Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F32A5_7
(372 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17533617|ref|NP_495514.1| u6 snRNA-associated Sm-like protein... 178 3e-44
gi|39582333|emb|CAE67582.1| Hypothetical protein CBG13115 [Caeno... 177 6e-44
gi|6912486|ref|NP_036453.1| U6 snRNA-associated Sm-like protein ... 139 2e-32
gi|41152340|ref|NP_956990.1| LSM4 homolog, U6 small nuclear RNA ... 139 2e-32
gi|50761130|ref|XP_418245.1| PREDICTED: similar to Hypothetical ... 139 2e-32
gi|45361593|ref|NP_989371.1| hypothetical protein MGC76085 [Xeno... 139 2e-32
gi|47217413|emb|CAG00773.1| unnamed protein product [Tetraodon n... 138 2e-32
gi|13161882|emb|CAC33027.1| Lsm4 protein [Takifugu rubripes] 137 4e-32
gi|45550963|ref|NP_723584.2| CG31990-PA [Drosophila melanogaster... 137 5e-32
gi|25012547|gb|AAN71375.1| RE35747p [Drosophila melanogaster] 137 5e-32
gi|7657317|ref|NP_056631.1| LSM4 homolog, U6 small nuclear RNA a... 136 1e-31
gi|27668769|ref|XP_214318.1| similar to U6 snRNA-associated Sm-l... 136 1e-31
gi|31232706|ref|XP_318746.1| ENSANGP00000016613 [Anopheles gambi... 135 1e-31
gi|38047763|gb|AAR09784.1| similar to Drosophila melanogaster CG... 135 2e-31
gi|12834762|dbj|BAB23033.1| unnamed protein product [Mus musculus] 134 3e-31
gi|34902916|ref|NP_912805.1| unnamed protein product [Oryza sati... 134 4e-31
gi|12230291|sp|Q9LGE6|LSM4_ORYSA Probable U6 snRNA-associated Sm... 134 4e-31
gi|12230258|sp|Q43582|LSM4_TOBAC Probable U6 snRNA-associated Sm... 132 1e-30
gi|15241028|ref|NP_198124.1| small nuclear ribonucleoprotein, pu... 132 2e-30
gi|21593495|gb|AAM65462.1| glycine rich protein-like [Arabidopsi... 132 2e-30
gi|20260282|gb|AAM13039.1| unknown protein [Arabidopsis thaliana... 130 5e-30
gi|12230329|sp|Q9ZRU9|LSM4_FAGSY Probable U6 snRNA-associated Sm... 129 1e-29
gi|49097780|ref|XP_410350.1| hypothetical protein AN6213.2 [Aspe... 117 4e-26
gi|46121885|ref|XP_385496.1| hypothetical protein FG05320.1 [Gib... 109 1e-23
gi|32415822|ref|XP_328389.1| hypothetical protein [Neurospora cr... 109 1e-23
gi|49076098|ref|XP_402061.1| hypothetical protein UM04446.1 [Ust... 104 5e-22
gi|23508277|ref|NP_700946.1| U6 snRNA associated Sm-like protein... 103 6e-22
gi|23485036|gb|EAA20166.1| Sm protein, putative [Plasmodium yoel... 103 6e-22
gi|19113071|ref|NP_596279.1| putative small ribonuclear protein-... 100 7e-21
gi|50413178|ref|XP_457218.1| unnamed protein product [Debaryomyc... 100 9e-21
gi|38110088|gb|EAA55858.1| hypothetical protein MG01509.4 [Magna... 94 5e-19
gi|50259394|gb|EAL22067.1| hypothetical protein CNBC2050 [Crypto... 94 6e-19
gi|50545437|ref|XP_500256.1| hypothetical protein [Yarrowia lipo... 85 3e-16
gi|45200801|ref|NP_986371.1| AGL296Wp [Eremothecium gossypii] >g... 73 2e-12
gi|6320958|ref|NP_011037.1| Like Sm-D3 protein; Lsm4p [Saccharom... 67 1e-10
gi|605651|gb|AAA58257.1| regulatory protein 67 1e-10
gi|50309757|ref|XP_454891.1| unnamed protein product [Kluyveromy... 64 9e-10
gi|50288171|ref|XP_446514.1| unnamed protein product [Candida gl... 62 4e-09
gi|18394883|ref|NP_564119.1| small nuclear ribonucleoprotein, pu... 60 1e-08
gi|21555384|gb|AAM63846.1| small nuclear ribonucleoprotein, puta... 60 1e-08
gi|50307679|ref|XP_453819.1| unnamed protein product [Kluyveromy... 60 1e-08
gi|41052905|dbj|BAD07817.1| putative small nuclear ribonucleopro... 59 2e-08
gi|50294275|ref|XP_449549.1| unnamed protein product [Candida gl... 59 2e-08
gi|29468365|gb|AAO85522.1| putative U6 snRNA-associated Sm-like ... 59 2e-08
gi|50545379|ref|XP_500227.1| hypothetical protein [Yarrowia lipo... 58 4e-08
gi|45331345|gb|AAS57926.1| Lsm4p [Trypanosoma brucei] 58 5e-08
gi|46123175|ref|XP_386141.1| hypothetical protein FG05965.1 [Gib... 57 9e-08
gi|32404628|ref|XP_322927.1| hypothetical protein [Neurospora cr... 57 9e-08
gi|15223010|ref|NP_177757.1| small nuclear ribonucleoprotein D3,... 57 1e-07
gi|38103648|gb|EAA50324.1| hypothetical protein MG04083.4 [Magna... 56 1e-07
gi|46432646|gb|EAK92119.1| hypothetical protein CaO19.4146 [Cand... 55 3e-07
gi|50260161|gb|EAL22822.1| hypothetical protein CNBB0430 [Crypto... 55 3e-07
gi|50555508|ref|XP_505162.1| hypothetical protein [Yarrowia lipo... 55 3e-07
gi|19112491|ref|NP_595699.1| probable small nuclear ribonucleopr... 55 4e-07
gi|19172997|ref|NP_597548.1| U6 snRNA ASSOCIATED SM-LIKE PROTEIN... 55 4e-07
gi|45270956|gb|AAS56859.1| YLR147C [Saccharomyces cerevisiae] 55 4e-07
gi|6323176|ref|NP_013248.1| involved in snRNP biogenesis and pre... 55 4e-07
gi|49088696|ref|XP_406144.1| conserved hypothetical protein [Asp... 54 6e-07
gi|8778615|gb|AAF79623.1| F5M15.9 [Arabidopsis thaliana] 54 6e-07
gi|28828063|gb|AAO50746.1| similar to expressed protein; protein... 54 6e-07
gi|50422631|ref|XP_459888.1| unnamed protein product [Debaryomyc... 54 6e-07
gi|45200940|ref|NP_986510.1| AGL157Cp [Eremothecium gossypii] >g... 54 7e-07
gi|50310953|ref|XP_455499.1| unnamed protein product [Kluyveromy... 52 4e-06
gi|19173042|ref|NP_597593.1| similarity to SMALL NUCLEAR RIBONUC... 49 2e-05
gi|27371312|gb|AAH40973.1| MGC52856 protein [Xenopus laevis] 49 2e-05
gi|47211785|emb|CAF93753.1| unnamed protein product [Tetraodon n... 49 3e-05
gi|4759160|ref|NP_004166.1| small nuclear ribonucleoprotein poly... 49 3e-05
gi|41054297|ref|NP_956054.1| small nuclear ribonucleoprotein D3 ... 49 3e-05
gi|49079848|ref|XP_403524.1| hypothetical protein UM05909.1 [Ust... 49 3e-05
gi|17542052|ref|NP_503027.1| small nuclear ribonucleoprotein, sm... 49 3e-05
gi|50344816|ref|NP_001002081.1| zgc:86943 [Danio rerio] >gnl|BL_... 48 5e-05
gi|46227630|gb|EAK88565.1| small nucealr riboprotein SMD3, SM do... 47 7e-05
gi|39585219|emb|CAE57462.1| Hypothetical protein CBG00427 [Caeno... 47 7e-05
gi|46105464|ref|XP_380536.1| hypothetical protein FG00360.1 [Gib... 47 9e-05
gi|15079335|gb|AAH11510.1| Small nuclear ribonucleoprotein D3 [M... 47 1e-04
gi|6730225|pdb|1D3B|A Chain A, Crystal Structure Of The D3b Subc... 47 1e-04
gi|31239529|ref|XP_320178.1| ENSANGP00000011800 [Anopheles gambi... 47 1e-04
gi|24652901|ref|NP_725106.1| CG8427-PA [Drosophila melanogaster]... 46 2e-04
gi|27659256|ref|XP_226489.1| similar to snRNP core protein SMX5d... 46 2e-04
gi|50759758|ref|XP_417768.1| PREDICTED: similar to U7 snRNP-spec... 46 2e-04
gi|15920417|ref|NP_376086.1| 90aa long hypothetical small nuclea... 46 2e-04
gi|21358381|ref|NP_648570.1| CG10418-PA [Drosophila melanogaster... 45 3e-04
gi|48106301|ref|XP_396083.1| similar to CG10418-PA [Apis mellifera] 45 3e-04
gi|32414377|ref|XP_327668.1| hypothetical protein [Neurospora cr... 45 4e-04
gi|46237602|emb|CAE83980.1| LSM2 homolog, U6 small nuclear RNA a... 44 6e-04
gi|13994221|ref|NP_085100.1| snRNP core protein SMX5; dystrophia... 44 6e-04
gi|11138539|gb|AAG31434.1| snRNP core protein SMX5d [Mus musculus] 44 6e-04
gi|10863977|ref|NP_067000.1| LSM2 homolog, U6 small nuclear RNA ... 44 6e-04
gi|23613226|ref|NP_703548.1| u6 snRNA-associated sm-like protein... 44 8e-04
gi|31210107|ref|XP_314020.1| ENSANGP00000010025 [Anopheles gambi... 44 8e-04
gi|17561850|ref|NP_506348.1| u6 snRNA-associated Sm-like protein... 44 0.001
gi|13812245|ref|NP_113376.1| small nuclear ribonucleoprotein D-l... 43 0.001
gi|47212040|emb|CAF92642.1| unnamed protein product [Tetraodon n... 43 0.001
gi|20092011|ref|NP_618086.1| Sm protein [Methanosarcina acetivor... 43 0.002
gi|14249632|ref|NP_116270.1| LSM10, U7 small nuclear RNA associa... 42 0.003
gi|33337945|gb|AAQ13594.1| MSTP074 [Homo sapiens] 42 0.003
gi|50259170|gb|EAL21847.1| hypothetical protein CNBC5480 [Crypto... 42 0.003
gi|14602195|ref|NP_147628.1| homolog of small nuclear ribonucleo... 42 0.003
gi|38101787|gb|EAA48697.1| hypothetical protein MG00355.4 [Magna... 42 0.003
gi|15897150|ref|NP_341755.1| Small nuclear riboprotein protein (... 42 0.004
gi|773428|gb|AAA65451.1| small nuclear ribonucleoprotein 42 0.004
gi|19075959|ref|NP_588459.1| U6-associated Sm snRNP core protein... 41 0.005
gi|6319445|ref|NP_009527.1| Like Sm-D1 protein; Lsm2p [Saccharom... 41 0.005
gi|50410121|ref|XP_456936.1| unnamed protein product [Debaryomyc... 41 0.006
gi|50288309|ref|XP_446583.1| unnamed protein product [Candida gl... 41 0.006
gi|8745056|emb|CAB95310.1| possible small nuclear riboprotein SM... 41 0.006
gi|46806276|dbj|BAD17484.1| putative small nuclear ribonucleopro... 41 0.006
gi|46441248|gb|EAL00547.1| hypothetical protein CaO19.7673 [Cand... 40 0.011
gi|46227255|gb|EAK88205.1| small nuclear ribonucleoprotein D1. S... 40 0.011
gi|21554327|gb|AAM63434.1| U6 snRNA-associated Sm-like protein [... 40 0.011
gi|34871191|ref|XP_345582.1| similar to U7 snRNP-specific Sm-lik... 40 0.011
gi|20270251|ref|NP_620046.1| U7 snRNP-specific Sm-like protein L... 40 0.011
gi|46105460|ref|XP_380534.1| conserved hypothetical protein [Gib... 40 0.011
gi|39597102|emb|CAE59329.1| Hypothetical protein CBG02671 [Caeno... 40 0.014
gi|18379085|ref|NP_563682.1| small nuclear ribonucleoprotein D, ... 40 0.014
gi|45198700|ref|NP_985729.1| AFR182Cp [Eremothecium gossypii] >g... 40 0.014
gi|15232179|ref|NP_191540.1| small nuclear ribonucleoprotein F, ... 40 0.014
gi|21553911|gb|AAM62994.1| snRNP core Sm protein Sm-X5-like prot... 40 0.014
gi|38344744|emb|CAE03048.2| OSJNBa0089K21.2 [Oryza sativa (japon... 40 0.014
gi|50425359|ref|XP_461273.1| unnamed protein product [Debaryomyc... 39 0.019
gi|50252055|dbj|BAD27986.1| putative small nuclear ribonucleopro... 39 0.019
gi|25518743|pir||H86164 hypothetical protein F15K9.7 - Arabidops... 39 0.019
gi|23619200|ref|NP_705162.1| u6 snRNA-associated sm-like protein... 39 0.024
gi|2113818|emb|CAB05859.1| AmphiBrf43 [Branchiostoma floridae] 39 0.024
gi|49088946|ref|XP_406242.1| conserved hypothetical protein [Asp... 39 0.024
gi|37806009|dbj|BAC99422.1| putative snRNP core protein SMX5d [O... 39 0.032
gi|17864386|ref|NP_524774.1| CG10753-PA [Drosophila melanogaster... 39 0.032
gi|17945870|gb|AAL48981.1| RE39488p [Drosophila melanogaster] 39 0.032
gi|15235510|ref|NP_192193.1| small nuclear ribonucleoprotein D1,... 39 0.032
gi|39589389|emb|CAE74418.1| Hypothetical protein CBG22150 [Caeno... 39 0.032
gi|23483747|gb|EAA19315.1| probable u6 snRNA-associated sm-like ... 39 0.032
gi|17510579|ref|NP_490883.1| u6 snRNA-associated Sm-like protein... 39 0.032
gi|23479567|gb|EAA16362.1| Sm protein, putative [Plasmodium yoel... 39 0.032
gi|48716974|dbj|BAD23667.1| putative Sm protein F [Oryza sativa ... 39 0.032
gi|32959908|emb|CAE11897.1| small nuclear ribonucleoprotein Sm D... 38 0.042
gi|17536583|ref|NP_495306.1| small nuclear ribonucleoprotein, sm... 38 0.042
gi|29726409|pdb|1LOJ|A Chain A, Crystal Structure Of A Methanoba... 38 0.042
gi|15678676|ref|NP_275791.1| conserved protein [Methanothermobac... 38 0.042
gi|20150503|pdb|1JRI|A Chain A, The Crystal Structure Of An Sm-L... 38 0.042
gi|29726339|pdb|1JBM|A Chain A, Heptameric Crystal Structure Of ... 38 0.042
gi|13786869|pdb|1I81|A Chain A, Crystal Structure Of A Heptameri... 38 0.042
gi|19115525|ref|NP_594613.1| small nuclear ribonucleoprotein smd... 38 0.042
gi|46107150|ref|XP_380634.1| hypothetical protein FG00458.1 [Gib... 38 0.054
gi|31199215|ref|XP_308555.1| ENSANGP00000009562 [Anopheles gambi... 38 0.054
gi|50732862|ref|XP_418799.1| PREDICTED: similar to KIAA0851 prot... 38 0.054
gi|38104411|gb|EAA50982.1| hypothetical protein MG04741.4 [Magna... 38 0.054
gi|49250837|gb|AAH74514.1| Unknown (protein for MGC:69276) [Xeno... 37 0.071
gi|50291695|ref|XP_448280.1| unnamed protein product [Candida gl... 37 0.071
gi|50259704|gb|EAL22374.1| hypothetical protein CNBB5470 [Crypto... 37 0.071
gi|18312096|ref|NP_558763.1| small nuclear ribonucleoprotein hom... 37 0.071
gi|49110192|ref|XP_411726.1| hypothetical protein AN7589.2 [Aspe... 37 0.093
gi|5902102|ref|NP_008869.1| small nuclear ribonucleoprotein D1 p... 37 0.093
gi|27545253|ref|NP_775359.1| small nuclear ribonucleoprotein D1 ... 37 0.093
gi|50746299|ref|XP_420431.1| PREDICTED: similar to U6 snRNA-asso... 37 0.093
gi|46229796|gb|EAK90614.1| small nuclear ribonucleo protein [Cry... 37 0.093
gi|5901998|ref|NP_009011.1| Sm protein F [Homo sapiens] >gnl|BL_... 37 0.093
gi|49073013|ref|XP_400757.1| hypothetical protein UM03142.1 [Ust... 37 0.093
gi|32408407|ref|XP_324685.1| hypothetical protein [Neurospora cr... 37 0.12
gi|15224366|ref|NP_181909.1| small nuclear ribonucleoprotein F, ... 37 0.12
gi|50344808|ref|NP_001002077.1| zgc:92379 [Danio rerio] >gnl|BL_... 37 0.12
gi|15231485|ref|NP_187416.1| small nuclear ribonucleoprotein D1,... 37 0.12
gi|20861373|ref|XP_134104.1| RIKEN cDNA 2410088K19 [Mus musculus] 36 0.16
gi|47217355|emb|CAG11060.1| unnamed protein product [Tetraodon n... 36 0.16
gi|46229862|gb|EAK90680.1| snRNP core protein homolog Sm-X5. SM... 36 0.21
gi|19075064|ref|NP_586665.1| SMALL NUCLEAR RIBONUCLEOPROTEIN (U1... 36 0.21
gi|19112893|ref|NP_596101.1| small nuclear ribonucleoprotein F [... 36 0.21
gi|11138533|gb|AAG31431.1| snRNP core protein SMX5b [Mus musculu... 35 0.27
gi|13541906|ref|NP_111594.1| Small nuclear ribonucleoprotein (sn... 35 0.27
gi|48477742|ref|YP_023448.1| snRNP Sm-like protein [Picrophilus ... 35 0.27
gi|13812341|ref|NP_113459.1| putative small nuclear ribonucleopr... 35 0.27
gi|23613617|ref|NP_704638.1| small nuclear ribonucleoprotein (sn... 35 0.27
gi|31212897|ref|XP_312266.1| ENSANGP00000002801 [Anopheles gambi... 35 0.35
gi|11602707|emb|CAC18540.1| putative U6-snRNA-associated protein... 35 0.35
gi|31212689|ref|XP_315329.1| ENSANGP00000021121 [Anopheles gambi... 35 0.35
gi|34874855|ref|XP_346027.1| similar to Small nuclear ribonucleo... 35 0.46
gi|42415804|gb|AAS15770.1| DebB [Drosophila simulans] 35 0.46
gi|49619143|gb|AAT68156.1| small nuclear ribonucleoprotein F [Da... 35 0.46
gi|22024001|ref|NP_523708.2| CG16792-PA [Drosophila melanogaster... 35 0.46
gi|495021|gb|AAA28445.1| membrane-associated protein 35 0.46
gi|50728518|ref|XP_416157.1| PREDICTED: similar to Small nuclear... 34 0.60
gi|33876795|gb|AAH02505.2| SNRPF protein [Homo sapiens] 34 0.60
gi|41946811|gb|AAH66015.1| Unknown (protein for IMAGE:5715059) [... 34 0.60
gi|23508457|ref|NP_701126.1| small nuclear ribonucleoprotein D1,... 34 0.60
gi|24656550|ref|NP_611528.1| CG9344-PA [Drosophila melanogaster]... 34 0.60
gi|50308123|ref|XP_454062.1| unnamed protein product [Kluyveromy... 34 0.60
gi|4507131|ref|NP_003086.1| small nuclear ribonucleoprotein poly... 34 0.60
gi|48145619|emb|CAG33032.1| SNRPF [Homo sapiens] 34 0.60
gi|47218337|emb|CAG04169.1| unnamed protein product [Tetraodon n... 34 0.60
gi|25350049|pir||D89269 protein T10G3.6 [imported] - Caenorhabdi... 34 0.60
gi|39645845|gb|AAH63397.1| Unknown (protein for IMAGE:5176590) [... 34 0.60
gi|38079111|ref|XP_357414.1| similar to SNRPF protein [Mus muscu... 34 0.79
gi|45358711|ref|NP_988268.1| Small nuclear ribonucleoprotein (Sm... 34 0.79
gi|29245184|gb|EAA36838.1| GLP_122_3813_3433 [Giardia lamblia AT... 34 0.79
gi|45185890|ref|NP_983606.1| ACR204Cp [Eremothecium gossypii] >g... 34 0.79
gi|19173340|ref|NP_597143.1| PUTATIVE SM-LIKE SMALL NUCLEAR RIBO... 34 0.79
gi|9837170|gb|AAG00459.1| Sm-F [Trypanosoma brucei] 34 0.79
gi|34864945|ref|XP_345815.1| similar to Small nuclear ribonucleo... 34 0.79
gi|41614834|ref|NP_963332.1| NEQ037 [Nanoarchaeum equitans Kin4-... 34 0.79
gi|50306519|ref|XP_453233.1| unnamed protein product [Kluyveromy... 34 0.79
gi|23490523|gb|EAA22278.1| small nuclear riboprotein Sm-D1-like ... 33 1.0
gi|29841078|gb|AAP06091.1| hypothetical protein [Schistosoma jap... 33 1.0
gi|7861942|gb|AAF70450.1| Smx5 [Danio rerio] 33 1.0
gi|15234669|ref|NP_194751.1| small nuclear ribonucleoprotein F, ... 33 1.0
gi|29246813|gb|EAA38396.1| GLP_0_18571_18248 [Giardia lamblia AT... 33 1.3
gi|47218886|emb|CAG05652.1| unnamed protein product [Tetraodon n... 33 1.3
gi|34851678|ref|XP_344755.1| similar to U6 snRNA-associated Sm-l... 33 1.3
gi|16082245|ref|NP_394696.1| small nuclear ribonucleoprotein rel... 33 1.3
gi|34879731|ref|XP_344138.1| similar to U6 snRNA-associated Sm-l... 33 1.3
gi|48477793|ref|YP_023499.1| snRNP Sm-like protein [Picrophilus ... 33 1.8
gi|13812103|ref|NP_113140.1| probable small nuclear ribonucleopr... 33 1.8
gi|21703324|gb|AAM76159.1| U7 snRNP-specific SM-like protein [Bo... 33 1.8
gi|48838252|ref|ZP_00295198.1| COG1958: Small nuclear ribonucleo... 32 2.3
gi|20093660|ref|NP_613507.1| Small nuclear ribonucleoprotein (sn... 32 2.3
gi|21228485|ref|NP_634407.1| Small nuclear riboprotein-like prot... 32 2.3
gi|45201226|ref|NP_986796.1| AGR130Wp [Eremothecium gossypii] >g... 32 2.3
gi|6321510|ref|NP_011588.1| Homolog of human core snRNP protein ... 32 2.3
gi|29726438|pdb|1M5Q|A Chain A, Crystal Structure Of A Novel Sm-... 32 3.0
gi|38103439|gb|EAA50136.1| hypothetical protein MG03895.4 [Magna... 32 3.0
gi|18313113|ref|NP_559780.1| small nuclear ribonucleoprotein hom... 32 3.9
gi|13541187|ref|NP_110875.1| Small nuclear ribonucleoprotein (sn... 32 3.9
gi|14324575|dbj|BAB59502.1| small nuclear ribonucleoprotein [The... 32 3.9
gi|38099604|gb|EAA46929.1| hypothetical protein MG10740.4 [Magna... 32 3.9
gi|31206697|ref|XP_312315.1| ENSANGP00000010577 [Anopheles gambi... 32 3.9
gi|468739|emb|CAA52849.1| TOR1 [Saccharomyces cerevisiae] 31 5.1
gi|6322526|ref|NP_012600.1| Involved in cell cycle signaling and... 31 5.1
gi|408956|gb|AAB66881.1| mutant drr1-1 protein [Saccharomyces ce... 31 5.1
gi|24744796|emb|CAD29796.1| ABC transporter [Planktothrix agardhii] 31 5.1
gi|15679629|ref|NP_276746.1| transcriptional control factor (enh... 31 5.1
gi|20090273|ref|NP_616348.1| Sm protein [Methanosarcina acetivor... 31 5.1
gi|48861447|ref|ZP_00315349.1| COG0442: Prolyl-tRNA synthetase [... 31 5.1
gi|10433122|dbj|BAB13912.1| unnamed protein product [Homo sapiens] 31 6.7
gi|31544646|ref|NP_853224.1| PepC [Mycoplasma gallisepticum R] >... 31 6.7
gi|23126716|ref|ZP_00108604.1| COG0513: Superfamily II DNA and R... 31 6.7
gi|48852470|ref|ZP_00306656.1| COG1958: Small nuclear ribonucleo... 31 6.7
gi|19115292|ref|NP_594380.1| small nuclear ribonucleoprotein, F-... 31 6.7
gi|46108998|ref|XP_381557.1| hypothetical protein FG01381.1 [Gib... 31 6.7
gi|46122663|ref|XP_385885.1| hypothetical protein FG05709.1 [Gib... 31 6.7
gi|10432740|dbj|BAB13840.1| unnamed protein product [Homo sapiens] 30 8.7
gi|25027469|ref|NP_737523.1| fatty-acid synthase I [Corynebacter... 30 8.7
gi|50260704|gb|EAL23354.1| hypothetical protein CNBA0080 [Crypto... 30 8.7
gi|48852496|ref|ZP_00306682.1| COG1958: Small nuclear ribonucleo... 30 8.7
gi|17560310|ref|NP_506870.1| u6 snRNA-associated Sm-like protein... 30 8.7
gi|38108971|gb|EAA54910.1| hypothetical protein MG05701.4 [Magna... 30 8.7
gi|39589637|emb|CAE66872.1| Hypothetical protein CBG12250 [Caeno... 30 8.7
gi|23508471|ref|NP_701140.1| small nuclear ribonucleoprotein F, ... 30 8.7
gi|50258571|gb|EAL21258.1| hypothetical protein CNBD3130 [Crypto... 30 8.7
gi|23943787|ref|NP_115536.1| chromosome 18 open reading frame 4;... 30 8.7
gi|50543240|ref|XP_499786.1| hypothetical protein [Yarrowia lipo... 30 8.7
gi|50842217|ref|YP_055444.1| serine-threonine protein kinase [Pr... 30 8.7
>gi|17533617|ref|NP_495514.1| u6 snRNA-associated Sm-like protein
(lsm-2) [Caenorhabditis elegans]
gi|12230257|sp|Q19952|LSM4_CAEEL Probable U6 snRNA-associated
Sm-like protein LSm4
gi|7500292|pir||T16234 hypothetical protein F32A5.7 -
Caenorhabditis elegans
gi|669028|gb|AAC46661.1| Hypothetical protein F32A5.7
[Caenorhabditis elegans]
Length = 123
Score = 178 bits (451), Expect = 3e-44
Identities = 87/87 (100%), Positives = 87/87 (100%)
Frame = -1
Query: 372 MVLPLSLLKTAQNHPMLVELKNGETYNGHLKACDSWMNIHLVDVIFTSKDGDKFFKMSEA 193
MVLPLSLLKTAQNHPMLVELKNGETYNGHLKACDSWMNIHLVDVIFTSKDGDKFFKMSEA
Sbjct: 1 MVLPLSLLKTAQNHPMLVELKNGETYNGHLKACDSWMNIHLVDVIFTSKDGDKFFKMSEA 60
Query: 192 YVRGSTIKYLRIPETVVDLVKTEVNEV 112
YVRGSTIKYLRIPETVVDLVKTEVNEV
Sbjct: 61 YVRGSTIKYLRIPETVVDLVKTEVNEV 87