Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F30B5_5
(909 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17539566|ref|NP_500519.1| DumPY : shorter than wild-type DPY-... 265 1e-69
gi|39580356|emb|CAE61461.1| Hypothetical protein CBG05353 [Caeno... 245 1e-63
gi|39580357|emb|CAE61462.1| Hypothetical protein CBG05354 [Caeno... 137 3e-31
gi|17539490|ref|NP_500520.1| abnormal RAy Morphology RAM-4, COLl... 137 3e-31
gi|345339|pir||JC1448 collagen col-34 - Caenorhabditis elegans >... 135 1e-30
gi|17539484|ref|NP_501527.1| COLlagen structural gene (col-3) [C... 133 6e-30
gi|39578930|emb|CAE57041.1| Hypothetical protein CBG24927 [Caeno... 133 6e-30
gi|17538876|ref|NP_502107.1| COLlagen structural gene (28.7 kD) ... 129 1e-28
gi|39593732|emb|CAE62024.1| Hypothetical protein CBG06035 [Caeno... 127 3e-28
gi|17543264|ref|NP_500133.1| COLlagen structural gene (col-108) ... 123 6e-27
gi|48060128|gb|AAK68452.2| Collagen protein 108 [Caenorhabditis ... 123 6e-27
gi|39592038|emb|CAE75258.1| Hypothetical protein CBG23219 [Caeno... 119 1e-25
gi|39592014|emb|CAE75234.1| Hypothetical protein CBG23185 [Caeno... 119 1e-25
gi|25153764|ref|NP_741423.1| COLlagen structural gene (28.9 kD) ... 118 2e-25
gi|17561474|ref|NP_505886.1| COLlagen structural gene (29.3 kD) ... 118 2e-25
gi|17564278|ref|NP_505913.1| predicted CDS, COLlagen structural ... 117 4e-25
gi|39592016|emb|CAE75236.1| Hypothetical protein CBG23187 [Caeno... 115 1e-24
gi|39585732|emb|CAE59934.1| Hypothetical protein CBG03420 [Caeno... 115 1e-24
gi|39584177|emb|CAE61552.1| Hypothetical protein CBG05461 [Caeno... 115 1e-24
gi|32453014|gb|AAA96159.2| Collagen protein 33 [Caenorhabditis e... 115 2e-24
gi|17539482|ref|NP_501829.1| COLlagen structural gene (col-2) [C... 112 9e-24
gi|39588210|emb|CAE68135.1| Hypothetical protein CBG13781 [Caeno... 112 1e-23
gi|17543328|ref|NP_502808.1| COLlagen structural gene (col-134) ... 111 2e-23
gi|1589837|gb|AAC48358.1| cuticle preprocollagen [Meloidogyne in... 110 4e-23
gi|115401|sp|P16253|CAC3_HAECO Cuticle collagen 3A3 >gnl|BL_ORD_... 108 1e-22
gi|321006|pir||A44984 collagen - nematode (Haemonchus contortus) 108 1e-22
gi|1184072|gb|AAC47437.1| COL-1 106 8e-22
gi|39592242|emb|CAE75463.1| Hypothetical protein CBG23461 [Caeno... 106 8e-22
gi|17539488|ref|NP_500524.1| COLlagen structural gene (col-33) [... 105 1e-21
gi|17563290|ref|NP_506095.1| COLlagen structural gene, SQuaT SQT... 105 1e-21
gi|17566746|ref|NP_505074.1| COLlagen structural gene (29.5 kD) ... 105 1e-21
gi|39591778|emb|CAE71356.1| Hypothetical protein CBG18259 [Caeno... 105 2e-21
gi|17539418|ref|NP_501561.1| COLlagen structural gene (col-119) ... 104 2e-21
gi|39591777|emb|CAE71355.1| Hypothetical protein CBG18258 [Caeno... 104 2e-21
gi|39586422|emb|CAE74080.1| Hypothetical protein CBG21735 [Caeno... 104 3e-21
gi|17555480|ref|NP_499408.1| COLlagen structural gene (29.2 kD) ... 103 7e-21
gi|39584181|emb|CAE61556.1| Hypothetical protein CBG05465 [Caeno... 102 1e-20
gi|39590411|emb|CAE66150.1| Hypothetical protein CBG11380 [Caeno... 102 1e-20
gi|17555478|ref|NP_499409.1| COLlagen structural gene (29.2 kD) ... 102 2e-20
gi|17555472|ref|NP_499410.1| COLlagen structural gene (29.2 kD) ... 101 2e-20
gi|39585707|emb|CAE59909.1| Hypothetical protein CBG03393 [Caeno... 100 6e-20
gi|17540574|ref|NP_502700.1| COLlagen structural gene (col-133) ... 99 1e-19
gi|17538760|ref|NP_501867.1| COLlagen structural gene (29.1 kD) ... 98 2e-19
gi|32698037|emb|CAE11316.1| Hypothetical protein H06A10.2 [Caeno... 97 4e-19
gi|17553060|ref|NP_499703.1| COLlagen structural gene (col-98) [... 96 8e-19
gi|39596498|emb|CAE63117.1| Hypothetical protein CBG07414 [Caeno... 96 1e-18
gi|32565764|ref|NP_871702.1| COLlagen structural gene (col-95) [... 95 2e-18
gi|115397|sp|P08124|CC01_CAEEL Cuticle collagen 1 precursor (Squ... 94 3e-18
gi|39588940|emb|CAE69570.1| Hypothetical protein CBG15782 [Caeno... 94 3e-18
gi|17568109|ref|NP_510274.1| COLlagen structural gene (col-44) [... 94 5e-18
gi|17551424|ref|NP_510247.1| COLlagen structural gene (col-183) ... 94 5e-18
gi|39596517|emb|CAE63136.1| Hypothetical protein CBG07436 [Caeno... 93 7e-18
gi|39584782|emb|CAE67677.1| Hypothetical protein CBG13240 [Caeno... 93 7e-18
gi|32565788|ref|NP_871711.1| predicted CDS, COLlagen structural ... 93 9e-18
gi|39596527|emb|CAE63146.1| Hypothetical protein CBG07448 [Caeno... 92 1e-17
gi|39584781|emb|CAE67676.1| Hypothetical protein CBG13239 [Caeno... 89 1e-16
gi|17560884|ref|NP_504252.1| COLlagen structural gene (col-139) ... 89 2e-16
gi|39588428|emb|CAE72779.1| Hypothetical protein CBG20034 [Caeno... 88 2e-16
gi|39582210|emb|CAE64161.1| Hypothetical protein CBG08781 [Caeno... 87 7e-16
gi|17542184|ref|NP_501700.1| COLlagen structural gene (29.4 kD) ... 86 9e-16
gi|39594094|emb|CAE70204.1| Hypothetical protein CBG16679 [Caeno... 86 1e-15
gi|4809258|gb|AAD30169.1| collagen [Haemonchus contortus] 85 3e-15
gi|17557099|ref|NP_499700.1| COLlagen structural gene (30.3 kD) ... 84 4e-15
gi|39588941|emb|CAE69571.1| Hypothetical protein CBG15783 [Caeno... 82 1e-14
gi|39580392|emb|CAE70951.1| Hypothetical protein CBG17762 [Caeno... 79 1e-13
gi|39580360|emb|CAE61465.1| Hypothetical protein CBG05357 [Caeno... 77 7e-13
gi|17537301|ref|NP_494562.1| COLlagen structural gene (37.0 kD) ... 77 7e-13
gi|39583745|emb|CAE63849.1| Hypothetical protein CBG08408 [Caeno... 76 9e-13
gi|17543166|ref|NP_500138.1| COLlagen structural gene (29.0 kD) ... 76 1e-12
gi|17540822|ref|NP_500071.1| COLlagen structural gene (col-105) ... 76 1e-12
gi|39596499|emb|CAE63118.1| Hypothetical protein CBG07415 [Caeno... 75 3e-12
gi|17539522|ref|NP_501150.1| COLlagen structural gene (col-114) ... 74 6e-12
gi|17535685|ref|NP_496589.1| ROLler: helically twisted, animals ... 72 2e-11
gi|39593552|emb|CAE61844.1| Hypothetical protein CBG05818 [Caeno... 70 8e-11
gi|7498195|pir||T34203 hypothetical protein D2024.8 - Caenorhabd... 67 4e-10
gi|17561476|ref|NP_505888.1| COLlagen structural gene (col-155) ... 66 9e-10
gi|687634|gb|AAA62504.1| collagen 64 4e-09
gi|39591412|emb|CAE73466.1| Hypothetical protein CBG20917 [Caeno... 63 1e-08
gi|17568107|ref|NP_510273.1| COLlagen structural gene (col-9) [C... 62 1e-08
gi|32563747|ref|NP_494878.2| COLlagen structural gene (col-17) [... 62 1e-08
gi|39591507|emb|CAE73561.1| Hypothetical protein CBG21031 [Caeno... 60 7e-08
gi|687636|gb|AAA62505.1| collagen [Caenorhabditis elegans] 60 9e-08
gi|18846043|ref|NP_572129.1| ORF 73; extensive acidic domains, p... 56 1e-06
gi|17539916|ref|NP_500598.1| COLlagen structural gene (col-110) ... 56 1e-06
gi|39584784|emb|CAE67679.1| Hypothetical protein CBG13242 [Caeno... 56 1e-06
gi|21954120|gb|AAM80556.1| cuticular collagen [Trichinella spira... 55 2e-06
gi|5669894|gb|AAD46501.1| latent nuclear antigen [Human herpesvi... 55 3e-06
gi|23482650|gb|EAA18573.1| hypothetical protein [Plasmodium yoel... 54 4e-06
gi|39587615|emb|CAE58553.1| Hypothetical protein CBG01712 [Caeno... 54 4e-06
gi|321007|pir||B44984 collagen - nematode (Haemonchus contortus)... 53 8e-06
gi|17531401|ref|NP_493635.1| COLlagen structural gene (col-67Co)... 52 1e-05
gi|39586900|emb|CAE62835.1| Hypothetical protein CBG07014 [Caeno... 52 1e-05
gi|27806661|ref|NP_776463.1| dentin matrix acidic phosphoprotein... 52 1e-05
gi|33303426|gb|AAQ02289.1| dentin matrix protein 1 [Xenomys nels... 52 1e-05
gi|159171|gb|AAA29174.1| collagen 8E 52 1e-05
gi|115399|sp|P16252|CAC2_HAECO Cuticle collagen 2C >gnl|BL_ORD_I... 52 2e-05
gi|17535689|ref|NP_495582.1| ROLler: helically twisted, animals ... 52 2e-05
gi|84433|pir||JS0167 collagen col-6 - Caenorhabditis elegans >gn... 52 2e-05
gi|32563818|ref|NP_871912.1| ROLler: helically twisted, animals ... 52 2e-05
gi|7494563|pir||T34507 cutical collagen 6 - Caenorhabditis elegans 52 2e-05
gi|39595982|emb|CAE67485.1| Hypothetical protein CBG12990 [Caeno... 51 3e-05
gi|17510331|ref|NP_491088.1| COLlagen structural gene (col-48) [... 51 3e-05
gi|7378657|emb|CAB85466.1| putative cuticular collagen [Ascaris ... 51 3e-05
gi|7496625|pir||T15670 hypothetical protein C27H5.5 - Caenorhabd... 51 3e-05
gi|17532623|ref|NP_495487.1| COLlagen structural gene (col-36) [... 51 3e-05
gi|39595524|emb|CAE60562.1| Hypothetical protein CBG04191 [Caeno... 50 5e-05
gi|39582304|emb|CAE67553.1| Hypothetical protein CBG13078 [Caeno... 50 7e-05
gi|13936996|gb|AAK50002.1| ORF73 [Human herpesvirus 8] 50 9e-05
gi|17567513|ref|NP_509121.1| COLlagen structural gene (35.0 kD) ... 50 9e-05
gi|11037008|gb|AAG27458.1| latent nuclear antigen [Human herpesv... 50 9e-05
gi|84431|pir||JS0169 collagen col-14 - Caenorhabditis elegans >g... 50 9e-05
gi|9886896|gb|AAG01636.1| Orf73 [Human herpesvirus 8] 49 1e-04
gi|46437429|gb|EAK96776.1| hypothetical protein CaO19.2859 [Cand... 49 2e-04
gi|32565701|ref|NP_495366.2| collagen triple helix repeat family... 49 2e-04
gi|543968|sp|P35800|CCDA_CAEEL Cuticle collagen dpy-10 precursor... 49 2e-04
gi|7494559|pir||T28887 collagen dpy-10 - Caenorhabditis elegans 49 2e-04
gi|39587054|emb|CAE62989.1| Hypothetical protein CBG07217 [Caeno... 49 2e-04
gi|17532621|ref|NP_494879.1| COLlagen structural gene (col-20) [... 49 2e-04
gi|33303420|gb|AAQ02286.1| dentin matrix protein 1 [Neotoma albi... 48 3e-04
gi|39590294|emb|CAE66032.1| Hypothetical protein CBG11227 [Caeno... 48 3e-04
gi|34874497|ref|XP_224295.2| similar to KIAA0853 protein [Rattus... 48 3e-04
gi|33303446|gb|AAQ02299.1| dentin matrix protein 1 [Reithrodonto... 48 3e-04
gi|1236783|emb|CAA65506.1| cuticular collagen [Teladorsagia circ... 48 3e-04
gi|1236781|emb|CAA65507.1| cuticular collagen [Teladorsagia circ... 48 3e-04
gi|17551382|ref|NP_508395.1| DumPY : shorter than wild-type DPY-... 47 5e-04
gi|25145834|ref|NP_501273.2| COLlagen structural gene (col-14) [... 47 5e-04
gi|7497485|pir||T29810 hypothetical protein C46A5.3 - Caenorhabd... 47 5e-04
gi|39595004|emb|CAE70872.1| Hypothetical protein CBG17662 [Caeno... 47 5e-04
gi|33285161|gb|AAC48094.2| Dumpy : shorter than wild-type protei... 47 6e-04
gi|28828396|gb|AAO51028.1| similar to Dictyostelium discoideum (... 47 6e-04
gi|48870343|ref|ZP_00323067.1| COG4932: Predicted outer membrane... 47 8e-04
gi|2246532|gb|AAB62657.1| ORF 73, contains large complex repeat ... 47 8e-04
gi|27882420|gb|AAH44688.1| Ncoa5-prov protein [Xenopus laevis] 47 8e-04
gi|33303422|gb|AAQ02287.1| dentin matrix protein 1 [Neotoma cine... 47 8e-04
gi|21309834|gb|AAM19759.1| glutamic acid-rich protein cNBL1500 [... 47 8e-04
gi|50405059|ref|YP_054151.1| hypothetical protein PTMB.222 [Para... 46 0.001
gi|39597656|emb|CAE68347.1| Hypothetical protein CBG14077 [Caeno... 46 0.001
gi|46437481|gb|EAK96827.1| hypothetical protein CaO19.10377 [Can... 46 0.001
gi|33303418|gb|AAQ02285.1| dentin matrix protein 1 [Hodomys alleni] 46 0.001
gi|39586728|emb|CAE65770.1| Hypothetical protein CBG10862 [Caeno... 45 0.002
gi|33303448|gb|AAQ02300.1| dentin matrix protein 1 [Baiomys tayl... 45 0.002
gi|33303434|gb|AAQ02293.1| dentin matrix protein 1 [Onychomys le... 45 0.002
gi|32566596|ref|NP_872268.1| COLlagen structural gene (col-171) ... 45 0.002
gi|32566594|ref|NP_872267.1| COLlagen structural gene (col-170) ... 45 0.002
gi|33303458|gb|AAQ02305.1| dentin matrix protein 1 [Oryzomys pal... 45 0.002
gi|39595279|emb|CAE60316.1| Hypothetical protein CBG03907 [Caeno... 45 0.002
gi|39593182|emb|CAE64651.1| Hypothetical protein CBG09422 [Caeno... 45 0.003
gi|18447198|gb|AAL68190.1| GH09355p [Drosophila melanogaster] 44 0.004
gi|26554099|ref|NP_758033.1| DNA topoisomerase IV subunit A [Myc... 44 0.004
gi|24662885|ref|NP_648504.1| CG6004-PB [Drosophila melanogaster]... 44 0.004
gi|17507553|ref|NP_490679.1| COLlagen structural gene (col-45) [... 44 0.005
gi|39581447|emb|CAE74729.1| Hypothetical protein CBG22547 [Caeno... 44 0.005
gi|39585827|emb|CAE61240.1| Hypothetical protein CBG05040 [Caeno... 43 0.009
gi|39585817|emb|CAE61230.1| Hypothetical protein CBG05029 [Caeno... 43 0.009
gi|32566570|ref|NP_872255.1| COLlagen structural gene (28.4 kD) ... 43 0.009
gi|17532741|ref|NP_495367.1| DumPY : shorter than wild-type DPY-... 43 0.009
gi|543967|sp|P35799|CCD2_CAEEL Cuticle collagen dpy-2 precursor 43 0.009
gi|26347067|dbj|BAC37182.1| unnamed protein product [Mus musculus] 43 0.009
gi|46440327|gb|EAK99634.1| hypothetical protein CaO19.9985 [Cand... 43 0.011
gi|33303456|gb|AAQ02304.1| dentin matrix protein 1 [Holochilus s... 43 0.011
gi|46440238|gb|EAK99546.1| hypothetical protein CaO19.2449 [Cand... 43 0.011
gi|33469121|ref|NP_058059.1| dentin matrix protein 1; serine ric... 43 0.011
gi|6137020|emb|CAB59629.1| dentin matrix protein-1 [Mus musculus] 43 0.011
gi|39585824|emb|CAE61237.1| Hypothetical protein CBG05037 [Caeno... 42 0.015
gi|39585828|emb|CAE61241.1| Hypothetical protein CBG05041 [Caeno... 42 0.015
gi|39597872|emb|CAE68564.1| Hypothetical protein CBG14399 [Caeno... 42 0.015
gi|33303450|gb|AAQ02301.1| dentin matrix protein 1 [Scotinomys t... 42 0.015
gi|17543526|ref|NP_502966.1| predicted CDS, COLlagen structural ... 42 0.015
gi|28850409|gb|AAO53177.1| similar to Dictyostelium discoideum (... 42 0.015
gi|34864831|ref|XP_217647.2| similar to nongradient byssal precu... 35 0.017
gi|33303424|gb|AAQ02288.1| dentin matrix protein 1 [Neotoma mexi... 42 0.019
gi|17533675|ref|NP_496739.1| mature parasite-infected erythrocyt... 42 0.025
gi|39592197|emb|CAE75417.1| Hypothetical protein CBG23407 [Caeno... 42 0.025
gi|17569753|ref|NP_509060.1| COLlagen structural gene (28.5 kD) ... 42 0.025
gi|33303454|gb|AAQ02303.1| dentin matrix protein 1 [Tylomys nudi... 42 0.025
gi|39585826|emb|CAE61239.1| Hypothetical protein CBG05039 [Caeno... 41 0.032
gi|39585825|emb|CAE61238.1| Hypothetical protein CBG05038 [Caeno... 41 0.032
gi|563237|gb|AAC46628.1| cuticular collagen Bmcol-2 41 0.032
gi|6322945|ref|NP_013018.1| Suppressor of mutant AC40 subunit of... 41 0.032
gi|295671|gb|AAA35091.1| selected as a weak suppressor of a muta... 41 0.032
gi|30025105|gb|AAP13769.1| Hypothetical protein T07H6.3b [Caenor... 41 0.032
gi|17569675|ref|NP_509051.1| COLlagen structural gene (col-166) ... 41 0.032
gi|30681829|ref|NP_850032.1| expressed protein [Arabidopsis thal... 41 0.032
gi|33591257|gb|AAL06398.2| unknown [Francisella tularensis subsp... 41 0.032
gi|17550996|ref|NP_509960.1| COLlagen structural gene (col-180Co... 41 0.042
gi|21402779|ref|NP_658764.1| hypothetical protein predicted by G... 41 0.042
gi|50730849|ref|XP_417045.1| PREDICTED: similar to KIAA0853 prot... 41 0.042
gi|33303452|gb|AAQ02302.1| dentin matrix protein 1 [Ototylomys p... 41 0.042
gi|17507951|ref|NP_491958.1| COLlagen structural gene (col-59) [... 41 0.042
gi|11466451|ref|NP_046743.1| Rep-like [Dictyostelium discoideum]... 40 0.055
gi|23613038|ref|NP_703360.1| interspersed repeat antigen, putati... 40 0.055
gi|38488737|ref|NP_942112.1| starmaker [Danio rerio] >gnl|BL_ORD... 40 0.072
gi|45267830|ref|NP_987089.1| dentin matrix protein 1; dentin mat... 40 0.072
gi|46442819|gb|EAL02105.1| hypothetical protein CaO19.801 [Candi... 40 0.072
gi|17566918|ref|NP_506061.1| LONg body length LON-3, cuticle col... 40 0.072
gi|31982941|ref|NP_055885.2| KIAA0853 [Homo sapiens] >gnl|BL_ORD... 40 0.094
gi|30022804|ref|NP_834435.1| Spore germination protein IA [Bacil... 40 0.094
gi|21732311|emb|CAD38544.1| hypothetical protein [Homo sapiens] 40 0.094
gi|17569755|ref|NP_509059.1| COLlagen structural gene (28.5 kD) ... 40 0.094
gi|19112670|ref|NP_595878.1| hypothetical serine-rich repeat pro... 40 0.094
gi|12053007|emb|CAB66679.1| hypothetical protein [Homo sapiens] 40 0.094
gi|11559966|ref|NP_071531.1| involucrin gene [Rattus norvegicus]... 40 0.094
gi|7507620|pir||T16841 hypothetical protein T10E10.2 - Caenorhab... 40 0.094
gi|21309836|gb|AAM19760.1| glutamic acid-rich protein cNBL1700 [... 40 0.094
gi|33303460|gb|AAQ02306.1| dentin matrix protein 1 [Sigmodon his... 39 0.12
gi|4335794|gb|AAD17458.1| cuticular collagen [Ascaris suum] 39 0.12
gi|45360527|ref|NP_988936.1| hypothetical protein MGC75993 [Xeno... 39 0.12
gi|46435796|gb|EAK95170.1| hypothetical protein CaO19.4072 [Cand... 39 0.12
gi|1245105|gb|AAC52934.1| glutamine repeat protein-1 39 0.12
gi|17531395|ref|NP_495104.1| BLIstered cuticle BLI-2, Nematode c... 39 0.12
gi|15228477|ref|NP_189519.1| expressed protein [Arabidopsis thal... 39 0.12
gi|7332272|gb|AAA17398.2| collagen [Caenorhabditis elegans] 39 0.12
gi|7494560|pir||T37285 collagen dpy-2 - Caenorhabditis elegans 39 0.12
gi|17385617|emb|CAD12628.1| involucrin [Sus scrofa] 39 0.12
gi|50419503|ref|XP_458278.1| unnamed protein product [Debaryomyc... 39 0.16
gi|423763|pir||A45988 dentin matrix acidic phosphoprotein AG1 - rat 39 0.16
gi|46435639|gb|EAK95016.1| hypothetical protein CaO19.11553 [Can... 39 0.16
gi|34857875|ref|XP_346628.1| hypothetical protein XP_346627 [Rat... 39 0.21
gi|33303432|gb|AAQ02292.1| dentin matrix protein 1 [Onychomys ar... 39 0.21
gi|23485922|gb|EAA20646.1| hypothetical protein [Plasmodium yoel... 39 0.21
gi|29570382|gb|AAO38600.2| Dumpy : shorter than wild-type protei... 39 0.21
gi|45201034|ref|NP_986604.1| AGL062Cp [Eremothecium gossypii] >g... 39 0.21
gi|46195852|ref|NP_996876.1| dentin matrix protein 1 [Gallus gal... 39 0.21
gi|32565703|ref|NP_872048.1| dumpy shorter than wild-type protei... 39 0.21
gi|28829276|gb|AAO51818.1| similar to Kaposi's sarcoma-associate... 39 0.21
gi|25411550|pir||F84514 hypothetical protein At2g14140 [imported... 38 0.27
gi|39596930|emb|CAE59157.1| Hypothetical protein CBG02463 [Caeno... 38 0.27
gi|26000376|gb|AAN75486.1| dentin matrix protein 1 [Kerivoula ha... 38 0.27
gi|32407190|ref|XP_324184.1| hypothetical protein [Neurospora cr... 38 0.27
gi|34871469|ref|XP_221997.2| similar to connexin29 [Rattus norve... 38 0.27
gi|17568327|ref|NP_509766.1| cuticle collagen 1 like (XL161) [Ca... 38 0.27
gi|17385613|emb|CAD12626.1| involucrin [Sus scrofa] 38 0.36
gi|47523948|ref|NP_999613.1| involucrin [Sus scrofa] >gnl|BL_ORD... 38 0.36
gi|47568496|ref|ZP_00239196.1| spermine/spermidine synthase fami... 38 0.36
gi|39594125|emb|CAE70235.1| Hypothetical protein CBG16724 [Caeno... 38 0.36
gi|28828998|gb|AAO51573.1| similar to Dictyostelium discoideum (... 38 0.36
gi|6940339|emb|CAB72282.1| EG:BACR43E12.5 [Drosophila melanogaster] 37 0.47
gi|20128967|ref|NP_570033.1| CG14418-PA [Drosophila melanogaster... 37 0.47
gi|21313246|ref|NP_082038.1| RIKEN cDNA 5430400H23 [Mus musculus... 37 0.47
gi|34865500|ref|XP_345960.1| similar to hypothetical protein [Ra... 37 0.47
gi|17567621|ref|NP_509162.1| COLlagen structural gene (col-173) ... 37 0.61
gi|17385615|emb|CAD12627.1| involucrin [Sus scrofa] 37 0.61
gi|39597358|emb|CAE59586.1| Hypothetical protein CBG02987 [Caeno... 37 0.61
gi|15929245|gb|AAH15068.1| Ap3b1 protein [Mus musculus] 37 0.61
gi|39595798|emb|CAE67301.1| Hypothetical protein CBG12754 [Caeno... 37 0.61
gi|17551704|ref|NP_508747.1| COLlagen structural gene (33.9 kD) ... 37 0.80
gi|32423379|ref|XP_332127.1| hypothetical protein [Neurospora cr... 37 0.80
gi|17533809|ref|NP_496362.1| COLlagen structural gene (29.2 kD) ... 37 0.80
gi|28850332|gb|AAM08494.2| similar to Mus musculus (Mouse). GABA... 37 0.80
gi|42569025|ref|NP_179030.2| hypothetical protein [Arabidopsis t... 37 0.80
gi|50311997|ref|XP_456030.1| unnamed protein product [Kluyveromy... 37 0.80
gi|46440639|gb|EAK99943.1| hypothetical protein CaO19.6260 [Cand... 37 0.80
gi|17384366|emb|CAD13202.1| involucrin [Sus scrofa] 36 1.0
gi|39591241|emb|CAE73294.1| Hypothetical protein CBG20714 [Caeno... 36 1.0
gi|17533807|ref|NP_496361.1| COLlagen structural gene (30.9 kD) ... 36 1.0
gi|23379703|gb|AAM76594.1| dental matrix acidic phophoprotein 1 ... 36 1.0
gi|23379705|gb|AAM76595.1| dental matrix acidic phophoprotein 1 ... 36 1.0
gi|23482074|gb|EAA18164.1| hypothetical protein [Plasmodium yoel... 36 1.0
gi|28828096|gb|AAO50779.1| similar to Mus musculus (Mouse). Sex-... 36 1.0
gi|11071800|emb|CAC14644.1| lectin-related protein [Leishmania m... 36 1.0
gi|39597359|emb|CAE59587.1| Hypothetical protein CBG02988 [Caeno... 36 1.4
gi|23509422|ref|NP_702089.1| hypothetical protein [Plasmodium fa... 36 1.4
gi|23612236|ref|NP_703816.1| hypothetical protein [Plasmodium fa... 36 1.4
gi|17567743|ref|NP_509276.1| COLlagen structural gene (30.0 kD) ... 36 1.4
gi|50548313|ref|XP_501626.1| hypothetical protein [Yarrowia lipo... 36 1.4
gi|39585885|emb|CAE61299.1| Hypothetical protein CBG05125 [Caeno... 36 1.4
gi|28828775|gb|AAO51370.1| similar to Dictyostelium discoideum (... 36 1.4
gi|50421413|ref|XP_459257.1| unnamed protein product [Debaryomyc... 36 1.4
gi|39586769|emb|CAE65811.1| Hypothetical protein CBG10919 [Caeno... 36 1.4
gi|24655493|ref|NP_728653.1| CG7971-PB [Drosophila melanogaster]... 35 1.8
gi|48763005|ref|ZP_00267562.1| hypothetical protein Rrub02003719... 35 1.8
gi|16198129|gb|AAL13867.1| LD33732p [Drosophila melanogaster] 35 1.8
gi|42519751|ref|NP_965681.1| hypothetical protein LJ0574 [Lactob... 35 1.8
gi|38110729|gb|EAA56408.1| hypothetical protein MG06379.4 [Magna... 35 1.8
gi|30019120|ref|NP_830751.1| hypothetical protein [Bacillus cere... 35 1.8
gi|24655483|ref|NP_728652.1| CG7971-PC [Drosophila melanogaster]... 35 1.8
gi|15291219|gb|AAK92878.1| GH12043p [Drosophila melanogaster] >g... 35 1.8
gi|22026908|ref|NP_611556.2| CG30389-PC [Drosophila melanogaster... 35 1.8
gi|24655488|ref|NP_647642.2| CG7971-PA [Drosophila melanogaster]... 35 1.8
gi|50420655|ref|XP_458864.1| unnamed protein product [Debaryomyc... 35 1.8
gi|38107901|gb|EAA54011.1| hypothetical protein MG01996.4 [Magna... 35 1.8
gi|38049260|gb|AAR10431.1| hypothetical protein [Enterococcus fa... 35 2.3
gi|23508380|ref|NP_701049.1| hypothetical protein [Plasmodium fa... 35 2.3
gi|33303436|gb|AAQ02294.1| dentin matrix protein 1 [Osgoodomys b... 35 2.3
gi|49523567|emb|CAF18245.1| STYLOSA protein [Antirrhinum majus] 35 2.3
gi|28828351|gb|AAL93018.2| similar to Staphylococcus epidermidis... 35 2.3
gi|6688939|emb|CAB65345.1| PR7 protein [Plasmodium falciparum] 35 2.3
gi|26000386|gb|AAN75482.1| dentin matrix protein 1 [Thyroptera d... 35 3.0
gi|32418170|ref|XP_329563.1| hypothetical protein [Neurospora cr... 35 3.0
gi|26000370|gb|AAN75483.1| dentin matrix protein 1 [Thyroptera t... 35 3.0
gi|39586591|emb|CAE73718.1| Hypothetical protein CBG21232 [Caeno... 35 3.0
gi|2373389|dbj|BAA22091.1| voltage-dependent calcium channel alp... 35 3.0
gi|50306605|ref|XP_453276.1| unnamed protein product [Kluyveromy... 35 3.0
gi|1711421|sp|P54705|SNWA_DICDI Protein snwA >gnl|BL_ORD_ID|9602... 35 3.0
gi|50742552|ref|XP_419673.1| PREDICTED: similar to A-kinase anch... 35 3.0
gi|27503875|gb|AAH42244.1| MGC53372 protein [Xenopus laevis] 35 3.0
gi|4884691|gb|AAD31770.1| lactoferrin-binding protein precursor ... 35 3.0
gi|33303430|gb|AAQ02291.1| dentin matrix protein 1 [Ochrotomys n... 35 3.0
gi|79960|pir||JH0204 hypothetical 30.5K protein precursor - Ente... 34 4.0
gi|31616158|gb|AAK38834.2| biofilm-associated surface protein [S... 34 4.0
gi|30038111|gb|AAP12719.1| mastermind [Drosophila americana] 34 4.0
gi|32413407|ref|XP_327183.1| predicted protein [Neurospora crass... 34 4.0
gi|49070826|ref|XP_399702.1| hypothetical protein UM02087.1 [Ust... 34 4.0
gi|628967|pir||S45091 hypothetical protein iota - Streptococcus ... 34 4.0
gi|28828729|gb|AAO51324.1| similar to Dictyostelium discoideum (... 34 4.0
gi|24642197|ref|NP_573033.1| CG6324-PA [Drosophila melanogaster]... 34 4.0
gi|42568946|ref|NP_178574.2| hypothetical protein [Arabidopsis t... 34 4.0
gi|41054766|ref|NP_956894.1| hypothetical protein MGC63522 [Dani... 34 4.0
gi|12957024|emb|CAC29194.1| hypothetical protein [Enterococcus f... 34 4.0
gi|21221416|ref|NP_627195.1| putative secreted protein [Streptom... 34 4.0
gi|22324231|emb|CAD44395.1| hypothetical protein [Enterococcus f... 34 4.0
gi|23025131|ref|ZP_00064303.1| hypothetical protein [Leuconostoc... 34 4.0
gi|49481396|ref|YP_038778.1| spore germination protein [Bacillus... 34 4.0
gi|7442026|pir||T06572 convicilin precursor - garden pea (fragme... 34 5.2
gi|26000384|gb|AAN75474.1| dentin matrix protein 1 [Pteronotus p... 34 5.2
gi|49074246|ref|XP_401271.1| hypothetical protein UM03656.1 [Ust... 34 5.2
gi|544374|sp|P36417|GBF_DICDI G-box binding factor (GBF) >gnl|BL... 34 5.2
gi|20129887|ref|NP_610708.1| CG13185-PA [Drosophila melanogaster... 34 5.2
gi|7339551|emb|CAB82855.1| convicilin [Pisum sativum] 34 5.2
gi|2492913|sp|Q28758|APA4_PAPAN Apolipoprotein A-IV precursor (A... 34 5.2
gi|38074781|ref|XP_355331.1| similar to Bromodomain adjacent to ... 34 5.2
gi|17548689|ref|NP_522029.1| PROBABLE GENERAL SECRETION PATHWAY ... 34 5.2
gi|10180741|gb|AAG14229.1| UL36 large tegument protein-like prot... 34 5.2
gi|50309619|ref|XP_454821.1| unnamed protein product [Kluyveromy... 34 5.2
gi|41387633|gb|AAS01677.1| large tegument protein [Gallid herpes... 34 5.2
gi|26326841|dbj|BAC27164.1| unnamed protein product [Mus musculus] 34 5.2
gi|50510945|dbj|BAD32458.1| mKIAA1476 protein [Mus musculus] 34 5.2
gi|32421133|ref|XP_331010.1| hypothetical protein [Neurospora cr... 34 5.2
gi|1706205|sp|P13919|CVCB_PEA Convicilin precursor 34 5.2
gi|227928|prf||1713472A convicilin 34 5.2
gi|16198327|gb|AAL14009.1| SD07158p [Drosophila melanogaster] 34 5.2
gi|38074779|ref|XP_130366.3| similar to KIAA1476 protein [Mus mu... 34 5.2
gi|45478244|gb|AAS66293.1| LRRGT00202 [Rattus norvegicus] 33 6.7
gi|29290091|gb|AAO67562.1| Pol protein [Drosophila virilis] 33 6.7
gi|25027859|ref|NP_737913.1| putative transcription termination ... 33 6.7
gi|17367114|sp|Q9U7E0|ATRX_CAEEL Transcriptional regulator ATRX ... 33 6.7
gi|17509687|ref|NP_491423.1| human XNP gene related (156.2 kD) (... 33 6.7
gi|24658452|ref|NP_729078.1| CG10596-PC [Drosophila melanogaster... 33 6.7
gi|39597491|emb|CAE59721.1| Hypothetical protein CBG03154 [Caeno... 33 6.7
gi|18495763|emb|CAC87579.1| surface protein [Theileria annulata] 33 6.7
gi|48780895|ref|ZP_00277558.1| COG1530: Ribonucleases G and E [B... 33 6.7
gi|24658445|ref|NP_729077.1| CG10596-PA [Drosophila melanogaster... 33 6.7
gi|25013014|gb|AAN71591.1| RH50422p [Drosophila melanogaster] 33 6.7
gi|15235717|ref|NP_195495.1| expressed protein [Arabidopsis thal... 33 6.7
gi|21355467|ref|NP_647973.1| CG10596-PB [Drosophila melanogaster... 33 6.7
gi|23486147|gb|EAA20734.1| hypothetical protein [Plasmodium yoel... 33 6.7
gi|33863851|ref|NP_895411.1| putative chromosome segregation pro... 33 6.7
gi|34854705|ref|XP_229225.2| similar to KIAA1476 protein [Rattus... 33 8.8
gi|50545271|ref|XP_500173.1| hypothetical protein [Yarrowia lipo... 33 8.8
gi|48771947|ref|ZP_00276289.1| hypothetical protein Reut02000697... 33 8.8
gi|17535687|ref|NP_495858.1| ROLler: helically twisted, animals ... 33 8.8
gi|27469858|gb|AAH41719.1| MGC52646 protein [Xenopus laevis] 33 8.8
gi|18495789|emb|CAC87892.1| surface protein [Theileria annulata] 33 8.8
gi|39584056|emb|CAE66462.1| Hypothetical protein CBG11739 [Caeno... 33 8.8
gi|38603523|dbj|BAD02898.1| bacteriolytic enzyme [Bacillus clausii] 33 8.8
gi|50424619|ref|XP_460899.1| unnamed protein product [Debaryomyc... 33 8.8
gi|29290086|gb|AAO67558.1| Gag protein [Drosophila virilis] >gnl... 33 8.8
gi|28829619|gb|AAO52136.1| similar to Dictyostelium. Serine/thre... 33 8.8
gi|46121513|ref|XP_385311.1| hypothetical protein FG05135.1 [Gib... 33 8.8
gi|49079706|ref|XP_403469.1| hypothetical protein UM05854.1 [Ust... 33 8.8
gi|50305121|ref|XP_452519.1| unnamed protein product [Kluyveromy... 33 8.8
gi|46316651|ref|ZP_00217230.1| COG1530: Ribonucleases G and E [B... 33 8.8
gi|50414818|gb|AAH77321.1| Unknown (protein for MGC:80275) [Xeno... 33 8.8
>gi|17539566|ref|NP_500519.1| DumPY : shorter than wild-type DPY-13,
collagen family member (30.1 kD) (dpy-13)
[Caenorhabditis elegans]
gi|115411|sp|P17657|CCDC_CAEEL Cuticle collagen dpy-13
gi|84436|pir||A31921 collagen dpy-13 precursor - Caenorhabditis
elegans
gi|156270|gb|AAA27994.1| collagen
gi|1123099|gb|AAA83499.1| Dumpy : shorter than wild-type protein 13
[Caenorhabditis elegans]
Length = 302
Score = 265 bits (677), Expect = 1e-69
Identities = 144/218 (66%), Positives = 144/218 (66%)
Frame = +1
Query: 1 MDIDTKIKAYRFVAYSAVVFSVIAVLSVCITLPIVYNYVHTVRRQLHNEALTCKGSMKDV 180
MDIDTKIKAYRFVAYSAVVFSVIAVLSVCITLPIVYNYVHTVRRQLHNEALTCKGSMKDV
Sbjct: 1 MDIDTKIKAYRFVAYSAVVFSVIAVLSVCITLPIVYNYVHTVRRQLHNEALTCKGSMKDV 60
Query: 181 WADVHHLRVDAASNRTARAVRYGRDDAAAGNGPNFDSGCEGCCQXXXXXXXXXXXXXXXX 360
WADVHHLRVDAASNRTARAVRYGRDDAAAGNGPNFDSGCEGCCQ
Sbjct: 61 WADVHHLRVDAASNRTARAVRYGRDDAAAGNGPNFDSGCEGCCQPGPQGAPGAPGKPGRP 120
Query: 361 XXXXXXXXXXXXXXXXQKPCEEITXXXXXXXXXXXXXXXXXXXXXXXKGEAGQPGQPGSD 540
QKPCEEIT KGEAGQPGQPGSD
Sbjct: 121 GKPGAPGFPGNPGKAPQKPCEEITPPPCKPCPQGPPGAPGLPGDQGDKGEAGQPGQPGSD 180
Query: 541 AAPGEQXXXXXXXXXXXXXXXXXXXDEGLPAVCEPVQK 654
AAPGEQ DEGLPAVCEPVQK
Sbjct: 181 AAPGEQGPKGPNGAPGKPGAPGAPGDEGLPAVCEPVQK 218
Score = 55.1 bits (131), Expect = 2e-06
Identities = 23/23 (100%), Positives = 23/23 (100%)
Frame = +1
Query: 838 ERGICPKYCAIDGGIFFEDGTRR 906
ERGICPKYCAIDGGIFFEDGTRR
Sbjct: 280 ERGICPKYCAIDGGIFFEDGTRR 302