Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F29B9_4
(540 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|14550374|gb|AAK67231.1| Hypothetical protein F29B9.5 [Caenorh... 369 e-101
gi|7500138|pir||T29930 hypothetical protein F29B9.5 - Caenorhabd... 358 4e-98
gi|39587621|emb|CAE58559.1| Hypothetical protein CBG01721 [Caeno... 311 6e-84
gi|39589121|emb|CAE57854.1| Hypothetical protein CBG00891 [Caeno... 154 1e-36
gi|17537401|ref|NP_494757.1| thioredoxin family member (2E596) [... 150 1e-35
gi|17535459|ref|NP_496200.1| thioredoxin family member (17.3 kD)... 146 2e-34
gi|39595082|emb|CAE60119.1| Hypothetical protein CBG03662 [Caeno... 141 8e-33
gi|39580153|emb|CAE56273.1| Hypothetical protein CBG23918 [Caeno... 136 2e-31
gi|17539056|ref|NP_500478.1| thioredoxin family member (17.0 kD)... 130 1e-29
gi|45861991|gb|AAS78778.1| thioredoxin [Ascaris suum] 127 1e-28
gi|39597070|emb|CAE59297.1| Hypothetical protein CBG02632 [Caeno... 115 4e-25
gi|47219909|emb|CAF97179.1| unnamed protein product [Tetraodon n... 115 5e-25
gi|17532245|ref|NP_495275.1| thioredoxin family member (2G632) [... 114 1e-24
gi|23598166|gb|AAN34969.1| thioredoxin 1; ov-thioredoxin 1 [Onch... 112 5e-24
gi|23598164|gb|AAN34968.1| thioredoxin; wb-Thioredoxin [Wucherer... 110 1e-23
gi|21436483|gb|AAM51563.1| thioredoxin [Brugia malayi] >gnl|BL_O... 109 3e-23
gi|19698793|gb|AAL91107.1| thioredoxin [Brugia malayi] 106 2e-22
gi|17564492|ref|NP_503954.1| predicted CDS, thioredoxin family m... 105 6e-22
gi|23598162|gb|AAN34967.1| thioredoxin 2; ov-thioredoxin 2 [Onch... 103 1e-21
gi|7505193|pir||T33313 hypothetical protein K02H11.6 - Caenorhab... 102 4e-21
gi|25153934|ref|NP_503440.2| predicted CDS, thioredoxin family m... 102 4e-21
gi|17541496|ref|NP_500578.1| thioredoxin family member (4F253) [... 98 8e-20
gi|32452987|gb|AAB09142.2| Hypothetical protein M01H9.1 [Caenorh... 98 8e-20
gi|17538896|ref|NP_503101.1| thioredoxin family member (20.1 kD)... 97 1e-19
gi|39585201|emb|CAE57444.1| Hypothetical protein CBG00406 [Caeno... 96 4e-19
gi|39587599|emb|CAE58537.1| Hypothetical protein CBG01696 [Caeno... 96 4e-19
gi|49256203|gb|AAH71162.1| Unknown (protein for MGC:83491) [Xeno... 96 5e-19
gi|34874056|ref|XP_344575.1| similar to RIKEN cDNA 4930519N16 [R... 93 3e-18
gi|22165362|ref|NP_083449.1| RIKEN cDNA 4930519N16 [Mus musculus... 92 6e-18
gi|17564844|ref|NP_503892.1| predicted CDS, thioredoxin (5D726) ... 92 7e-18
gi|31415911|gb|AAP50932.1| putative trypanothione-dependent pero... 91 2e-17
gi|4056568|gb|AAD04231.1| PDI-like protein [Zea mays] 86 3e-16
gi|21592996|gb|AAM64945.1| PDI-like protein [Arabidopsis thaliana] 86 4e-16
gi|18406743|ref|NP_564756.1| DC1 domain-containing protein [Arab... 86 4e-16
gi|31415915|gb|AAP50936.1| putative trypanothione-dependent pero... 86 5e-16
gi|50758318|ref|XP_415863.1| PREDICTED: similar to red-1 [Gallus... 84 2e-15
gi|13435627|gb|AAH04688.1| Nxn protein [Mus musculus] 84 2e-15
gi|6679160|ref|NP_032776.1| nucleoredoxin [Mus musculus] >gnl|BL... 84 2e-15
gi|34872883|ref|XP_340858.1| similar to red-1 [Rattus norvegicus] 84 2e-15
gi|23304737|emb|CAC87937.1| PDI-like protein [Quercus suber] 83 3e-15
gi|41393676|gb|AAS02080.1| protein disulfide isomerase [Quercus ... 83 3e-15
gi|7507212|pir||T24545 hypothetical protein T05F1.11 - Caenorhab... 83 3e-15
gi|32563627|ref|NP_492564.2| putative nuclear protein family mem... 83 3e-15
gi|33991273|gb|AAH09327.2| NXN protein [Homo sapiens] 82 6e-15
gi|49522545|gb|AAH73845.1| NXN protein [Homo sapiens] 82 6e-15
gi|33149331|ref|NP_071908.2| nucleoredoxin; nucleoredoxin 1 [Hom... 82 6e-15
gi|48141594|ref|XP_397245.1| similar to red-1 [Apis mellifera] 82 8e-15
gi|50796126|ref|XP_423839.1| PREDICTED: similar to RIKEN cDNA 49... 82 8e-15
gi|49256234|gb|AAH74275.1| Unknown (protein for MGC:84045) [Xeno... 80 2e-14
gi|18417767|ref|NP_567869.1| expressed protein [Arabidopsis thal... 77 2e-13
gi|17506685|ref|NP_493308.1| putative cytoplasmic protein family... 74 1e-12
gi|8569430|pdb|1EZK|A Chain A, Crystal Structure Of Recombinant ... 74 2e-12
gi|8569420|pdb|1EWX|A Chain A, Crystal Structure Of Native Trypa... 74 2e-12
gi|8569320|pdb|1QK8|A Chain A, Tryparedoxin-I From Crithidia Fas... 74 2e-12
gi|34810146|pdb|1OKD|A Chain A, Nmr-Structure Of Tryparedoxin 1 74 2e-12
gi|16740634|gb|AAH16199.1| 4930519N16Rik protein [Mus musculus] 73 3e-12
gi|6175375|gb|AAF04973.1| tryparedoxin [Trypanosoma cruzi] 73 3e-12
gi|38567893|emb|CAE03648.2| OSJNBa0060N03.13 [Oryza sativa (japo... 73 3e-12
gi|41018378|sp|O77404|TYPX_TRYBB Tryparedoxin >gnl|BL_ORD_ID|643... 73 4e-12
gi|44889412|gb|AAS48351.1| mitochondrial tryparedoxin [Leishmani... 73 4e-12
gi|34908844|ref|NP_915769.1| PDI-like protein [Oryza sativa (jap... 71 1e-11
gi|19171158|emb|CAC85916.1| tryparedoxin [Trypanosoma cruzi] 70 2e-11
gi|3676476|gb|AAC61984.1| tryparedoxin II [Crithidia fasciculata] 70 2e-11
gi|27574271|pdb|1O81|A Chain A, Tryparedoxin Ii From C.Fascicula... 70 2e-11
gi|30749849|pdb|1O8X|A Chain A, Mutant Tryparedoxin-I Cys43ala 70 2e-11
gi|44889410|gb|AAS48350.1| tryparedoxin [Leishmania infantum] 70 2e-11
gi|27066375|pdb|1O6J|A Chain A, Tryparedoxin Ii From C.Fascicula... 70 2e-11
gi|14278309|pdb|1FG4|A Chain A, Structure Of Tryparedoxin Ii >gn... 70 2e-11
gi|29726921|pdb|1OC9|A Chain A, Tryparedoxin Ii From C.Fascicula... 69 7e-11
gi|13787131|pdb|1I5G|A Chain A, Tryparedoxin Ii Complexed With G... 66 3e-10
gi|7486675|pir||T04491 hypothetical protein F8F16.60 - Arabidops... 66 4e-10
gi|34908848|ref|NP_915771.1| PDI-like protein [Oryza sativa (jap... 65 6e-10
gi|21699084|ref|NP_660326.1| chromosome 9 open reading frame 121... 64 2e-09
gi|28626437|gb|AAO44001.1| tryparedoxin [Trypanosoma cruzi] >gnl... 62 8e-09
gi|28626435|gb|AAO44000.1| tryparedoxin [Trypanosoma cruzi] 61 1e-08
gi|19923987|ref|NP_612463.1| hypothetical protein BC014127; rod-... 60 3e-08
gi|34877784|ref|XP_224718.2| similar to hypothetical protein BC0... 59 7e-08
gi|50794394|ref|XP_423688.1| PREDICTED: similar to RIKEN cDNA A9... 59 7e-08
gi|21704204|ref|NP_663573.1| thioredoxin-like 6 [Mus musculus] >... 58 9e-08
gi|23480906|gb|EAA17344.1| PDI-like protein-related [Plasmodium ... 57 2e-07
gi|47223917|emb|CAG06094.1| unnamed protein product [Tetraodon n... 55 8e-07
gi|7488267|pir||T04492 protein kinase homolog F8F16.70 - Arabido... 54 2e-06
gi|42524350|ref|NP_969730.1| thiol:disulfide interchange protein... 53 4e-06
gi|23613711|ref|NP_704732.1| hypothetical protein [Plasmodium fa... 53 4e-06
gi|22035894|emb|CAD43149.1| putative PDI-like protein [Toxoplasm... 51 1e-05
gi|46579997|ref|YP_010805.1| thioredoxin family protein [Desulfo... 50 3e-05
gi|29346702|ref|NP_810205.1| thiol:disulfide interchange protein... 50 3e-05
gi|48854964|ref|ZP_00309124.1| COG0526: Thiol-disulfide isomeras... 49 4e-05
gi|34395959|sp|P35160|RESA_BACSU Thiol-disulfide oxidoreductase ... 49 7e-05
gi|16079372|ref|NP_390196.1| essential protein similar to cytoch... 49 7e-05
gi|49259146|pdb|1ST9|A Chain A, Crystal Structure Of A Soluble D... 49 7e-05
gi|44004529|ref|NP_982197.1| cytochrome c biogenesis protein, pu... 47 2e-04
gi|48845155|ref|ZP_00299442.1| COG0526: Thiol-disulfide isomeras... 46 4e-04
gi|39996423|ref|NP_952374.1| thioredoxin family protein [Geobact... 46 4e-04
gi|39794699|gb|AAH63828.1| NXN protein [Homo sapiens] 46 4e-04
gi|23474644|ref|ZP_00129937.1| COG0526: Thiol-disulfide isomeras... 44 0.002
gi|48853637|ref|ZP_00307805.1| COG0526: Thiol-disulfide isomeras... 43 0.004
gi|48861343|ref|ZP_00315246.1| COG0526: Thiol-disulfide isomeras... 42 0.007
gi|16877842|gb|AAH17153.1| Txnl6 protein [Mus musculus] 42 0.009
gi|30021713|ref|NP_833344.1| Thiol:disulfide interchange protein... 41 0.012
gi|15605725|ref|NP_213102.1| thiol disulfide interchange protein... 41 0.012
gi|15900873|ref|NP_345477.1| thioredoxin family protein [Strepto... 41 0.015
gi|47227788|emb|CAG08951.1| unnamed protein product [Tetraodon n... 41 0.015
gi|42782682|ref|NP_979929.1| ahpC/TSA family protein [Bacillus c... 41 0.015
gi|15902948|ref|NP_358498.1| Conserved hypothetical protein [Str... 41 0.015
gi|34556527|ref|NP_906342.1| PUTATIVE LIPOPROTEIN THIREDOXIN [Wo... 40 0.020
gi|47227790|emb|CAG08953.1| unnamed protein product [Tetraodon n... 40 0.020
gi|21401535|ref|NP_657520.1| AhpC-TSA, AhpC/TSA family [Bacillus... 40 0.020
gi|47567895|ref|ZP_00238602.1| thioredoxin family protein [Bacil... 40 0.033
gi|34541283|ref|NP_905762.1| thioredoxin family protein [Porphyr... 39 0.044
gi|48861502|ref|ZP_00315403.1| COG0526: Thiol-disulfide isomeras... 39 0.044
gi|47569146|ref|ZP_00239834.1| thiol:disulfide interchange prote... 39 0.044
gi|39998369|ref|NP_954320.1| thioredoxin-related protein [Geobac... 39 0.057
gi|15614140|ref|NP_242443.1| cytochrome c biogenesis (thioredoxi... 39 0.057
gi|23099137|ref|NP_692603.1| cytochrome c biogenesis [Oceanobaci... 39 0.057
gi|48831057|ref|ZP_00288139.1| COG0526: Thiol-disulfide isomeras... 39 0.057
gi|4100188|gb|AAD00775.1| thioredoxin [Treponema pallidum] 38 0.097
gi|15639094|ref|NP_218540.1| thioredoxin, putative [Treponema pa... 38 0.097
gi|46321068|ref|ZP_00221448.1| COG0526: Thiol-disulfide isomeras... 38 0.097
gi|46198796|ref|YP_004463.1| thiol:disulfide interchange protein... 38 0.097
gi|16078448|ref|NP_389267.1| ykvV [Bacillus subtilis subsp. subt... 38 0.097
gi|21399393|ref|NP_655378.1| AhpC-TSA, AhpC/TSA family [Bacillus... 38 0.097
gi|30019621|ref|NP_831252.1| ResA protein [Bacillus cereus ATCC ... 38 0.097
gi|49480308|ref|YP_035959.1| thioredoxin family protein [Bacillu... 38 0.097
gi|42780922|ref|NP_978169.1| thioredoxin family protein [Bacillu... 38 0.097
gi|23098307|ref|NP_691773.1| cytochrome c biogenesis [Oceanobaci... 38 0.097
gi|21673850|ref|NP_661915.1| thiol:disulfide interchange protein... 37 0.17
gi|46315997|ref|ZP_00216577.1| COG0526: Thiol-disulfide isomeras... 37 0.17
gi|23099277|ref|NP_692743.1| cytochrome c biogenesis [Oceanobaci... 37 0.17
gi|20140734|sp|Q98TX1|THIO_OPHHA Thioredoxin >gnl|BL_ORD_ID|7088... 37 0.17
gi|21757496|dbj|BAC05133.1| unnamed protein product [Homo sapiens] 37 0.17
gi|47575097|ref|ZP_00245132.1| COG0526: Thiol-disulfide isomeras... 37 0.17
gi|32475489|ref|NP_868483.1| probable thioredoxin [Pirellula sp.... 37 0.22
gi|11362710|pir||T50864 thioredoxin-like protein [imported] - Ho... 37 0.22
gi|11358957|pir||T50865 thioredoxin-like protein [imported] - pe... 37 0.22
gi|15894825|ref|NP_348174.1| Thioredoxin, trx [Clostridium aceto... 37 0.22
gi|48862305|ref|ZP_00316202.1| COG0526: Thiol-disulfide isomeras... 37 0.22
gi|24637231|gb|AAN63619.1| thioredoxin h-like protein [Nicotiana... 37 0.22
gi|48862666|ref|ZP_00316561.1| COG0526: Thiol-disulfide isomeras... 37 0.28
gi|21244602|ref|NP_644184.1| disulphide-isomerase [Xanthomonas a... 37 0.28
gi|11362711|pir||T50862 thioredoxin-like protein [imported] - Ph... 37 0.28
gi|34499734|ref|NP_903949.1| thioredoxin-related transmembrane p... 37 0.28
gi|27734590|sp|Q9V429|THI2_DROME Thioredoxin 2 (DmTrx-2) >gnl|BL... 37 0.28
gi|17648013|ref|NP_523526.1| CG31884-PA [Drosophila melanogaster... 37 0.28
gi|1086147|pir||S49353 protein S2 - Phalaris coerulescens 37 0.28
gi|48845548|ref|ZP_00299826.1| COG0526: Thiol-disulfide isomeras... 37 0.28
gi|1085952|pir||S49352 protein S1 - Phalaris coerulescens 37 0.28
gi|34499712|ref|NP_903927.1| probable thioredoxin [Chromobacteri... 36 0.37
gi|30580603|sp|O96952|THIO_GEOCY Thioredoxin >gnl|BL_ORD_ID|1666... 36 0.37
gi|50877972|emb|CAG37812.1| related to cytochrome c biogenesis p... 36 0.37
gi|32474228|ref|NP_867222.1| probable thioredoxin related protei... 36 0.37
gi|47565510|ref|ZP_00236551.1| cytochrome c biogenesis protein, ... 36 0.37
gi|23007581|ref|ZP_00049389.1| COG0526: Thiol-disulfide isomeras... 36 0.48
gi|11135129|sp|O64432|THIH_BRARA Thioredoxin H-type (TRX-H) >gnl... 36 0.48
gi|11135277|sp|Q42388|THH1_BRANA Thioredoxin H-type 1 (TRX-H-1) ... 36 0.48
gi|27806783|ref|NP_776393.1| thioredoxin [Bos taurus] >gnl|BL_OR... 36 0.48
gi|339649|gb|AAA74596.1| thioredoxin >gnl|BL_ORD_ID|1573571 gi|9... 36 0.48
gi|24158968|pdb|1M7T|A Chain A, Solution Structure And Dynamics ... 36 0.48
gi|47523692|ref|NP_999478.1| thioredoxin [Sus scrofa] >gnl|BL_OR... 36 0.48
gi|11494247|gb|AAG35777.1| thioredoxin-h-like protein 1 [Brassic... 36 0.48
gi|44004543|ref|NP_982212.1| thioredoxin, putative [Bacillus cer... 36 0.48
gi|1729950|sp|P50413|THIO_SHEEP Thioredoxin >gnl|BL_ORD_ID|10029... 36 0.48
gi|47223916|emb|CAG06093.1| unnamed protein product [Tetraodon n... 36 0.48
gi|24372005|ref|NP_716047.1| hypothetical protein SO0409 [Shewan... 36 0.48
gi|24373660|ref|NP_717703.1| thioredoxin family protein [Shewane... 36 0.48
gi|46113775|ref|ZP_00200900.1| COG0526: Thiol-disulfide isomeras... 36 0.48
gi|48853471|ref|ZP_00307641.1| COG0526: Thiol-disulfide isomeras... 35 0.63
gi|41054259|ref|NP_956073.1| protein disulfide isomerase related... 35 0.63
gi|39645929|gb|AAH63979.1| Protein disulfide isomerase related p... 35 0.63
gi|17545554|ref|NP_518956.1| CONSERVED HYPOTHETICAL PROTEIN [Ral... 35 0.63
gi|20140452|sp|O97508|THIO_HORSE Thioredoxin >gnl|BL_ORD_ID|1070... 35 0.63
gi|50592994|ref|NP_003320.2| thioredoxin [Homo sapiens] >gnl|BL_... 35 0.63
gi|267126|sp|P29451|THIO_MACMU Thioredoxin >gnl|BL_ORD_ID|675440... 35 0.63
gi|30584095|gb|AAP36296.1| Homo sapiens thioredoxin [synthetic c... 35 0.63
gi|230939|pdb|3TRX| Thioredoxin (Reduced Form) >gnl|BL_ORD_ID|4... 35 0.63
gi|2392150|pdb|1AIU| Human Thioredoxin (D60n Mutant, Reduced Form) 35 0.63
gi|640449|pdb|1TRS| Thioredoxin Mutant With Cys 62 Replaced By ... 35 0.63
gi|1827675|pdb|1ERV| Human Thioredoxin Mutant With Cys 73 Repla... 35 0.63
gi|34877964|ref|XP_237591.2| similar to spermatid-specific thior... 35 0.63
gi|47573051|ref|ZP_00243091.1| COG0526: Thiol-disulfide isomeras... 35 0.63
gi|15615431|ref|NP_243734.1| thiol/disulfide interchange protein... 35 0.63
gi|25029368|ref|NP_739422.1| putative thioredoxin [Corynebacteri... 35 0.63
gi|23957713|ref|NP_705844.1| thioredoxin-like redox-active prote... 35 0.82
gi|47223486|emb|CAF97973.1| unnamed protein product [Tetraodon n... 35 0.82
gi|46362893|ref|ZP_00198057.2| COG0526: Thiol-disulfide isomeras... 35 0.82
gi|38048645|gb|AAR10225.1| similar to Drosophila melanogaster th... 35 0.82
gi|29477099|gb|AAH50132.1| Thioredoxin domain-containing 2 [Homo... 35 0.82
gi|42516570|ref|NP_115619.4| thioredoxin domain-containing 2; sp... 35 0.82
gi|22974690|ref|ZP_00020860.1| hypothetical protein [Chloroflexu... 35 0.82
gi|19704458|ref|NP_604020.1| Thioredoxin-like protein [Fusobacte... 35 0.82
gi|30261828|ref|NP_844205.1| thioredoxin family protein [Bacillu... 35 0.82
gi|30019866|ref|NP_831497.1| Thiol:disulfide interchange protein... 35 0.82
gi|22972679|ref|ZP_00019544.1| hypothetical protein [Chloroflexu... 35 0.82
gi|27367008|ref|NP_762535.1| Thiol-disulfide isomerase [Vibrio v... 35 0.82
gi|42523669|ref|NP_969049.1| cytochrome c biogenesis (thioredoxi... 35 0.82
gi|48858333|ref|ZP_00312290.1| COG0526: Thiol-disulfide isomeras... 35 1.1
gi|15596150|ref|NP_249644.1| probable thioredoxin [Pseudomonas a... 35 1.1
gi|24637225|gb|AAN63616.1| thioredoxin h-like protein [Hordeum v... 35 1.1
gi|27543511|gb|AAO16555.1| thioredoxin h [Leymus chinensis] 35 1.1
gi|23014510|ref|ZP_00054322.1| COG0526: Thiol-disulfide isomeras... 35 1.1
gi|20140745|sp|Q9BDJ3|THIO_CALJA Thioredoxin >gnl|BL_ORD_ID|1571... 35 1.1
gi|12053003|emb|CAB66676.1| hypothetical protein [Homo sapiens] 35 1.1
gi|11358964|pir||T50867 thioredoxin-like protein [imported] - ry... 35 1.1
gi|15239136|ref|NP_199112.1| thioredoxin H-type 3 (TRX-H-3) (GIF... 35 1.1
gi|7105691|gb|AAF36074.1| Human jtb gene related protein 1 [Caen... 35 1.1
gi|21675042|ref|NP_663107.1| thiol:disulfide interchange protein... 35 1.1
gi|23011563|ref|ZP_00051887.1| COG0526: Thiol-disulfide isomeras... 35 1.1
gi|49481052|ref|YP_035690.1| thiol-disulfide oxidoreductase [Bac... 35 1.1
gi|42780672|ref|NP_977919.1| resA protein [Bacillus cereus ATCC ... 35 1.1
gi|19705357|ref|NP_602852.1| Thiol:disulfide interchange protein... 35 1.1
gi|17547971|ref|NP_521373.1| HYPOTHETICAL TRANSMEMBRANE PROTEIN ... 34 1.4
gi|38173919|gb|AAH60981.1| Txndc2 protein [Mus musculus] 34 1.4
gi|21222859|ref|NP_628638.1| putative secreted protein [Streptom... 34 1.4
gi|46140331|ref|ZP_00203565.1| COG0526: Thiol-disulfide isomeras... 34 1.4
gi|11358963|pir||T50863 thioredoxin-like protein [imported] - ry... 34 1.4
gi|48855386|ref|ZP_00309545.1| COG0526: Thiol-disulfide isomeras... 34 1.4
gi|15829178|ref|NP_326538.1| THIOREDOXIN [Mycoplasma pulmonis UA... 34 1.4
gi|27468335|ref|NP_764972.1| thioredoxin-like protein [Staphyloc... 34 1.4
gi|15231958|ref|NP_187483.1| thioredoxin family protein [Arabido... 34 1.4
gi|50552013|ref|XP_503481.1| hypothetical protein [Yarrowia lipo... 34 1.4
gi|17547006|ref|NP_520408.1| PUTATIVE THIOL:DISULFIDE INTERCHANG... 34 1.4
gi|23943824|ref|NP_705739.1| thioredoxin domain containing 2 (sp... 34 1.4
gi|16078864|ref|NP_389684.1| yneN [Bacillus subtilis subsp. subt... 34 1.8
gi|45517156|ref|ZP_00168708.1| COG0526: Thiol-disulfide isomeras... 34 1.8
gi|19851972|gb|AAL99941.1| thioredoxin H [Populus tremula x Popu... 34 1.8
gi|29831341|ref|NP_825975.1| hypothetical protein SAV4798 [Strep... 34 1.8
gi|48771359|ref|ZP_00275701.1| COG0526: Thiol-disulfide isomeras... 34 1.8
gi|42527870|ref|NP_972968.1| conserved domain protein [Treponema... 34 1.8
gi|21230335|ref|NP_636252.1| thioredoxin [Xanthomonas campestris... 34 1.8
gi|24371865|ref|NP_715907.1| thiol:disulfide interchange protein... 34 1.8
gi|4581959|emb|CAB40200.1| disulphide isomerase [Caenorhabditis ... 34 1.8
gi|17554386|ref|NP_497746.1| protein disulfide isomerase (53.4 k... 34 1.8
gi|29347974|ref|NP_811477.1| conserved hypothetical protein [Bac... 34 1.8
gi|20807505|ref|NP_622676.1| Thiol-disulfide isomerase and thior... 34 1.8
gi|46106470|ref|ZP_00187298.2| COG0526: Thiol-disulfide isomeras... 33 2.4
gi|23479713|gb|EAA16465.1| thioredoxin-like redox-active protein... 33 2.4
gi|48832301|ref|ZP_00289339.1| COG0526: Thiol-disulfide isomeras... 33 2.4
gi|17986371|ref|NP_539005.1| THIOL:DISULFIDE INTERCHANGE PROTEIN... 33 2.4
gi|15966987|ref|NP_387340.1| PUTATIVE THIOL:DISULFIDE INTERCHANG... 33 2.4
gi|46130219|ref|ZP_00164996.2| COG0526: Thiol-disulfide isomeras... 33 2.4
gi|16126449|ref|NP_421013.1| thiol:disulfide interchange protein... 33 2.4
gi|46359877|gb|AAS88809.1| putative thioredoxin h [Oryza sativa ... 33 2.4
gi|24637229|gb|AAN63618.1| thioredoxin h-like protein [Oryza sat... 33 2.4
gi|48730629|ref|ZP_00264376.1| COG0526: Thiol-disulfide isomeras... 33 2.4
gi|28436918|gb|AAH46736.1| P4hb protein [Xenopus laevis] 33 2.4
gi|16124365|ref|NP_418929.1| thioredoxin [Caulobacter crescentus... 33 2.4
gi|23978434|dbj|BAC21264.1| thioredoxin h [Cucurbita maxima] 33 2.4
gi|4758304|ref|NP_004902.1| protein disulfide isomerase related ... 33 3.1
gi|18309723|ref|NP_561657.1| probable cytochrome C-type biogenes... 33 3.1
gi|17548784|ref|NP_522124.1| PUTATIVE THIOL:DISULFIDE INTERCHANG... 33 3.1
gi|23502828|ref|NP_698955.1| thiol:disulfide interchange protein... 33 3.1
gi|25990151|gb|AAN75008.1| disulfide isomerase PDI [Leishmania m... 33 3.1
gi|50589915|ref|ZP_00331380.1| COG0526: Thiol-disulfide isomeras... 33 3.1
gi|33383073|dbj|BAC81190.1| thiol-disulfide oxidoreductase [Brev... 33 3.1
gi|15805374|ref|NP_294068.1| cytochrome c biogenesis protein, th... 33 3.1
gi|34896158|ref|NP_909423.1| thioredoxin-like protein [Oryza sat... 33 3.1
gi|25282772|pir||A59394 thioredoxin - Clostridium pasteurianum 33 3.1
gi|41407294|ref|NP_960130.1| TrxB [Mycobacterium avium subsp. pa... 33 3.1
gi|549079|sp|Q05739|THIO_STRCL Thioredoxin (TRX) >gnl|BL_ORD_ID|... 33 3.1
gi|15219537|ref|NP_175128.1| thioredoxin H-type 5 (TRX-H-5) (TOU... 33 3.1
gi|45382053|ref|NP_990784.1| thioredoxin [Gallus gallus] >gnl|BL... 33 3.1
gi|11135312|sp|Q96419|THIH_FAGES Thioredoxin H-type (TRX-H) >gnl... 33 3.1
gi|1388084|gb|AAC49356.1| thioredoxin h 33 3.1
gi|687235|gb|AAA85099.1| protein disulfide isomerase 33 3.1
gi|29349305|ref|NP_812808.1| putative thiol:disulfide interchang... 33 3.1
gi|50733457|ref|XP_418880.1| PREDICTED: similar to Protein disul... 33 3.1
gi|48763561|ref|ZP_00268115.1| COG0526: Thiol-disulfide isomeras... 33 3.1
gi|29348731|ref|NP_812234.1| putative thioredoxin family protein... 33 3.1
gi|15235475|ref|NP_195437.1| thioredoxin family protein [Arabido... 33 3.1
gi|15891342|ref|NP_357014.1| AGR_L_2458p [Agrobacterium tumefaci... 33 3.1
gi|41406499|ref|NP_959335.1| hypothetical protein MAP0401 [Mycob... 33 3.1
gi|48893370|ref|ZP_00326606.1| COG0526: Thiol-disulfide isomeras... 33 3.1
gi|15222488|ref|NP_177146.1| thioredoxin, putative [Arabidopsis ... 33 4.1
gi|30575686|gb|AAP33009.1| thioredoxin H [Citrus x paradisi] 33 4.1
gi|21233251|ref|NP_639168.1| disulphide-isomerase [Xanthomonas c... 33 4.1
gi|47215755|emb|CAG05766.1| unnamed protein product [Tetraodon n... 33 4.1
gi|14595690|gb|AAK70900.1| thioredoxin [Aedes aegypti] 33 4.1
gi|46226985|gb|EAK87951.1| possible thioredoxin H-type of possib... 33 4.1
gi|12841560|dbj|BAB25256.1| unnamed protein product [Mus musculus] 33 4.1
gi|29373131|gb|AAO72714.1| thioredoxin 1 [Melopsittacus undulatus] 33 4.1
gi|50414764|gb|AAH77772.1| P4hb protein [Xenopus laevis] 33 4.1
gi|6755911|ref|NP_035790.1| thioredoxin 1 [Mus musculus] >gnl|BL... 33 4.1
gi|29337032|sp|O17486|THIO_ECHGR Thioredoxin >gnl|BL_ORD_ID|7234... 33 4.1
gi|16758644|ref|NP_446252.1| thioredoxin [Rattus norvegicus] >gn... 33 4.1
gi|34540117|ref|NP_904596.1| thioredoxin family protein [Porphyr... 33 4.1
gi|21241708|ref|NP_641290.1| thioredoxin [Xanthomonas axonopodis... 33 4.1
gi|3392892|emb|CAA12644.1| protein disulphide isomerase [Fasciol... 33 4.1
gi|33860800|ref|NP_892361.1| thioredoxin-like protein TxlA [Proc... 33 4.1
gi|28868894|ref|NP_791513.1| thioredoxin, putative [Pseudomonas ... 33 4.1
gi|26991745|ref|NP_747170.1| thioredoxin 2 [Pseudomonas putida K... 33 4.1
gi|422337|pir||S34275 protein disulfide-isomerase homolog precur... 33 4.1
gi|33595920|ref|NP_883563.1| putative thiol:disulfide interchang... 33 4.1
gi|33601302|ref|NP_888862.1| putative thiol:disulfide interchang... 33 4.1
gi|6753240|ref|NP_033917.1| calcium binding protein, intestinal;... 32 5.3
gi|34498208|ref|NP_902423.1| probable disulphide-isomerase [Chro... 32 5.3
gi|17229693|ref|NP_486241.1| hypothetical protein [Nostoc sp. PC... 32 5.3
gi|32815907|gb|AAP88338.1| At3g17880 [Arabidopsis thaliana] 32 5.3
gi|29612484|gb|AAH49564.1| 4930429J24Rik protein [Mus musculus] 32 5.3
gi|32475862|ref|NP_868856.1| probable FixW protein [Pirellula sp... 32 5.3
gi|9294492|dbj|BAB02711.1| thioredoxin-like protein [Arabidopsis... 32 5.3
gi|30684711|ref|NP_188415.2| tetratricoredoxin (TDX) [Arabidopsi... 32 5.3
gi|45219865|gb|AAH66857.1| Cai protein [Mus musculus] 32 5.3
gi|26390223|dbj|BAC25863.1| unnamed protein product [Mus musculus] 32 5.3
gi|24637237|gb|AAN63622.1| thioredoxin [Triticum aestivum] 32 5.3
gi|34897826|ref|NP_910259.1| putative UMP/CMP kinase [Oryza sati... 32 5.3
gi|42519542|ref|NP_965472.1| thioredoxin [Lactobacillus johnsoni... 32 5.3
gi|23024157|ref|ZP_00063378.1| COG0526: Thiol-disulfide isomeras... 32 5.3
gi|135775|sp|P08628|THIO_RABIT Thioredoxin >gnl|BL_ORD_ID|156405... 32 5.3
gi|47215756|emb|CAG05767.1| unnamed protein product [Tetraodon n... 32 5.3
gi|1729942|sp|P80579|THIO_ALIAC Thioredoxin (TRX) >gnl|BL_ORD_ID... 32 5.3
gi|31231867|ref|XP_318607.1| ENSANGP00000021044 [Anopheles gambi... 32 5.3
gi|18874552|gb|AAL79841.1| thioredoxin [Schistosoma mansoni] 32 5.3
gi|31231849|ref|XP_318603.1| ENSANGP00000004582 [Anopheles gambi... 32 5.3
gi|34810800|pdb|1NW2|A Chain A, The Crystal Structure Of The Mut... 32 5.3
gi|48846587|ref|ZP_00300848.1| COG0526: Thiol-disulfide isomeras... 32 5.3
gi|27904718|ref|NP_777844.1| undecaprenyl pyrophosphate syntheta... 32 5.3
gi|20066322|gb|AAM09377.1| nonstructural protein (readthrough) [... 32 5.3
gi|47551041|ref|NP_999697.1| ER calcistorin; protein disulfide i... 32 5.3
gi|25405885|pir||G96509 protein F27F5.21 [imported] - Arabidopsi... 32 5.3
gi|119531|sp|P08003|PDA4_MOUSE Protein disulfide-isomerase A4 pr... 32 5.3
gi|46576014|gb|AAT01375.1| unknown protein [Oryza sativa (japoni... 32 5.3
gi|27229039|ref|NP_080408.2| RIKEN cDNA 4930429J24 [Mus musculus... 32 5.3
gi|46111043|ref|XP_382579.1| hypothetical protein FG02403.1 [Gib... 32 5.3
gi|16758712|ref|NP_446301.1| protein disulfide isomerase related... 32 5.3
gi|423647|pir||S32476 protein disulfide-isomerase (EC 5.3.4.1) E... 32 5.3
gi|38181882|gb|AAH61535.1| Protein disulfide isomerase related p... 32 5.3
gi|5051813|emb|CAB45042.1| putative [Amycolatopsis orientalis] 32 5.3
gi|15679737|ref|NP_276855.1| protein disulphide isomerase [Metha... 32 7.0
gi|46119202|ref|ZP_00176226.2| COG0526: Thiol-disulfide isomeras... 32 7.0
gi|31415929|gb|AAP50950.1| putative thioredoxin [Oryza sativa (j... 32 7.0
gi|48862956|ref|ZP_00316850.1| COG0526: Thiol-disulfide isomeras... 32 7.0
gi|48869615|ref|ZP_00322366.1| COG0526: Thiol-disulfide isomeras... 32 7.0
gi|3153859|gb|AAC17430.1| thioredoxin delta 3 [Homo sapiens] 32 7.0
gi|11135265|sp|Q39362|THH2_BRANA Thioredoxin H-type 2 (TRX-H-2) ... 32 7.0
gi|15223645|ref|NP_173403.1| thioredoxin H-type 4 (TRX-H-4) (GRE... 32 7.0
gi|6687568|emb|CAB65014.1| thioredoxin (TRX) [Fasciola hepatica] 32 7.0
gi|21402563|ref|NP_658548.1| thiored, Thioredoxin [Bacillus anth... 32 7.0
gi|21617968|gb|AAM67018.1| thioredoxin [Arabidopsis thaliana] 32 7.0
gi|48106068|ref|XP_396045.1| similar to ENSANGP00000014381 [Apis... 32 7.0
gi|15611830|ref|NP_223481.1| THIOREDOXIN [Helicobacter pylori J9... 32 7.0
gi|6492215|gb|AAF14217.1| thioredoxin [Fasciola hepatica] 32 7.0
gi|21223797|ref|NP_629576.1| thioredoxin [Streptomyces coelicolo... 32 7.0
gi|50402589|gb|AAT76629.1| thioredoxin 2 [Schistosoma mansoni] 32 7.0
gi|1065111|pdb|1MDI|A Chain A, High Resolution Solution Nmr Stru... 32 7.0
gi|1388082|gb|AAC49355.1| thioredoxin h 32 7.0
gi|48848783|ref|ZP_00303028.1| COG0526: Thiol-disulfide isomeras... 32 7.0
gi|27375705|ref|NP_767234.1| thioredoxin [Bradyrhizobium japonic... 32 7.0
gi|28571707|ref|NP_650317.3| CG9286-PA [Drosophila melanogaster]... 32 7.0
gi|15616852|ref|NP_240065.1| undecaprenyl pyrophosphate syntheta... 32 7.0
gi|48835262|ref|ZP_00292263.1| COG0526: Thiol-disulfide isomeras... 32 7.0
gi|15838584|ref|NP_299272.1| thioredoxin [Xylella fastidiosa 9a5... 32 7.0
gi|3915131|sp|Q42443|THIH_ORYSA Thioredoxin H-type (TRX-H) (Phlo... 32 7.0
gi|49474788|ref|YP_032830.1| Thiol 3adisulfide interchange prote... 32 7.0
gi|41018362|sp|Q8IFW4|THIT_DROME Thioredoxin T (ThioredoxinT) >g... 32 7.0
gi|49473781|ref|YP_031823.1| Thiol 3A-disulfide interchange prot... 32 7.0
gi|48862992|ref|ZP_00316886.1| COG0526: Thiol-disulfide isomeras... 32 7.0
gi|24379599|ref|NP_721554.1| putative thioredoxin family protein... 32 7.0
gi|15828655|ref|NP_326015.1| THIOREDOXIN [Mycoplasma pulmonis UA... 32 7.0
gi|2117426|pir||S58119 thioredoxin (clone GREN) - Arabidopsis th... 32 7.0
gi|24372070|ref|NP_716112.1| thioredoxin, putative [Shewanella o... 32 9.1
gi|24371867|ref|NP_715909.1| thioredoxin, putative [Shewanella o... 32 9.1
gi|19879581|gb|AAL68889.1| thioredoxin; SoxW [Chlorobium limicola] 32 9.1
gi|22994227|ref|ZP_00038739.1| COG0526: Thiol-disulfide isomeras... 32 9.1
gi|50426325|ref|XP_461759.1| unnamed protein product [Debaryomyc... 32 9.1
gi|29346993|ref|NP_810496.1| putative protein disulfide isomeras... 32 9.1
gi|15614085|ref|NP_242388.1| thioredoxin (thiol:disulfide interc... 32 9.1
gi|23013627|ref|ZP_00053500.1| COG0526: Thiol-disulfide isomeras... 32 9.1
gi|50421171|ref|XP_459131.1| unnamed protein product [Debaryomyc... 32 9.1
gi|16329883|ref|NP_440611.1| thioredoxin [Synechocystis sp. PCC ... 32 9.1
gi|23127896|ref|ZP_00109755.1| COG0526: Thiol-disulfide isomeras... 32 9.1
gi|6636405|gb|AAF20171.1| protein disulfide isomerase 3 [Giardia... 32 9.1
gi|15924734|ref|NP_372268.1| thioredoxin homolog [Staphylococcus... 32 9.1
gi|50426289|ref|XP_461741.1| unnamed protein product [Debaryomyc... 32 9.1
gi|24380154|ref|NP_722109.1| putative bacterocin transport acces... 32 9.1
gi|24637227|gb|AAN63617.1| thioredoxin h-like protein [Zea mays] 32 9.1
gi|30250315|ref|NP_842385.1| Thioredoxin [Nitrosomonas europaea ... 32 9.1
gi|46317426|ref|ZP_00218004.1| COG0526: Thiol-disulfide isomeras... 32 9.1
gi|15966399|ref|NP_386752.1| PUTATIVE THIOL:DISULFIDE INTERCHANG... 32 9.1
gi|13473735|ref|NP_105303.1| thioredoxin [Mesorhizobium loti MAF... 32 9.1
gi|39583758|emb|CAE63862.1| Hypothetical protein CBG08424 [Caeno... 32 9.1
gi|48849000|ref|ZP_00303244.1| COG4232: Thiol:disulfide intercha... 32 9.1
gi|46447234|ref|YP_008599.1| hypothetical protein pc1600 [Parach... 32 9.1
>gi|14550374|gb|AAK67231.1| Hypothetical protein F29B9.5
[Caenorhabditis elegans]
Length = 179
Score = 369 bits (947), Expect = e-101
Identities = 179/179 (100%), Positives = 179/179 (100%)
Frame = +1
Query: 1 MDLIIFFFPQLICILQLNHELFMSDSPTMSEFMKGVMLLKQDLTEVPAEEALKGKVVALY 180
MDLIIFFFPQLICILQLNHELFMSDSPTMSEFMKGVMLLKQDLTEVPAEEALKGKVVALY
Sbjct: 1 MDLIIFFFPQLICILQLNHELFMSDSPTMSEFMKGVMLLKQDLTEVPAEEALKGKVVALY 60
Query: 181 FSAGWCPPCKQFTPKLVRFYHHLKKAGKPIEVVFFSRDRSKADLEENFTEKHGDWLCVKY 360
FSAGWCPPCKQFTPKLVRFYHHLKKAGKPIEVVFFSRDRSKADLEENFTEKHGDWLCVKY
Sbjct: 61 FSAGWCPPCKQFTPKLVRFYHHLKKAGKPIEVVFFSRDRSKADLEENFTEKHGDWLCVKY 120
Query: 361 GDDILTRYQSKFEIKTIPVLRVINAAGKMVVVDGKSEVVDKGKADPQGLFAAWEAACNK 537
GDDILTRYQSKFEIKTIPVLRVINAAGKMVVVDGKSEVVDKGKADPQGLFAAWEAACNK
Sbjct: 121 GDDILTRYQSKFEIKTIPVLRVINAAGKMVVVDGKSEVVDKGKADPQGLFAAWEAACNK 179