871|gb|AAH41236.1| XNopp180 protein [Xenopus laevis]           38   0.92
gi|22035606|ref|NP_663720.1| mitogen-activated protein kinase ki...    38   0.92
gi|627547|pir||A33532 mucin SMUC-40 - human (fragment) >gnl|BL_O...    38   0.92
gi|50732245|ref|XP_418546.1| PREDICTED: similar to PAX transcrip...    38   0.92
gi|25453410|ref|NP_671482.1| calcium channel, voltage-dependent,...    38   0.92
gi|1078707|pir||B53435 vesicular transport-associated repeat pro...    38   0.92
gi|16332372|ref|NP_277028.1| cell division cycle 2-like 1 (PITSL...    38   0.92
gi|24641054|ref|NP_572640.1| CG9817-PA [Drosophila melanogaster]...    38   0.92
gi|348579|pir||A45386 omega-conotoxin-sensitive calcium channel ...    38   0.92
gi|1705855|sp|Q02294|CCAB_RAT Voltage-dependent N-type calcium c...    38   0.92
gi|38105253|gb|EAA51699.1| hypothetical protein MG03294.4 [Magna...    38   0.92
gi|15236054|ref|NP_195694.1| expressed protein [Arabidopsis thal...    38   0.92
gi|10178881|emb|CAC08450.1| Def-6 protein [Homo sapiens]               38   0.92
gi|31213063|ref|XP_315475.1| ENSANGP00000021721 [Anopheles gambi...    38   0.92
gi|31542501|ref|NP_071330.2| differentially expressed in FDCP 6 ...    38   0.92
gi|16332362|ref|NP_277023.1| cell division cycle 2-like 1 (PITSL...    38   0.92
gi|24645053|ref|NP_649795.1| CG7352-PA [Drosophila melanogaster]...    38   0.92
gi|13124365|sp|Q9W705|NCO2_XENLA Nuclear receptor coactivator 2 ...    38   0.92
gi|28573674|ref|NP_788423.1| CG18375-PB [Drosophila melanogaster...    38   0.92
gi|46122089|ref|XP_385598.1| hypothetical protein FG05422.1 [Gib...    38   0.92
gi|49119281|gb|AAH73328.1| XNopp180 protein [Xenopus laevis]           38   0.92
gi|1717773|sp|P06398|TRT3_COTJA Troponin T, fast skeletal muscle...    37   1.2
gi|5524531|gb|AAD44278.1| putative cointegrate resolution protei...    37   1.2
gi|34852596|ref|XP_218094.2| similar to chromosome 6 open readin...    37   1.2
gi|42658491|ref|XP_379883.1| similar to Piccolo protein (Aczonin...    37   1.2
gi|40253888|dbj|BAD05822.1| repressor protein [Oryza sativa (jap...    37   1.2
gi|7511920|pir||T13592 hypothetical protein 66A1.2 - fruit fly (...    37   1.2
gi|42657517|ref|XP_376516.1| myosin VI [Homo sapiens] >gnl|BL_OR...    37   1.2
gi|49235221|ref|ZP_00329293.1| COG1418: Predicted HD superfamily...    37   1.2
gi|41150156|ref|XP_370886.1| similar to FLJ40113 protein [Homo s...    37   1.2
gi|47226837|emb|CAG06679.1| unnamed protein product [Tetraodon n...    37   1.2
gi|18481620|gb|AAL73485.1| repressor protein [Oryza sativa]            37   1.2
gi|5052544|gb|AAD38602.1| scratch [Drosophila melanogaster]            37   1.2
gi|5359759|gb|AAD42799.1| fast troponin T isoform [Coturnix japo...    37   1.2
gi|86461|pir||B31957 troponin T, skeletal muscle, isoform 2 - ch...    37   1.2
gi|33413778|gb|AAN39448.1| normocyte binding protein 2b [Plasmod...    37   1.2
gi|136393|sp|P12620|TRT3_CHICK Troponin T, fast skeletal muscle ...    37   1.2
gi|30698340|dbj|BAC76600.1| fast skeletal muscle troponin T isof...    37   1.2
gi|86463|pir||D31957 troponin T, skeletal muscle, isoform 4 - ch...    37   1.2
gi|12004999|gb|AAG44259.1| fast skeletal muscle troponin T isofo...    37   1.2
gi|40788239|dbj|BAA20843.2| KIAA0389 [Homo sapiens]                    37   1.2
gi|48106581|ref|XP_396127.1| similar to ENSANGP00000013112 [Apis...    37   1.2
gi|8895539|gb|AAF81014.1| fast skeletal muscle troponin T [Mitu ...    37   1.2
gi|23619292|ref|NP_705254.1| Plasmodium falciparum reticulocyte ...    37   1.2
gi|463250|emb|CAA83229.1| Neurofilament protein, high molecular ...    37   1.2
gi|104506|pir||A34327 troponin T, fast skeletal muscle, embryoni...    37   1.2
gi|20151583|gb|AAM11151.1| LD24056p [Drosophila melanogaster]          37   1.2
gi|6753154|ref|NP_033864.1| pre-acrosome localization protein 1 ...    37   1.2
gi|1828|emb|CAA35992.1| trichohyalin [Ovis sp.]                        37   1.2
gi|24657086|ref|NP_523911.2| CG1130-PA [Drosophila melanogaster]...    37   1.2
gi|28830026|gb|AAO52516.1| similar to Kaposi's sarcoma-associate...    37   1.2
gi|13345189|gb|AAK19245.1| reticulocyte binding protein 2 homolo...    37   1.2
gi|46143831|ref|ZP_00133959.2| COG3064: Membrane protein involve...    37   1.2
gi|19424152|ref|NP_598197.1| mucin 10 [Rattus norvegicus] >gnl|B...    37   1.2
gi|50802652|ref|XP_428619.1| PREDICTED: similar to MITF-2B prote...    37   1.2
gi|6684776|gb|AAF23735.1| glycoprotein [Human respiratory syncyt...    37   1.2
gi|507160|gb|AAA19582.1| PITSLRE alpha 2-2                             37   1.2
gi|37573054|dbj|BAC98582.1| putative RNA-binding region RNP-1 an...    37   1.2
gi|1022788|gb|AAA91035.1| neuron specific zinc finger transcript...    37   1.2
gi|46275814|ref|NP_035034.1| neurofilament, heavy polypeptide [M...    37   1.2
gi|46113266|ref|ZP_00182564.2| COG1418: Predicted HD superfamily...    37   1.2
gi|42782863|ref|NP_980110.1| HDIG/HD/KH domain protein [Bacillus...    37   1.2
gi|47568283|ref|ZP_00238986.1| HD/KH domain protein [Bacillus ce...    37   1.2
gi|39594449|emb|CAE72027.1| Hypothetical protein CBG19109 [Caeno...    37   1.6
gi|47077384|dbj|BAD18580.1| unnamed protein product [Homo sapiens]     37   1.6
gi|12311848|emb|CAC22666.1| hypothetical protein L1156.02 [Leish...    37   1.6
gi|32421301|ref|XP_331094.1| predicted protein [Neurospora crass...    37   1.6
gi|16126834|ref|NP_421398.1| hypothetical protein [Caulobacter c...    37   1.6
gi|9280816|gb|AAC51654.2| myosin VI [Homo sapiens]                     37   1.6
gi|49086020|ref|XP_405088.1| hypothetical protein AN0951.2 [Aspe...    37   1.6
gi|627056|pir||A54641 interspersed repeat antigen precursor - ma...    37   1.6
gi|13874522|dbj|BAB46880.1| hypothetical protein [Macaca fascicu...    37   1.6
gi|17550336|ref|NP_510658.1| TBP-Associated transcription Factor...    37   1.6
gi|47222289|emb|CAG05038.1| unnamed protein product [Tetraodon n...    37   1.6
gi|32419006|ref|XP_329981.1| hypothetical protein [Neurospora cr...    37   1.6
gi|50770620|ref|XP_423115.1| PREDICTED: similar to meiosis-speci...    37   1.6
gi|45199064|ref|NP_986093.1| AFR546Wp [Eremothecium gossypii] >g...    37   1.6
gi|32141129|ref|NP_733520.1| hypothetical protein [Streptomyces ...    37   1.6
gi|50730591|ref|XP_416961.1| PREDICTED: hypothetical protein XP_...    37   1.6
gi|39596393|emb|CAE63011.1| Hypothetical protein CBG07253 [Caeno...    37   1.6
gi|47565383|ref|ZP_00236425.1| hypothetical protein protein [Bac...    37   1.6
gi|45361405|ref|NP_989280.1| hypothetical protein MGC76303 [Xeno...    37   1.6
gi|50547915|ref|XP_501427.1| hypothetical protein [Yarrowia lipo...    37   1.6
gi|45552307|ref|NP_995676.1| CG33300-PA [Drosophila melanogaster...    37   1.6
gi|30021870|ref|NP_833501.1| hydrolase (HAD superfamily) [Bacill...    37   1.6
gi|1082284|pir||B54024 protein kinase (EC 2.7.1.37) cdc2-related...    37   1.6
gi|24643078|ref|NP_573313.2| CG6606-PA [Drosophila melanogaster]...    37   2.0
gi|28374176|gb|AAH46263.1| LOC398566 protein [Xenopus laevis]          37   2.0
gi|6320715|ref|NP_010795.1| Protein kinase involved in bud growt...    37   2.0
gi|25141373|ref|NP_491340.2| nuclear protein SET and WW/Rsp5/WWP...    37   2.0
gi|34533778|dbj|BAC86801.1| unnamed protein product [Homo sapiens]     37   2.0
gi|48096459|ref|XP_392462.1| similar to CG18255-PA [Apis mellifera]    37   2.0
gi|50751893|ref|XP_422565.1| PREDICTED: similar to glutamine ric...    37   2.0
gi|32140760|ref|NP_116277.2| collagen, type XXVII, alpha 1 [Homo...    37   2.0
gi|17568717|ref|NP_508293.1| putative protein family member (XC1...    37   2.0
gi|3043566|dbj|BAA25447.1| KIAA0521 protein [Homo sapiens]             37   2.0
gi|32564092|ref|NP_871842.1| nuclear protein SET (1E831) [Caenor...    37   2.0
gi|50414437|gb|AAH77721.1| ARHGEF18 protein [Homo sapiens]             37   2.0
gi|38110219|gb|EAA55974.1| hypothetical protein MG01625.4 [Magna...    37   2.0
gi|6684786|gb|AAF23740.1| glycoprotein [Human respiratory syncyt...    37   2.0
gi|7484379|pir||T07907 hydroxyproline-rich glycoprotein GAS28 pr...    37   2.0
gi|41327769|ref|NP_056133.2| Rho-specific guanine nucleotide exc...    37   2.0
gi|39587535|emb|CAE58473.1| Hypothetical protein CBG01613 [Caeno...    37   2.0
gi|45546669|ref|ZP_00186743.1| COG1418: Predicted HD superfamily...    37   2.0
gi|37790564|gb|AAR03433.1| attachment protein [Human respiratory...    37   2.0
gi|17568719|ref|NP_508292.1| putative protein family member (XC1...    37   2.0
gi|50741992|ref|XP_426157.1| PREDICTED: similar to Peripheral-ty...    37   2.0
gi|4235273|gb|AAD13151.1| M-like protein [Streptococcus pyogenes]      37   2.0
gi|584043|emb|CAA83860.1| G [Human respiratory syncytial virus]        37   2.0
gi|21929808|gb|AAM82004.1| attachment glycoprotein [Human respir...    37   2.0
gi|584038|emb|CAA83878.1| G [Human respiratory syncytial virus]        37   2.0
gi|41054113|ref|NP_956149.1| Unknown (protein for MGC:64185); wu...    37   2.0
gi|25395254|pir||B87754 protein C43E11.3 [imported] - Caenorhabd...    37   2.0
gi|7495155|pir||T29265 hypothetical protein C01G8.7 - Caenorhabd...    37   2.0
gi|28871907|ref|NP_794526.1| conserved hypothetical protein [Pse...    37   2.0
gi|16332325|ref|NP_443053.1| eukaryotic protein kinase [Synechoc...    37   2.0
gi|19115480|ref|NP_594568.1| hypothetical coiled-coil protein; t...    37   2.0
gi|46127825|ref|XP_388466.1| hypothetical protein FG08290.1 [Gib...    37   2.0
gi|21243239|ref|NP_642821.1| hypothetical protein [Xanthomonas a...    37   2.0
gi|32452989|gb|AAP82647.1| Hypothetical protein K06A9.1c [Caenor...    37   2.0
gi|23613070|ref|NP_703392.1| hypothetical protein [Plasmodium fa...    37   2.0
gi|32403722|ref|XP_322474.1| hypothetical protein [Neurospora cr...    37   2.0
gi|50757955|ref|XP_425376.1| PREDICTED: similar to Envoplakin (2...    37   2.0
gi|37790566|gb|AAR03434.1| attachment protein [Human respiratory...    37   2.0
gi|37790574|gb|AAR03438.1| attachment protein [Human respiratory...    37   2.0
gi|30262170|ref|NP_844547.1| conserved domain protein [Bacillus ...    37   2.0
gi|37790572|gb|AAR03437.1| attachment protein [Human respiratory...    37   2.0
gi|47211224|emb|CAF92780.1| unnamed protein product [Tetraodon n...    37   2.0
gi|15793701|ref|NP_283523.1| hypothetical protein NMA0724 [Neiss...    37   2.0
gi|38103658|gb|EAA50334.1| hypothetical protein MG04093.4 [Magna...    37   2.0
gi|25144050|ref|NP_491562.2| ARID  protein and XYPPX repeat (1F8...    37   2.0
gi|22749548|gb|AAH14491.2| FLJ10300 protein [Homo sapiens]             36   2.7
gi|39591417|emb|CAE73471.1| Hypothetical protein CBG20922 [Caeno...    36   2.7
gi|50254710|gb|EAL17456.1| hypothetical protein CNBM1490 [Crypto...    36   2.7
gi|26989701|ref|NP_745126.1| Tn4652, cointegrate resolution prot...    36   2.7
gi|37595234|gb|AAQ94502.1| M protein [Streptococcus pyogenes]          36   2.7
gi|18157515|dbj|BAB83833.1| TnpT protein [Pseudomonas putida]          36   2.7
gi|1708901|sp|P50468|M21_STRPY M protein, serotype 2.1 precursor...    36   2.7
gi|17561266|ref|NP_505801.1| protein of unknown function C6 and ...    36   2.7
gi|14423720|sp|Q9CD58|FTSH_MYCLE Cell division protein ftsH homo...    36   2.7
gi|25009850|gb|AAN71095.1| AT22221p [Drosophila melanogaster]          36   2.7
gi|9630970|ref|NP_047640.1| mucin-like protein [Lymantria dispar...    36   2.7
gi|601931|gb|AAA57153.1| neurofilament-H                               36   2.7
gi|42568067|ref|NP_197850.2| thaumatin-like protein, putative [A...    36   2.7
gi|345498|pir||A44400 myosin heavy chain 95F - fruit fly (Drosop...    36   2.7
gi|24649614|ref|NP_732976.1| CG5695-PB [Drosophila melanogaster]...    36   2.7
gi|15827019|ref|NP_301282.1| putative integral membrane peptidas...    36   2.7
gi|37541927|ref|XP_291989.2| similar to hypothetical protein [Ho...    36   2.7
gi|28557619|gb|AAO45215.1| RE25996p [Drosophila melanogaster]          36   2.7
gi|9759597|dbj|BAB11454.1| unnamed protein product [Arabidopsis ...    36   2.7
gi|29840918|gb|AAP05919.1| hypothetical protein [Schistosoma jap...    36   2.7
gi|41203728|ref|XP_373596.1| hypothetical protein XP_378464 [Hom...    36   2.7
gi|37790560|gb|AAR03431.1| attachment protein [Human respiratory...    36   2.7
gi|1082604|pir||S53363 mucin 5AC (clone JER58) - human (fragment...    36   2.7
gi|6684774|gb|AAF23734.1| glycoprotein [Human respiratory syncyt...    36   2.7
gi|45549229|ref|NP_524478.3| CG5695-PA [Drosophila melanogaster]...    36   2.7
gi|34875652|ref|XP_217381.2| similar to Traf2 and NCK interactin...    36   2.7
gi|32404122|ref|XP_322674.1| hypothetical protein [Neurospora cr...    36   2.7
gi|16182353|gb|AAL13482.1| GH01409p [Drosophila melanogaster]          36   2.7
gi|42569129|ref|NP_179444.2| cupin family protein [Arabidopsis t...    36   2.7
gi|28829856|gb|AAO52358.1| similar to Mus musculus (Mouse). 13 d...    36   2.7
gi|24647164|ref|NP_650466.2| CG5166-PA [Drosophila melanogaster]...    36   2.7
gi|47226278|emb|CAG09246.1| unnamed protein product [Tetraodon n...    36   2.7
gi|40888884|gb|AAR97288.1| DIF insensitive mutant A [Dictyosteli...    36   2.7
gi|39593575|emb|CAE61867.1| Hypothetical protein CBG05845 [Caeno...    36   2.7
gi|30685162|ref|NP_188532.2| leucine-rich repeat family protein ...    36   2.7
gi|48143507|ref|XP_397439.1| similar to ENSANGP00000015381 [Apis...    36   2.7
gi|22960408|ref|ZP_00008049.1| COG0532: Translation initiation f...    36   2.7
gi|34864325|ref|XP_236385.2| similar to KIAA1749 protein [Rattus...    36   2.7
gi|34785442|gb|AAH57524.1| LOC402861 protein [Danio rerio]             36   2.7
gi|38110797|gb|EAA56463.1| hypothetical protein MG06434.4 [Magna...    36   2.7
gi|34485666|gb|AAQ73218.1| M protein [Streptococcus pyogenes]          36   2.7
gi|41054391|ref|NP_955997.1| misshapen; wu:fc52d11 [Danio rerio]...    36   2.7
gi|21751020|dbj|BAC03887.1| unnamed protein product [Homo sapiens]     36   2.7
gi|21243587|ref|NP_643169.1| hypothetical protein [Xanthomonas a...    36   2.7
gi|5737842|gb|AAD50121.1| adenylyl cyclase [Dictyostelium discoi...    36   2.7
gi|50556614|ref|XP_505715.1| hypothetical protein [Yarrowia lipo...    36   2.7
gi|28571738|ref|NP_732034.2| CG5166-PC [Drosophila melanogaster]...    36   2.7
gi|31241699|ref|XP_321280.1| ENSANGP00000008441 [Anopheles gambi...    36   2.7
gi|25411878|pir||E84565 hypothetical protein At2g18540 [imported...    36   2.7
gi|24647162|ref|NP_732033.1| CG5166-PB [Drosophila melanogaster]...    36   2.7
gi|21400020|ref|NP_656005.1| hypothetical protein predicted by G...    36   2.7
gi|37790524|gb|AAR03413.1| attachment protein [Human respiratory...    36   2.7
gi|20259488|gb|AAM13864.1| unknown protein [Arabidopsis thaliana]      36   2.7
gi|16800504|ref|NP_470772.1| similar to unknown protein [Listeri...    36   2.7
gi|507162|gb|AAA19583.1| PITSLRE alpha 2-3                             36   2.7
gi|4204915|gb|AAD10849.1| ladinin [Homo sapiens]                       36   3.5
gi|7716519|gb|AAF68415.1| putative filamentous hemagglutinin [Pa...    36   3.5
gi|29251008|gb|EAA42494.1| GLP_587_87663_89534 [Giardia lamblia ...    36   3.5


>gi|7500077|pir||T21503 hypothetical protein F28D9.1 - Caenorhabditis
            elegans
          Length = 335

 Score =  379 bits (973), Expect = e-103
 Identities = 186/186 (100%), Positives = 186/186 (100%)
 Frame = -1

Query: 1806 MDAGYFRGANSEQDGRFSDKEKKLLKTMKFEPQLEQKIDLNRCNMDVIKPWITARVNDIL 1627
            MDAGYFRGANSEQDGRFSDKEKKLLKTMKFEPQLEQKIDLNRCNMDVIKPWITARVNDIL
Sbjct: 1    MDAGYFRGANSEQDGRFSDKEKKLLKTMKFEPQLEQKIDLNRCNMDVIKPWITARVNDIL 60

Query: 1626 GMEDDVVVEYILSQIDDKNLNPKLLQINVTGFLNARRAREFVGDLWNLLIEANASEDGIP 1447
            GMEDDVVVEYILSQIDDKNLNPKLLQINVTGFLNARRAREFVGDLWNLLIEANASEDGIP
Sbjct: 61   GMEDDVVVEYILSQIDDKNLNPKLLQINVTGFLNARRAREFVGDLWNLLIEANASEDGIP 120

Query: 1446 ASLVNQKMAEMKTNDRDEKGDDREDNDWTNRYKTLSNGRYTGPAREKAVRDDRIPARALS 1267
            ASLVNQKMAEMKTNDRDEKGDDREDNDWTNRYKTLSNGRYTGPAREKAVRDDRIPARALS
Sbjct: 121  ASLVNQKMAEMKTNDRDEKGDDREDNDWTNRYKTLSNGRYTGPAREKAVRDDRIPARALS 180

Query: 1266 PRKTPP 1249
            PRKTPP
Sbjct: 181  PRKTPP 186



 Score = 50.1 bits (118), Expect = 2e-04
 Identities = 23/23 (100%), Positives = 23/23 (100%)
 Frame = -1

Query: 234 DSEQQAPVAVKSPEMKKRRPNDT 166
           DSEQQAPVAVKSPEMKKRRPNDT
Sbjct: 259 DSEQQAPVAVKSPEMKKRRPNDT 281


>gi|25143299|ref|NP_492875.2| pre-mRNA splicing SR protein related
            (68.2 kD) (rsr-1) [Caenorhabditis elegans]
 gi|19571645|emb|CAB04214.3| Hypothetical protein F28D9.1
            [Caenorhabditis elegans]
          Length = 601

 Score =  379 bits (973), Expect = e-103
 Identities = 186/186 (100%), Positives = 186/186 (100%)
 Frame = -1

Query: 1806 MDAGYFRGANSEQDGRFSDKEKKLLKTMKFEPQLEQKIDLNRCNMDVIKPWITARVNDIL 1627
            MDAGYFRGANSEQDGRFSDKEKKLLKTMKFEPQLEQKIDLNRCNMDVIKPWITARVNDIL
Sbjct: 1    MDAGYFRGANSEQDGRFSDKEKKLLKTMKFEPQLEQKIDLNRCNMDVIKPWITARVNDIL 60

Query: 1626 GMEDDVVVEYILSQIDDKNLNPKLLQINVTGFLNARRAREFVGDLWNLLIEANASEDGIP 1447
            GMEDDVVVEYILSQIDDKNLNPKLLQINVTGFLNARRAREFVGDLWNLLIEANASEDGIP
Sbjct: 61   GMEDDVVVEYILSQIDDKNLNPKLLQINVTGFLNARRAREFVGDLWNLLIEANASEDGIP 120

Query: 1446 ASLVNQKMAEMKTNDRDEKGDDREDNDWTNRYKTLSNGRYTGPAREKAVRDDRIPARALS 1267
            ASLVNQKMAEMKTNDRDEKGDDREDNDWTNRYKTLSNGRYTGPAREKAVRDDRIPARALS
Sbjct: 121  ASLVNQKMAEMKTNDRDEKGDDREDNDWTNRYKTLSNGRYTGPAREKAVRDDRIPARALS 180

Query: 1266 PRKTPP 1249
            PRKTPP
Sbjct: 181  PRKTPP 186



 Score = 52.0 bits (123), Expect = 5e-05
 Identities = 24/24 (100%), Positives = 24/24 (100%)
 Frame = -1

Query: 237 QDSEQQAPVAVKSPEMKKRRPNDT 166
           QDSEQQAPVAVKSPEMKKRRPNDT
Sbjct: 524 QDSEQQAPVAVKSPEMKKRRPNDT 547



 Score = 43.1 bits (100), Expect = 0.022
 Identities = 29/156 (18%), Positives = 64/156 (40%)
 Frame = -3

Query: 874 EEPPASEKTPLTISIQEPSSKKSKIQIEKPTGSSKKKKIPVSFEKPTXXXXXXXXXXXXX 695
           + PP + +       + P+ K++K + + P   +++++ P + + P
Sbjct: 312 KSPPPARRRRSPSQSKSPAPKRAKSRSKSPPAPARRRRSPSASKSPPPAPKRAKSRS--- 368

Query: 694 XXSETPISVSFKEPTGSTKTPLPVQIQKPGSKKRNSSSSETPIPVSFKEPTGSKKSQI*I 515
              ++P +   + P+ S   P P + + P   +  +   E P     + P+ SK
Sbjct: 369 ---KSPPARRRRSPSASKSPPAPRRRRSPSKSRSPAPKREIPPARRRRSPSASKSPPAPK 425

Query: 514 QKPSGSKTXXXXXXXQKPGSTKTPLPVEKPTGSKTP 407
           +  S SK+       + P  +K+P P  + + SK+P
Sbjct: 426 RAKSRSKSPPAPRRRRSPSQSKSPAPRRRRSPSKSP 461


>gi|25375097|pir||H87917 protein F28D9.1 [imported] - Caenorhabditis
            elegans
          Length = 279

 Score =  379 bits (973), Expect = e-103
 Identities = 186/186 (100%), Positives = 186/186 (100%)
 Frame = -1

Query: 1806 MDAGYFRGANSEQDGRFSDKEKKLLKTMKFEPQLEQKIDLNRCNMDVIKPWITARVNDIL 1627
            MDAGYFRGANSEQDGRFSDKEKKLLKTMKFEPQLEQKIDLNRCNMDVIKPWITARVNDIL
Sbjct: 1    MDAGYFRGANSEQDGRFSDKEKKLLKTMKFEPQLEQKIDLNRCNMDVIKPWITARVNDIL 60

Query: 1626 GMEDDVVVEYILSQIDDKNLNPKLLQINVTGFLNARRAREFVGDLWNLLIEANASEDGIP 1447
            GMEDDVVVEYILSQIDDKNLNPKLLQINVTGFLNARRAREFVGDLWNLLIEANASEDGIP
Sbjct: 61   GMEDDVVVEYILSQIDDKNLNPKLLQINVTGFLNARRAREFVGDLWNLLIEANASEDGIP 120

Query: 1446 ASLVNQKMAEMKTNDRDEKGDDREDNDWTNRYKTLSNGRYTGPAREKAVRDDRIPARALS 1267
            ASLVNQKMAEMKTNDRDEKGDDREDNDWTNRYKTLSNGRYTGPAREKAVRDDRIPARALS
Sbjct: 121  ASLVNQKMAEMKTNDRDEKGDDREDNDWTNRYKTLSNGRYTGPAREKAVRDDRIPARALS 180

Query: 1266 PRKTPP 1249
            PRKTPP
Sbjct: 181  PRKTPP 186



 Score = 34.7 bits (78), Expect = 7.8
 Identities = 15/15 (100%), Positives = 15/15 (100%)
 Frame = -3

Query: 58  KTPKTPFTKRIRIGI 14
           KTPKTPFTKRIRIGI
Sbjct: 265 KTPKTPFTKRIRIGI 279




[DB home][top]