Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F32H2_6
(897 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17507091|ref|NP_492416.1| repeat protein (1J547) [Caenorhabdi... 574 e-163
gi|7500364|pir||T21672 hypothetical protein F32H2.4 - Caenorhabd... 574 e-163
gi|39589771|emb|CAE67006.1| Hypothetical protein CBG12405 [Caeno... 347 2e-94
gi|39578743|emb|CAE57166.1| Hypothetical protein CBG25105 [Caeno... 211 2e-53
gi|14150171|ref|NP_115737.1| THO complex 3 [Homo sapiens] >gnl|B... 174 2e-42
gi|46397748|sp|Q8VE80|THO3_MOUSE THO complex subunit 3 (Tho3) >g... 174 2e-42
gi|47215078|emb|CAG04532.1| unnamed protein product [Tetraodon n... 170 5e-41
gi|21312090|ref|NP_082873.1| THO complex 3 [Mus musculus] >gnl|B... 169 1e-40
gi|48128265|ref|XP_396624.1| similar to CG9615-PA [Apis mellifera] 154 3e-36
gi|24645024|ref|NP_649784.1| CG9615-PA [Drosophila melanogaster]... 151 2e-35
gi|21430078|gb|AAM50717.1| GM21396p [Drosophila melanogaster] 150 3e-35
gi|42490855|gb|AAH66325.1| Unknown (protein for MGC:87234) [Homo... 144 2e-33
gi|19075440|ref|NP_587940.1| WD repeat protein [Schizosaccharomy... 143 6e-33
gi|31198341|ref|XP_308118.1| ENSANGP00000017179 [Anopheles gambi... 139 7e-32
gi|15241134|ref|NP_200424.1| transducin family protein / WD-40 r... 137 4e-31
gi|50725519|dbj|BAD32988.1| putative THO complex 3 [Oryza sativa... 117 3e-25
gi|42733793|gb|AAS38711.1| similar to Dictyostelium discoideum (... 116 8e-25
gi|112947|sp|P14197|AAC3_DICDI AAC-rich mRNA clone AAC3 protein ... 116 8e-25
gi|50754949|ref|XP_414555.1| PREDICTED: similar to THO complex s... 114 2e-24
gi|34873865|ref|XP_237957.2| similar to RIKEN cDNA 2410044K02 [R... 109 7e-23
gi|46108820|ref|XP_381468.1| hypothetical protein FG01292.1 [Gib... 106 6e-22
gi|49092654|ref|XP_407788.1| hypothetical protein AN3651.2 [Aspe... 105 1e-21
gi|45506973|ref|ZP_00159321.1| COG2319: FOG: WD40 repeat [Anabae... 92 2e-17
gi|23128981|ref|ZP_00110817.1| COG2319: FOG: WD40 repeat [Nostoc... 89 1e-16
gi|17230292|ref|NP_486840.1| WD-repeat protein [Nostoc sp. PCC 7... 86 1e-15
gi|37522390|ref|NP_925767.1| WD-repeat protein [Gloeobacter viol... 83 7e-15
gi|32423029|ref|XP_331952.1| hypothetical protein [Neurospora cr... 82 2e-14
gi|37522457|ref|NP_925834.1| WD-repeat protein [Gloeobacter viol... 82 2e-14
gi|48894805|ref|ZP_00327914.1| COG2319: FOG: WD40 repeat [Tricho... 81 3e-14
gi|31226862|ref|XP_317781.1| ENSANGP00000022244 [Anopheles gambi... 79 1e-13
gi|17225206|gb|AAL37299.1| beta transducin-like protein HET-E2C*... 79 1e-13
gi|23130558|ref|ZP_00112371.1| COG2319: FOG: WD40 repeat [Nostoc... 79 1e-13
gi|23126094|ref|ZP_00108001.1| COG2319: FOG: WD40 repeat [Nostoc... 79 1e-13
gi|49072206|ref|XP_400392.1| hypothetical protein UM02777.1 [Ust... 79 1e-13
gi|23128236|ref|ZP_00110089.1| COG2319: FOG: WD40 repeat [Nostoc... 78 2e-13
gi|17225204|gb|AAL37298.1| beta transducin-like protein HET-E2C ... 78 2e-13
gi|17225208|gb|AAL37300.1| beta transducin-like protein HET-E2C*... 78 2e-13
gi|46134381|ref|ZP_00157805.2| COG2319: FOG: WD40 repeat [Anabae... 78 2e-13
gi|49124494|ref|XP_412605.1| hypothetical protein AN8468.2 [Aspe... 78 3e-13
gi|48891324|ref|ZP_00324864.1| COG2319: FOG: WD40 repeat [Tricho... 77 7e-13
gi|38108968|gb|EAA54907.1| hypothetical protein MG05698.4 [Magna... 77 7e-13
gi|46119952|ref|ZP_00179225.2| COG2319: FOG: WD40 repeat [Crocos... 76 9e-13
gi|3023956|sp|Q00808|HET1_PODAN Vegetatible incompatibility prot... 76 9e-13
gi|17227525|ref|NP_484073.1| WD-40 repeat protein [Nostoc sp. PC... 76 9e-13
gi|37523920|ref|NP_927297.1| WD-repeat protein [Gloeobacter viol... 76 1e-12
gi|45506958|ref|ZP_00159306.1| COG2319: FOG: WD40 repeat [Anabae... 74 4e-12
gi|46135357|ref|ZP_00162759.2| COG2319: FOG: WD40 repeat [Anabae... 73 8e-12
gi|48097023|ref|XP_393667.1| similar to ENSANGP00000022244 [Apis... 73 8e-12
gi|17230958|ref|NP_487506.1| WD-40 repeat protein [Nostoc sp. PC... 73 8e-12
gi|37521534|ref|NP_924911.1| WD-repeat protein [Gloeobacter viol... 73 1e-11
gi|17232251|ref|NP_488799.1| WD-repeat protein [Nostoc sp. PCC 7... 72 2e-11
gi|23124810|ref|ZP_00106776.1| COG2319: FOG: WD40 repeat [Nostoc... 72 2e-11
gi|17233145|ref|NP_490235.1| WD-repeat protein [Nostoc sp. PCC 7... 72 2e-11
gi|23128312|ref|ZP_00110163.1| COG2319: FOG: WD40 repeat [Nostoc... 71 3e-11
gi|17227743|ref|NP_484291.1| WD-40 repeat protein [Nostoc sp. PC... 71 3e-11
gi|17137500|ref|NP_477329.1| CG4063-PA [Drosophila melanogaster]... 71 3e-11
gi|45509691|ref|ZP_00162024.1| COG2319: FOG: WD40 repeat [Anabae... 71 4e-11
gi|17228167|ref|NP_484715.1| WD-repeat protein [Nostoc sp. PCC 7... 71 4e-11
gi|17225210|gb|AAL37301.1| beta transducin-like protein HET-D2Y ... 70 5e-11
gi|45509405|ref|ZP_00161739.1| COG2319: FOG: WD40 repeat [Anabae... 70 8e-11
gi|37523925|ref|NP_927302.1| WD-repeat protein [Gloeobacter viol... 69 1e-10
gi|17228160|ref|NP_484708.1| WD-40 repeat protein [Nostoc sp. PC... 69 1e-10
gi|21674797|ref|NP_662862.1| WD-repeat family protein [Chlorobiu... 69 2e-10
gi|46135387|ref|ZP_00162792.2| COG2319: FOG: WD40 repeat [Anabae... 68 2e-10
gi|47215488|emb|CAG01596.1| unnamed protein product [Tetraodon n... 68 2e-10
gi|26326543|dbj|BAC27015.1| unnamed protein product [Mus musculus] 68 3e-10
gi|33468969|ref|NP_065626.1| transducin (beta)-like 1 X-linked; ... 68 3e-10
gi|13173175|gb|AAK14331.1| unknown protein i8 [Aedes aegypti] 68 3e-10
gi|23124360|ref|ZP_00106355.1| COG2319: FOG: WD40 repeat [Nostoc... 68 3e-10
gi|17227779|ref|NP_484327.1| WD-40 repeat protein [Nostoc sp. PC... 68 3e-10
gi|17232326|ref|NP_488874.1| WD-repeat protein [Nostoc sp. PCC 7... 67 4e-10
gi|46135416|ref|ZP_00203492.1| COG2319: FOG: WD40 repeat [Anabae... 67 4e-10
gi|45508168|ref|ZP_00160508.1| COG2319: FOG: WD40 repeat [Anabae... 67 5e-10
gi|49098124|ref|XP_410522.1| hypothetical protein AN6385.2 [Aspe... 67 5e-10
gi|37522224|ref|NP_925601.1| WD-repeat protein [Gloeobacter viol... 67 5e-10
gi|19335616|gb|AAL85577.1| unknown protein [Aedes aegypti] 67 5e-10
gi|13173173|gb|AAK14330.1| unknown protein i8 [Aedes aegypti] 67 5e-10
gi|48893580|ref|ZP_00326778.1| COG2319: FOG: WD40 repeat [Tricho... 67 5e-10
gi|50797401|ref|XP_423947.1| PREDICTED: similar to nuclear recep... 67 7e-10
gi|19335618|gb|AAL85578.1| unknown protein [Aedes aegypti] 67 7e-10
gi|17229616|ref|NP_486164.1| WD-40 repeat protein [Nostoc sp. PC... 66 9e-10
gi|49119215|gb|AAH73215.1| Unknown (protein for MGC:80502) [Xeno... 66 9e-10
gi|21356075|ref|NP_649969.1| CG3909-PA [Drosophila melanogaster]... 66 9e-10
gi|17227974|ref|NP_484522.1| WD-40 repeat protein [Nostoc sp. PC... 66 9e-10
gi|31322517|gb|AAP20646.1| nuclear receptor co-repressor complex... 66 9e-10
gi|26331128|dbj|BAC29294.1| unnamed protein product [Mus musculus] 66 9e-10
gi|12006108|gb|AAG44738.1| IRA1 [Mus musculus] 66 9e-10
gi|10434648|dbj|BAB14331.1| unnamed protein product [Homo sapiens] 66 9e-10
gi|31543001|ref|NP_109657.2| IRA1 protein [Mus musculus] >gnl|BL... 66 9e-10
gi|19913371|ref|NP_078941.2| nuclear receptor co-repressor/HDAC3... 66 9e-10
gi|34855547|ref|XP_345196.1| similar to nuclear receptor co-repr... 66 9e-10
gi|46439108|gb|EAK98430.1| hypothetical protein CaO19.536 [Candi... 66 9e-10
gi|37520744|ref|NP_924121.1| WD-repeat protein [Gloeobacter viol... 66 1e-09
gi|26327737|dbj|BAC27612.1| unnamed protein product [Mus musculus] 66 1e-09
gi|47085759|ref|NP_998214.1| zgc:56055 [Danio rerio] >gnl|BL_ORD... 66 1e-09
gi|48893749|ref|ZP_00326947.1| COG2319: FOG: WD40 repeat [Tricho... 65 2e-09
gi|17233117|ref|NP_490207.1| WD-repeat protein [Nostoc sp. PCC 7... 65 2e-09
gi|45509331|ref|ZP_00161665.1| COG2319: FOG: WD40 repeat [Anabae... 65 2e-09
gi|17227934|ref|NP_484482.1| serine/threonine kinase with WD-40 ... 65 2e-09
gi|15150805|ref|NP_150600.1| transducin beta-like 1Y; transducin... 65 2e-09
gi|17933598|ref|NP_525090.1| CG10545-PA [Drosophila melanogaster... 65 3e-09
gi|47226994|emb|CAG05886.1| unnamed protein product [Tetraodon n... 65 3e-09
gi|25404314|pir||A96638 hypothetical protein F11P17.7 [imported]... 64 3e-09
gi|45768550|gb|AAH67651.1| Unknown (protein for IMAGE:6963216) [... 64 3e-09
gi|12006104|gb|AAG44736.1| IRA1 [Homo sapiens] 64 3e-09
gi|1346729|sp|P49695|PKWA_THECU Probable serine/threonine-protei... 64 5e-09
gi|42562854|ref|NP_176316.3| WD-40 repeat family protein / katan... 64 5e-09
gi|38344202|emb|CAE05767.2| OSJNBa0064G10.18 [Oryza sativa (japo... 64 5e-09
gi|31214997|ref|XP_315943.1| ENSANGP00000013597 [Anopheles gambi... 64 5e-09
gi|41056233|ref|NP_956412.1| Unknown (protein for MGC:63538); wu... 64 5e-09
gi|48835147|ref|ZP_00292148.1| COG2319: FOG: WD40 repeat [Thermo... 64 5e-09
gi|31377770|ref|NP_056241.2| DKFZP434C245 protein [Homo sapiens]... 64 6e-09
gi|46437324|gb|EAK96673.1| hypothetical protein CaO19.9539 [Cand... 63 8e-09
gi|50728412|ref|XP_416132.1| PREDICTED: similar to TUWD12 [Gallu... 63 8e-09
gi|18415801|ref|NP_568194.1| transducin family protein / WD-40 r... 63 8e-09
gi|10178281|emb|CAC08339.1| katanin p80 subunit-like protein [Ar... 63 8e-09
gi|13472512|ref|NP_104079.1| WD-repeart protein, beta transducin... 63 8e-09
gi|2462069|emb|CAA04998.1| vanadium chloroperoxidase [Nostoc sp.... 63 8e-09
gi|5032159|ref|NP_005638.1| transducin beta-like 1X; transducin ... 63 1e-08
gi|45509197|ref|ZP_00161532.1| COG2319: FOG: WD40 repeat [Anabae... 63 1e-08
gi|49102841|ref|XP_411097.1| hypothetical protein AN6960.2 [Aspe... 63 1e-08
gi|20091406|ref|NP_617481.1| WD-domain containing protein [Metha... 63 1e-08
gi|45190361|ref|NP_984615.1| AEL246Cp [Eremothecium gossypii] >g... 63 1e-08
gi|39593406|emb|CAE64876.1| Hypothetical protein CBG09688 [Caeno... 63 1e-08
gi|23503100|sp|O60907|TBLX_HUMAN F-box-like/WD-repeat protein TB... 63 1e-08
gi|23130123|ref|ZP_00111942.1| COG2319: FOG: WD40 repeat [Nostoc... 63 1e-08
gi|25402650|pir||E86245 hypothetical protein [imported] - Arabid... 62 1e-08
gi|3983137|gb|AAC83821.1| Lis1 homolog [Drosophila melanogaster] 62 1e-08
gi|47216991|emb|CAG04933.1| unnamed protein product [Tetraodon n... 62 1e-08
gi|23129722|ref|ZP_00111547.1| COG2319: FOG: WD40 repeat [Nostoc... 62 1e-08
gi|17137196|ref|NP_477160.1| CG8440-PA [Drosophila melanogaster]... 62 1e-08
gi|46134639|ref|ZP_00158286.2| COG2319: FOG: WD40 repeat [Anabae... 62 1e-08
gi|48098117|ref|XP_393976.1| similar to heterotrimeric guanine n... 62 2e-08
gi|17230611|ref|NP_487159.1| WD repeat protein with Ser/Thr prot... 62 2e-08
gi|15220302|ref|NP_172582.1| WD-40 repeat family protein / katan... 62 2e-08
gi|33417154|gb|AAH56099.1| MGC69111 protein [Xenopus laevis] 62 2e-08
gi|13938537|gb|AAH07417.1| DKFZP434C245 protein [Homo sapiens] 62 2e-08
gi|37682095|gb|AAQ97974.1| TUWD12 [Danio rerio] 62 2e-08
gi|45506821|ref|ZP_00159171.1| COG2319: FOG: WD40 repeat [Anabae... 62 2e-08
gi|47229791|emb|CAG06987.1| unnamed protein product [Tetraodon n... 62 2e-08
gi|50754099|ref|XP_414244.1| PREDICTED: similar to DKFZP434C245 ... 62 2e-08
gi|49125072|ref|XP_412642.1| hypothetical protein AN8505.2 [Aspe... 62 2e-08
gi|48890816|ref|ZP_00324427.1| COG2319: FOG: WD40 repeat [Tricho... 62 2e-08
gi|46130702|ref|XP_389131.1| hypothetical protein FG08955.1 [Gib... 61 3e-08
gi|11055998|ref|NP_067642.1| guanine nucleotide-binding protein,... 61 3e-08
gi|3913720|sp|O45040|GBB1_HOMAM Guanine nucleotide-binding prote... 61 3e-08
gi|50804410|ref|XP_424310.1| PREDICTED: similar to transducin (b... 61 4e-08
gi|50807285|ref|XP_424555.1| PREDICTED: similar to transducin (b... 61 4e-08
gi|23125398|ref|ZP_00107333.1| COG2319: FOG: WD40 repeat [Nostoc... 61 4e-08
gi|46134601|ref|ZP_00158195.2| COG2319: FOG: WD40 repeat [Anabae... 61 4e-08
gi|31214992|ref|XP_315942.1| ENSANGP00000014177 [Anopheles gambi... 61 4e-08
gi|31214985|ref|XP_315941.1| ENSANGP00000014117 [Anopheles gambi... 61 4e-08
gi|45508310|ref|ZP_00160649.1| COG2319: FOG: WD40 repeat [Anabae... 60 5e-08
gi|45525517|ref|ZP_00176748.1| COG2319: FOG: WD40 repeat [Crocos... 60 5e-08
gi|47087315|ref|NP_998646.1| guanine nucleotide binding protein ... 60 5e-08
gi|27597250|dbj|BAC55158.1| guanine nucleotide-binding protein b... 60 5e-08
gi|50549007|ref|XP_501974.1| hypothetical protein [Yarrowia lipo... 60 5e-08
gi|45506782|ref|ZP_00159132.1| COG2319: FOG: WD40 repeat [Anabae... 60 5e-08
gi|17225202|gb|AAL37297.1| beta transducin-like protein HET-E4s ... 60 7e-08
gi|26326347|dbj|BAC26917.1| unnamed protein product [Mus musculus] 60 7e-08
gi|23130132|ref|ZP_00111951.1| COG2319: FOG: WD40 repeat [Nostoc... 60 7e-08
gi|11127729|gb|AAG31061.1| G-protein B3 subunit [Ambystoma tigri... 60 7e-08
gi|50759201|ref|XP_417564.1| PREDICTED: similar to beta 1 subuni... 60 7e-08
gi|20502976|ref|NP_038558.1| guanine nucleotide-binding protein,... 60 7e-08
gi|17534675|ref|NP_496508.1| G Protein, Beta subunit (37.4 kD) (... 60 7e-08
gi|49899896|gb|AAH76910.1| Unknown (protein for MGC:89081) [Xeno... 60 7e-08
gi|34853578|ref|XP_213170.2| similar to guanine nucleotide-bindi... 60 7e-08
gi|17230661|ref|NP_487209.1| WD repeat protein with Ser/Thr prot... 60 7e-08
gi|50553923|ref|XP_504370.1| hypothetical protein [Yarrowia lipo... 60 7e-08
gi|15451370|dbj|BAB64489.1| hypothetical protein [Macaca fascicu... 60 9e-08
gi|15208165|dbj|BAB63107.1| hypothetical protein [Macaca fascicu... 60 9e-08
gi|19113822|ref|NP_592910.1| general transcriptional repressor t... 60 9e-08
gi|9931971|gb|AAB81475.2| general transcriptional repressor Tup1... 60 9e-08
gi|48891847|ref|ZP_00325296.1| COG2319: FOG: WD40 repeat [Tricho... 60 9e-08
gi|48894581|ref|ZP_00327690.1| COG2319: FOG: WD40 repeat [Tricho... 60 9e-08
gi|15451392|dbj|BAB64500.1| hypothetical protein [Macaca fascicu... 60 9e-08
gi|6680045|ref|NP_032168.1| guanine nucleotide-binding protein, ... 60 9e-08
gi|11127727|gb|AAG31060.1| G-protein B1 subunit [Ambystoma tigri... 60 9e-08
gi|71875|pir||RGKWB GTP-binding regulatory protein beta chain - ... 60 9e-08
gi|28849825|gb|AAO46882.1| heterotrimeric guanine nucleotide-bin... 60 9e-08
gi|47086811|ref|NP_997774.1| guanine nucleotide binding protein ... 60 9e-08
gi|1730213|sp|P54311|GBB1_RAT Guanine nucleotide-binding protein... 60 9e-08
gi|2494887|sp|P79147|GBB3_CANFA Guanine nucleotide-binding prote... 60 9e-08
gi|11177902|ref|NP_068630.1| guanine nucleotide-binding protein,... 60 9e-08
gi|17136870|ref|NP_476957.1| CG7704-PA [Drosophila melanogaster]... 60 9e-08
gi|30688991|ref|NP_197734.2| transducin family protein / WD-40 r... 59 1e-07
gi|12655011|gb|AAH01353.1| Katanin p80 subunit B 1 [Homo sapiens... 59 1e-07
gi|30688988|ref|NP_851064.1| transducin family protein / WD-40 r... 59 1e-07
gi|12845754|dbj|BAB26884.1| unnamed protein product [Mus musculus] 59 1e-07
gi|26329699|dbj|BAC28588.1| unnamed protein product [Mus musculu... 59 1e-07
gi|17227780|ref|NP_484328.1| WD-40 repeat protein [Nostoc sp. PC... 59 1e-07
gi|26327487|dbj|BAC27487.1| unnamed protein product [Mus musculus] 59 1e-07
gi|15289878|dbj|BAB63574.1| P0010B10.21 [Oryza sativa (japonica ... 59 1e-07
gi|45507426|ref|ZP_00159770.1| COG2319: FOG: WD40 repeat [Anabae... 59 1e-07
gi|34851232|ref|XP_214635.2| similar to katanin p80 subunit B 1;... 59 1e-07
gi|38089557|ref|XP_134311.2| katanin p80 (WD40-containing) subun... 59 1e-07
gi|30584393|gb|AAP36445.1| Homo sapiens katanin p80 (WD40-contai... 59 1e-07
gi|23124439|ref|ZP_00106428.1| COG2319: FOG: WD40 repeat [Nostoc... 59 1e-07
gi|9759081|dbj|BAB09559.1| unnamed protein product [Arabidopsis ... 59 1e-07
gi|4139469|pdb|1A0R|B Chain B, Heterotrimeric Complex Of Phosduc... 59 1e-07
gi|3023838|sp|P79959|GBB1_XENLA Guanine nucleotide-binding prote... 59 1e-07
gi|28461181|ref|NP_786971.1| guanine nucleotide binding protein ... 59 1e-07
gi|13591874|ref|NP_112249.1| guanine nucleotide-binding protein,... 59 1e-07
gi|47220310|emb|CAG03344.1| unnamed protein product [Tetraodon n... 59 1e-07
gi|48102256|ref|XP_395314.1| similar to CG12797-PA [Apis mellifera] 59 1e-07
gi|17391209|gb|AAH18512.1| 8030499H02Rik protein [Mus musculus] 59 1e-07
gi|17230283|ref|NP_486831.1| WD-repeat protein [Nostoc sp. PCC 7... 59 1e-07
gi|12652731|gb|AAH00115.1| Guanine nucleotide-binding protein, b... 59 1e-07
gi|4504053|ref|NP_002066.1| guanine nucleotide-binding protein, ... 59 1e-07
gi|47551119|ref|NP_999734.1| katanin p80 subunit [Strongylocentr... 59 1e-07
gi|50749745|ref|XP_421737.1| PREDICTED: similar to TAF5 RNA poly... 59 2e-07
gi|41053421|ref|NP_956616.1| similar to U5 snRNP-specific 40 kDa... 59 2e-07
gi|20091353|ref|NP_617428.1| WD40-repeat containing protein [Met... 59 2e-07
gi|48838134|ref|ZP_00295082.1| COG2319: FOG: WD40 repeat [Methan... 59 2e-07
gi|37577053|gb|AAQ94086.1| guanine nucleotide binding protein be... 59 2e-07
gi|50421955|ref|XP_459538.1| unnamed protein product [Debaryomyc... 58 2e-07
gi|121009|sp|P11017|GBB2_BOVIN Guanine nucleotide-binding protei... 58 2e-07
gi|37520475|ref|NP_923852.1| WD-repeat protein [Gloeobacter viol... 58 2e-07
gi|15100041|gb|AAK84217.1| G-protein beta-2 subunit [Rattus norv... 58 2e-07
gi|17232051|ref|NP_488599.1| WD-40 repeat-protein [Nostoc sp. PC... 58 2e-07
gi|13937391|ref|NP_034442.1| guanine nucleotide-binding protein,... 58 2e-07
gi|23130298|ref|ZP_00112115.1| COG2319: FOG: WD40 repeat [Nostoc... 58 3e-07
gi|5031817|ref|NP_005877.1| katanin p80 subunit B 1; katanin (80... 58 3e-07
gi|46134549|ref|ZP_00158076.2| COG2319: FOG: WD40 repeat [Anabae... 58 3e-07
gi|23123730|ref|ZP_00105782.1| COG2319: FOG: WD40 repeat [Nostoc... 58 3e-07
gi|41054303|ref|NP_956049.1| Unknown (protein for MGC:65943); mg... 58 3e-07
gi|50424771|ref|XP_460975.1| unnamed protein product [Debaryomyc... 58 3e-07
gi|31240513|ref|XP_320670.1| ENSANGP00000021164 [Anopheles gambi... 58 3e-07
gi|984551|gb|AAC72250.1| G protein beta 2 subunit [Mus musculus] 58 3e-07
gi|50729466|ref|XP_425517.1| PREDICTED: similar to guanine nucle... 58 3e-07
gi|1730218|sp|Q08706|GBB_LYMST Guanine nucleotide-binding protei... 58 3e-07
gi|49098364|ref|XP_410642.1| hypothetical protein AN6505.2 [Aspe... 58 3e-07
gi|627169|pir||S33263 transcription initiation factor IID-associ... 58 3e-07
gi|11066216|gb|AAG28504.1| TUPA [Emericella nidulans] 58 3e-07
gi|27694663|gb|AAH43772.1| Katnb1-prov protein [Xenopus laevis] 57 4e-07
gi|50257760|gb|EAL20461.1| hypothetical protein CNBE3820 [Crypto... 57 4e-07
gi|23129632|ref|ZP_00111458.1| COG2319: FOG: WD40 repeat [Nostoc... 57 4e-07
gi|48892224|ref|ZP_00325622.1| COG2319: FOG: WD40 repeat [Tricho... 57 4e-07
gi|6324076|ref|NP_014146.1| transcription export complex compone... 57 4e-07
gi|48840987|ref|ZP_00297913.1| COG2319: FOG: WD40 repeat [Methan... 57 4e-07
gi|50414726|gb|AAH77273.1| Unknown (protein for IMAGE:4031030) [... 57 4e-07
gi|47498030|ref|NP_998874.1| hypothetical protein MGC69344 [Xeno... 57 6e-07
gi|15235470|ref|NP_192182.1| transducin family protein / WD-40 r... 57 6e-07
gi|50752442|ref|XP_422782.1| PREDICTED: similar to guanine nucle... 57 6e-07
gi|49091992|ref|XP_407457.1| hypothetical protein AN3320.2 [Aspe... 57 6e-07
gi|48891514|ref|ZP_00325021.1| COG2319: FOG: WD40 repeat [Tricho... 57 6e-07
gi|23129032|ref|ZP_00110866.1| COG2319: FOG: WD40 repeat [Nostoc... 57 6e-07
gi|37520294|ref|NP_923671.1| WD-40 repeat protein [Gloeobacter v... 57 6e-07
gi|49257618|gb|AAH74250.1| Unknown (protein for MGC:84000) [Xeno... 57 6e-07
gi|48894319|ref|ZP_00327428.1| COG2319: FOG: WD40 repeat [Tricho... 57 6e-07
gi|45360769|ref|NP_989058.1| hypothetical protein MGC75813 [Xeno... 57 7e-07
gi|46130696|ref|XP_389128.1| hypothetical protein FG08952.1 [Gib... 57 7e-07
gi|39580327|emb|CAE64482.1| Hypothetical protein CBG09206 [Caeno... 57 7e-07
gi|38505813|ref|NP_942432.1| WD-repeat protein [Synechocystis sp... 57 7e-07
gi|50291233|ref|XP_448049.1| unnamed protein product [Candida gl... 56 9e-07
gi|1491718|emb|CAA64777.1| hTAFII100 [Homo sapiens] 56 9e-07
gi|34880600|ref|XP_346308.1| similar to RIKEN cDNA 1110005N04 [R... 56 9e-07
gi|30354079|gb|AAH52268.1| TAF5 protein [Homo sapiens] 56 9e-07
gi|21071067|ref|NP_008882.2| TBP-associated factor 5; TATA box b... 56 9e-07
gi|6686341|sp|Q15542|TAF5_HUMAN Transcription initiation factor ... 56 9e-07
gi|33585633|gb|AAH56002.1| Gnb3-prov protein [Xenopus laevis] 56 9e-07
gi|28893469|ref|NP_796316.1| TAF5 RNA polymerase II, TATA box bi... 56 9e-07
gi|1732075|gb|AAC50902.1| TBP-associated factor [Homo sapiens] 56 9e-07
gi|34863779|ref|XP_219965.2| similar to RIKEN cDNA 6330528C20 ge... 56 9e-07
gi|50309993|ref|XP_455010.1| unnamed protein product [Kluyveromy... 56 1e-06
gi|30689741|ref|NP_197897.2| transducin family protein / WD-40 r... 56 1e-06
gi|46134449|ref|ZP_00157910.2| COG2319: FOG: WD40 repeat [Anabae... 56 1e-06
gi|6325435|ref|NP_015504.1| Splicing factor, component of the U4... 56 1e-06
gi|31542899|ref|NP_038559.2| guanine nucleotide-binding protein,... 56 1e-06
gi|71874|pir||RGMSB4 GTP-binding regulatory protein beta-4 chain... 56 1e-06
gi|45359810|gb|AAS59142.1| G-protein beta 4 subunit [Rattus norv... 56 1e-06
gi|39592382|emb|CAE63459.1| Hypothetical protein CBG07923 [Caeno... 56 1e-06
gi|50258309|gb|EAL21000.1| hypothetical protein CNBD6010 [Crypto... 56 1e-06
gi|47117222|sp|Q8C092|TAF5_MOUSE Transcription initiation factor... 56 1e-06
gi|20833107|ref|XP_145012.1| guanine nucleotide binding protein,... 55 2e-06
gi|23129645|ref|ZP_00111471.1| COG2319: FOG: WD40 repeat [Nostoc... 55 2e-06
gi|3122601|sp|P93107|PF20_CHLRE Flagellar WD-repeat protein PF20... 55 2e-06
gi|6319675|ref|NP_009757.1| Subunit (90 kDa) of TFIID and SAGA c... 55 2e-06
gi|19528447|gb|AAL90338.1| RE19540p [Drosophila melanogaster] 55 2e-06
gi|45361545|ref|NP_989349.1| hypothetical protein MGC76247 [Xeno... 55 2e-06
gi|48893630|ref|ZP_00326828.1| COG2319: FOG: WD40 repeat [Tricho... 55 2e-06
gi|48893278|ref|ZP_00326547.1| COG0515: Serine/threonine protein... 55 2e-06
gi|45508715|ref|ZP_00161052.1| COG2319: FOG: WD40 repeat [Anabae... 55 2e-06
gi|16198479|gb|AAH15920.1| GNB3 protein [Homo sapiens] 55 2e-06
gi|50416375|gb|AAH77313.1| Unknown (protein for MGC:80243) [Xeno... 55 2e-06
gi|19527184|ref|NP_598727.1| TAF5-like RNA polymerase II, p300/C... 55 2e-06
gi|26354532|dbj|BAC40894.1| unnamed protein product [Mus musculus] 55 2e-06
gi|45544464|emb|CAF34034.1| putative WD-repeat-containing protei... 55 2e-06
gi|121014|sp|P23232|GBB_LOLFO Guanine nucleotide-binding protein... 55 2e-06
gi|37223059|gb|AAQ90156.1| visual G-protein beta subunit [Loligo... 55 2e-06
gi|41019302|gb|AAR98560.1| GntN [Micromonospora echinospora] 55 2e-06
gi|1730215|sp|P54313|GBB2_RAT Guanine nucleotide-binding protein... 55 2e-06
gi|33416638|gb|AAH55978.1| Loc60449-prov protein [Xenopus laevis] 55 2e-06
gi|49101231|ref|XP_410940.1| hypothetical protein AN6803.2 [Aspe... 55 2e-06
gi|34851989|ref|XP_226577.2| similar to RIKEN cDNA 1110005N04 [R... 55 2e-06
gi|17508727|ref|NP_493279.1| suppressor of Mec and Unc defects S... 55 2e-06
gi|23126612|ref|ZP_00108502.1| COG2319: FOG: WD40 repeat [Nostoc... 55 3e-06
gi|1353514|gb|AAB01736.1| G protein beta 2 subunit [Mus musculus] 55 3e-06
gi|163111|gb|AAA30552.1| G protein beta subunit 55 3e-06
gi|34854574|ref|XP_218024.2| similar to RIKEN cDNA 1110005N04 [R... 55 3e-06
gi|47214090|emb|CAF95347.1| unnamed protein product [Tetraodon n... 55 3e-06
gi|36958731|gb|AAQ87199.1| Vegetatible incompatibility protein H... 55 3e-06
gi|48891596|ref|ZP_00325089.1| COG0515: Serine/threonine protein... 55 3e-06
gi|45505417|ref|ZP_00157801.1| COG2319: FOG: WD40 repeat [Anabae... 55 3e-06
gi|306785|gb|AAA35922.1| G protein beta subunit 55 3e-06
gi|15224356|ref|NP_181905.1| transducin family protein / WD-40 r... 54 4e-06
gi|49522519|gb|AAH75582.1| Unknown (protein for MGC:89568) [Xeno... 54 4e-06
gi|45190337|ref|NP_984591.1| AEL269Cp [Eremothecium gossypii] >g... 54 4e-06
gi|50545019|ref|XP_500061.1| YlTUP1 [Yarrowia lipolytica] >gnl|B... 54 4e-06
gi|23124949|ref|ZP_00106905.1| COG2319: FOG: WD40 repeat [Nostoc... 54 4e-06
gi|23126489|ref|ZP_00108383.1| COG2319: FOG: WD40 repeat [Nostoc... 54 5e-06
gi|45508311|ref|ZP_00160650.1| COG2319: FOG: WD40 repeat [Anabae... 54 5e-06
gi|50741419|ref|XP_419579.1| PREDICTED: similar to TAF5-like RNA... 54 5e-06
gi|46134602|ref|ZP_00158196.2| COG2319: FOG: WD40 repeat [Anabae... 54 5e-06
gi|47222782|emb|CAG01749.1| unnamed protein product [Tetraodon n... 54 5e-06
gi|17481223|dbj|BAB79203.1| G protein beta subunit [Halocynthia ... 54 5e-06
gi|47085751|ref|NP_998183.1| zgc:56071 [Danio rerio] >gnl|BL_ORD... 54 5e-06
gi|34394959|dbj|BAC84508.1| putative WD40 protein Ciao1 [Oryza s... 54 5e-06
gi|29465691|gb|AAL99251.1| TupA protein [Penicillium marneffei] 54 5e-06
gi|47222534|emb|CAG02899.1| unnamed protein product [Tetraodon n... 54 6e-06
gi|4758560|ref|NP_004805.1| U5 snRNP-specific 40 kDa protein (hP... 54 6e-06
gi|17566626|ref|NP_505737.1| WD repeat domain 5B (54.5 kD) (5L21... 54 6e-06
gi|48895671|ref|ZP_00328655.1| COG0515: Serine/threonine protein... 54 6e-06
gi|544373|sp|P36408|GBB_DICDI Guanine nucleotide-binding protein... 53 8e-06
gi|20129125|ref|NP_608501.1| CG3436-PA [Drosophila melanogaster]... 53 8e-06
gi|339937|gb|AAA63265.1| transducin beta-1 subunit 53 8e-06
gi|49256488|gb|AAH74136.1| Unknown (protein for MGC:81859) [Xeno... 53 8e-06
gi|48854377|ref|ZP_00308540.1| COG2319: FOG: WD40 repeat [Cytoph... 53 8e-06
gi|50551767|ref|XP_503358.1| hypothetical protein [Yarrowia lipo... 53 8e-06
gi|49073338|ref|XP_400895.1| hypothetical protein UM03280.1 [Ust... 53 8e-06
gi|3406654|gb|AAC29438.1| transcriptional repressor TUP1 [Dictyo... 53 8e-06
gi|4140328|emb|CAA20356.1| dJ283E3.7.3 (Guanine Nucleotide Bindi... 53 8e-06
gi|11875643|gb|AAG40737.1| Bap1 [Myxococcus xanthus] 53 8e-06
gi|3387984|gb|AAC28655.1| beta-subunit signal transducing protei... 53 8e-06
gi|47679343|gb|AAT36652.1| Tup1p [Exophiala dermatitidis] 53 8e-06
gi|48130902|ref|XP_396674.1| similar to ENSANGP00000010673 [Apis... 53 1e-05
gi|47221781|emb|CAG08835.1| unnamed protein product [Tetraodon n... 53 1e-05
gi|11139411|gb|AAG31685.1| activated protein kinase C receptor L... 53 1e-05
gi|23130358|ref|ZP_00112175.1| COG2319: FOG: WD40 repeat [Nostoc... 53 1e-05
gi|39545918|gb|AAR28022.1| TAF5 [Arabidopsis thaliana] 53 1e-05
gi|50546811|ref|XP_500875.1| hypothetical protein [Yarrowia lipo... 53 1e-05
gi|15239819|ref|NP_199731.1| WD-40 repeat family protein / zfwd4... 52 1e-05
gi|24210418|emb|CAD54457.1| LIS1 protein [Dictyostelium discoide... 52 1e-05
gi|48097586|ref|XP_393828.1| similar to transducin family protei... 52 1e-05
gi|50255088|gb|EAL17827.1| hypothetical protein CNBL0890 [Crypto... 52 1e-05
gi|28279952|gb|AAH44534.1| Zgc:55911 protein [Danio rerio] 52 1e-05
gi|17555002|ref|NP_498096.1| nuclear matrix protein SNEV (3G260)... 52 1e-05
gi|50233904|ref|NP_956441.2| similar to WD40 protein Ciao1 [Dani... 52 1e-05
gi|46138173|ref|XP_390777.1| hypothetical protein FG10601.1 [Gib... 52 1e-05
gi|33390985|gb|AAQ17185.1| WD40 protein Ciao1-like protein [Cras... 52 1e-05
gi|7657439|ref|NP_055224.1| PCAF associated factor 65 beta; TAF5... 52 1e-05
gi|13991860|gb|AAK51530.1| p36 LACK protein [Leishmania amazonen... 52 1e-05
gi|2662477|gb|AAB88300.1| LACK [Leishmania major] >gnl|BL_ORD_ID... 52 1e-05
gi|45508210|ref|ZP_00160550.1| COG2319: FOG: WD40 repeat [Anabae... 52 1e-05
gi|17232369|ref|NP_488917.1| WD-repeat protein [Nostoc sp. PCC 7... 52 1e-05
gi|45360929|ref|NP_988871.1| hypothetical protein MGC75826 [Xeno... 52 1e-05
gi|24652663|ref|NP_725018.1| CG9062-PB [Drosophila melanogaster]... 52 1e-05
gi|25012800|gb|AAN71491.1| RE72568p [Drosophila melanogaster] 52 1e-05
gi|50539942|ref|NP_001002437.1| zgc:92641 [Danio rerio] >gnl|BL_... 52 1e-05
gi|20257506|gb|AAM15922.1| guanine nucleotide binding protein be... 52 1e-05
gi|19113764|ref|NP_592852.1| WD domian, G-beta repeat protein [S... 52 1e-05
gi|3646272|emb|CAA08816.1| putative transcription factor [Homo s... 52 1e-05
gi|41056005|ref|NP_956423.1| hypothetical protein MGC55391 [Dani... 52 2e-05
gi|12840673|dbj|BAB24913.1| unnamed protein product [Mus musculu... 52 2e-05
gi|38099099|gb|EAA46486.1| hypothetical protein MG08829.4 [Magna... 52 2e-05
gi|26665869|ref|NP_758440.1| TUWD12 [Homo sapiens] >gnl|BL_ORD_I... 52 2e-05
gi|32420377|ref|XP_330632.1| hypothetical protein [Neurospora cr... 52 2e-05
gi|37231578|gb|AAH58365.1| Prp8bp-pending protein [Mus musculus] 52 2e-05
gi|41724850|ref|ZP_00151660.1| COG2319: FOG: WD40 repeat [Dechlo... 52 2e-05
gi|12856025|dbj|BAB30542.1| unnamed protein product [Mus musculu... 52 2e-05
gi|47221560|emb|CAF97825.1| unnamed protein product [Tetraodon n... 52 2e-05
gi|27807199|ref|NP_777088.1| platelet-activating factor acetylhy... 52 2e-05
gi|39581518|emb|CAE64254.1| Hypothetical protein CBG08899 [Caeno... 52 2e-05
gi|23126805|ref|ZP_00108691.1| COG2319: FOG: WD40 repeat [Nostoc... 52 2e-05
gi|47059149|ref|NP_082016.1| similar to TUWD12 [Mus musculus] >g... 52 2e-05
gi|19111873|ref|NP_595081.1| WD repeat protein; possibly involve... 52 2e-05
gi|10764839|gb|AAG22830.1| unknown [Ochlerotatus triseriatus] 52 2e-05
gi|39585715|emb|CAE59917.1| Hypothetical protein CBG03402 [Caeno... 52 2e-05
gi|45199152|ref|NP_986181.1| AFR634Wp [Eremothecium gossypii] >g... 52 2e-05
gi|48846051|ref|ZP_00300319.1| COG2319: FOG: WD40 repeat [Geobac... 52 2e-05
gi|31202483|ref|XP_310190.1| ENSANGP00000010898 [Anopheles gambi... 52 2e-05
gi|6681847|ref|NP_011741.2| Required for sporulation, highly ind... 52 2e-05
gi|14486175|gb|AAK61800.1| Ama1p [Saccharomyces cerevisiae] 52 2e-05
gi|45433584|ref|NP_991399.1| hypothetical protein MGC76037 [Xeno... 52 2e-05
gi|14132774|gb|AAK52334.1| LIS1 [Xenopus laevis] 52 2e-05
gi|16306637|gb|AAH01494.1| U5 snRNP-specific 40 kDa protein (hPr... 52 2e-05
gi|4559414|gb|AAD23059.1| LIS [Mus musculus] 51 3e-05
gi|34395322|dbj|BAC84349.1| putative WD-40 repeat protein family... 51 3e-05
gi|19922278|ref|NP_610996.1| CG12797-PA [Drosophila melanogaster... 51 3e-05
gi|47225915|emb|CAF98395.1| unnamed protein product [Tetraodon n... 51 3e-05
gi|23126356|ref|ZP_00108255.1| COG2319: FOG: WD40 repeat [Nostoc... 51 3e-05
gi|17568701|ref|NP_510394.1| WD repeat domain 5B (43.1 kD) (XO96... 51 3e-05
gi|33146605|dbj|BAC79801.1| putative TATA box binding protein-as... 51 3e-05
gi|37521199|ref|NP_924576.1| WD-40 repeat protein [Gloeobacter v... 51 3e-05
gi|34868449|ref|XP_233022.2| similar to U4/U6 small nuclear ribo... 51 3e-05
gi|2104937|gb|AAC63098.1| truncated form platelet-activating fac... 51 3e-05
gi|24663767|ref|NP_648640.1| CG10191-PA [Drosophila melanogaster... 51 3e-05
gi|31242369|ref|XP_321615.1| ENSANGP00000011640 [Anopheles gambi... 51 3e-05
gi|7305363|ref|NP_038653.1| platelet-activating factor acetylhyd... 51 3e-05
gi|17056921|gb|AAL34972.1| Miller-Dieker lissencephaly protein [... 51 3e-05
gi|4557741|ref|NP_000421.1| platelet-activating factor acetylhyd... 51 3e-05
gi|480009|pir||S36113 LIS-1 protein - human 51 3e-05
gi|34851653|ref|XP_214663.2| similar to cirhin; testis expressed... 51 3e-05
gi|45187738|ref|NP_983961.1| ADL135Cp [Eremothecium gossypii] >g... 51 3e-05
gi|22972904|ref|ZP_00019756.1| hypothetical protein [Chloroflexu... 51 3e-05
gi|32411159|ref|XP_326060.1| hypothetical protein [Neurospora cr... 51 4e-05
gi|2494901|sp|P78706|RCO1_NEUCR Transcriptional repressor rco-1 ... 51 4e-05
gi|22330602|ref|NP_177513.2| transducin family protein / WD-40 r... 51 4e-05
gi|50258634|gb|EAL21321.1| hypothetical protein CNBD3750 [Crypto... 51 4e-05
gi|226483|prf||1515205A PRP4 gene 51 4e-05
gi|3023856|sp|Q27434|GBLP_LEICH Guanine nucleotide-binding prote... 51 4e-05
gi|2662479|gb|AAB88301.1| LACK [Leishmania braziliensis] >gnl|BL... 51 4e-05
gi|48096118|ref|XP_392399.1| similar to CG8440-PA [Apis mellifera] 51 4e-05
gi|27732211|ref|XP_215837.1| WD40 protein Ciao1 [Rattus norvegicus] 51 4e-05
gi|19075402|ref|NP_587902.1| tfiid subunit taf72p. [Schizosaccha... 51 4e-05
gi|50293299|ref|XP_449061.1| unnamed protein product [Candida gl... 51 4e-05
gi|25406289|pir||D96764 unknown protein F25P22.14 [imported] - A... 51 4e-05
gi|41152231|ref|NP_958503.1| platelet-activating factor acetylhy... 51 4e-05
gi|4757988|ref|NP_004795.1| WD40 protein Ciao1 [Homo sapiens] >g... 51 4e-05
gi|46433921|gb|EAK93346.1| hypothetical protein CaO19.10961 [Can... 51 4e-05
gi|24655061|ref|NP_611338.1| CG30116-PB [Drosophila melanogaster... 50 5e-05
gi|45508332|ref|ZP_00160671.1| COG2319: FOG: WD40 repeat [Anabae... 50 5e-05
gi|31203399|ref|XP_310648.1| ENSANGP00000020796 [Anopheles gambi... 50 5e-05
gi|11037744|gb|AAG27720.1| guanine nucleotide-binding protein be... 50 5e-05
gi|2654167|gb|AAB87695.1| activated protein kinase C receptor ho... 50 5e-05
gi|13625467|gb|AAK35068.1| LACK protective antigen [Leishmania d... 50 5e-05
gi|24655069|ref|NP_725798.1| CG30116-PD [Drosophila melanogaster... 50 5e-05
gi|49076806|ref|XP_402338.1| hypothetical protein UM04723.1 [Ust... 50 5e-05
gi|7492063|pir||T41075 hypothetical WD-repeat protein SPCC16A11.... 50 5e-05
gi|47523580|ref|NP_999415.1| platelet-activating factor acetylhy... 50 5e-05
gi|24655073|ref|NP_725799.1| CG30116-PA [Drosophila melanogaster... 50 5e-05
gi|45383504|ref|NP_989655.1| platelet-activating factor acetylhy... 50 5e-05
gi|50746511|ref|XP_420529.1| PREDICTED: similar to WD repeat dom... 50 5e-05
gi|50294333|ref|XP_449578.1| unnamed protein product [Candida gl... 50 5e-05
gi|46433889|gb|EAK93315.1| hypothetical protein CaO19.3457 [Cand... 50 5e-05
gi|32822805|gb|AAH54992.1| MGC64565 protein [Xenopus laevis] 50 5e-05
gi|12324597|gb|AAG52258.1| putative coatomer protein complex, su... 50 5e-05
gi|30699476|ref|NP_178116.2| coatomer protein complex, subunit b... 50 5e-05
gi|5901816|gb|AAD55416.1| BcDNA.GH04922 [Drosophila melanogaster] 50 5e-05
gi|27529968|dbj|BAB85574.2| KIAA1988 protein [Homo sapiens] 50 7e-05
gi|15233721|ref|NP_194712.1| transducin family protein / WD-40 r... 50 7e-05
gi|22298032|ref|NP_681279.1| WD-40 repeat protein [Thermosynecho... 50 7e-05
gi|47227921|emb|CAF97550.1| unnamed protein product [Tetraodon n... 50 7e-05
gi|349828|gb|AAA02882.1| Miller-Dieker lissencephaly protein 50 7e-05
gi|6624971|emb|CAB61534.1| transducin beta like 1 [Mus musculus] 50 7e-05
gi|14042083|dbj|BAB55100.1| unnamed protein product [Homo sapiens] 50 7e-05
gi|20832158|ref|XP_131444.1| PRP4 pre-mRNA processing factor 4 h... 50 7e-05
gi|47228269|emb|CAG07664.1| unnamed protein product [Tetraodon n... 50 7e-05
gi|30185730|gb|AAH51639.1| Prpf4 protein [Mus musculus] 50 7e-05
gi|47212444|emb|CAG11397.1| unnamed protein product [Tetraodon n... 50 7e-05
gi|23574762|dbj|BAC20600.1| platelet activating factor acetylhyd... 50 7e-05
gi|50556994|ref|XP_505905.1| hypothetical protein [Yarrowia lipo... 50 7e-05
gi|41016916|sp|Q969X6|CIRH_HUMAN Cirhin >gnl|BL_ORD_ID|1491098 g... 50 7e-05
gi|22760475|dbj|BAC11214.1| unnamed protein product [Homo sapiens] 50 7e-05
gi|14249536|ref|NP_116219.1| cirhin; testis expressed gene 292 [... 50 7e-05
gi|47211691|emb|CAF91816.1| unnamed protein product [Tetraodon n... 50 7e-05
gi|48854768|ref|ZP_00308929.1| COG2319: FOG: WD40 repeat [Cytoph... 50 7e-05
gi|449693|prf||1919424A Miller-Dieker lissencephaly gene 50 7e-05
gi|12652829|gb|AAH00167.1| Unknown (protein for IMAGE:2900671) [... 50 7e-05
gi|13174235|gb|AAK14409.1| putative angio-associated migratory c... 50 7e-05
gi|19075884|ref|NP_588384.1| notchless-like; WD repeat protein [... 50 9e-05
gi|26354947|dbj|BAC41100.1| unnamed protein product [Mus musculus] 50 9e-05
gi|19113785|ref|NP_592873.1| WD repeat protein; related to tup1 ... 50 9e-05
gi|41152229|ref|NP_958502.1| platelet-activating factor acetylhy... 50 9e-05
gi|49079348|ref|XP_403329.1| hypothetical protein UM05714.1 [Ust... 50 9e-05
gi|41054393|ref|NP_955998.1| Unknown (protein for MGC:55320); wu... 50 9e-05
gi|37681853|gb|AAQ97804.1| unknown [Danio rerio] 50 9e-05
gi|2853277|gb|AAC02261.1| WD splicing factor Hprp4p [Homo sapiens] 49 1e-04
gi|23127725|ref|ZP_00109588.1| COG2319: FOG: WD40 repeat [Nostoc... 49 1e-04
gi|50757510|ref|XP_415544.1| PREDICTED: similar to U4/U6 small n... 49 1e-04
gi|15218215|ref|NP_175645.1| coatomer protein complex, subunit b... 49 1e-04
gi|17541222|ref|NP_501859.1| guanine nucleotide-binding protein ... 49 1e-04
gi|13938549|gb|AAH07424.1| PRP4 pre-mRNA processing factor 4 hom... 49 1e-04
gi|48146327|emb|CAG33386.1| PRPF4 [Homo sapiens] 49 1e-04
gi|23126059|ref|ZP_00107968.1| COG2319: FOG: WD40 repeat [Nostoc... 49 1e-04
gi|37785807|gb|AAO25585.1| G-protein beta subunit Cgb1 [Cochliob... 49 1e-04
gi|24431950|ref|NP_004688.2| PRP4 pre-mRNA processing factor 4 h... 49 1e-04
gi|2708305|gb|AAC51925.1| U4/U6 small nuclear ribonucleoprotein ... 49 1e-04
gi|31216935|ref|XP_316328.1| ENSANGP00000020634 [Anopheles gambi... 49 1e-04
gi|24651075|ref|NP_651702.1| CG7568-PA [Drosophila melanogaster]... 49 1e-04
gi|27924436|gb|AAH45034.1| Prp8bp-pending-prov protein [Xenopus ... 49 1e-04
gi|47216142|emb|CAG10016.1| unnamed protein product [Tetraodon n... 49 1e-04
gi|50759611|ref|XP_417704.1| PREDICTED: similar to Prp8bp-pendin... 49 1e-04
gi|15229130|ref|NP_189852.1| transducin family protein / WD-40 r... 49 1e-04
gi|50428732|gb|AAT77083.1| putative WD G-beta repeat protein [Or... 49 1e-04
gi|45184815|ref|NP_982533.1| AAL009Cp [Eremothecium gossypii] >g... 49 2e-04
gi|23613131|ref|NP_703453.1| WD-repeat potein, putative [Plasmod... 49 2e-04
gi|2462071|emb|CAA05000.1| guanine nucleotide-binding protein be... 49 2e-04
gi|50415592|gb|AAH77590.1| Unknown (protein for MGC:83946) [Xeno... 49 2e-04
gi|38258921|sp|P46800|GBLP_DICDI Guanine nucleotide-binding prot... 49 2e-04
gi|17535491|ref|NP_496985.1| trp-asp repeats containing protein ... 49 2e-04
gi|50255950|gb|EAL18679.1| hypothetical protein CNBI2670 [Crypto... 49 2e-04
gi|39582675|emb|CAE73779.1| Hypothetical protein CBG21324 [Caeno... 49 2e-04
gi|46441352|gb|EAL00650.1| hypothetical protein CaO19.2084 [Cand... 49 2e-04
gi|17552164|ref|NP_497749.1| WD repeat domain 5B (3E795) [Caenor... 49 2e-04
gi|23124911|ref|ZP_00106869.1| COG2319: FOG: WD40 repeat [Nostoc... 49 2e-04
gi|13277350|ref|NP_075680.1| meiotic recombination protein REC14... 49 2e-04
gi|11992988|gb|AAA56865.2| guanine nucleotide regulatory protein... 49 2e-04
gi|19114682|ref|NP_593770.1| guanine nucleotide-binding protein ... 49 2e-04
gi|26345856|dbj|BAC36579.1| unnamed protein product [Mus musculus] 49 2e-04
>gi|17507091|ref|NP_492416.1| repeat protein (1J547) [Caenorhabditis
elegans]
gi|15718169|emb|CAB04240.2| Hypothetical protein F32H2.4
[Caenorhabditis elegans]
Length = 298
Score = 574 bits (1480), Expect = e-163
Identities = 281/298 (94%), Positives = 281/298 (94%)
Frame = +1
Query: 1 MKVQQCQSIAFNCDGTKLVCGAFDKKVSVANVDGGRLRFXXXXXXXXXXXXXXXXXEKQP 180
MKVQQCQSIAFNCDGTKLVCGAFDKKVSVANVDGGRLRF EKQP
Sbjct: 1 MKVQQCQSIAFNCDGTKLVCGAFDKKVSVANVDGGRLRFSWVGSSHSSSVEQVACSEKQP 60
Query: 181 NLFASASADRNICVWDIRQSKPTHRISNRVGNFFISWSPCDEYFIFLDKDNRINTVDIRN 360
NLFASASADRNICVWDIRQSKPTHRISNRVGNFFISWSPCDEYFIFLDKDNRINTVDIRN
Sbjct: 61 NLFASASADRNICVWDIRQSKPTHRISNRVGNFFISWSPCDEYFIFLDKDNRINTVDIRN 120
Query: 361 YQVVNSYEMKTFSHELTFHPLSNHVFVAESGGKVEILKFAGGALEPVTSIQAHSHQVECL 540
YQVVNSYEMKTFSHELTFHPLSNHVFVAESGGKVEILKFAGGALEPVTSIQAHSHQVECL
Sbjct: 121 YQVVNSYEMKTFSHELTFHPLSNHVFVAESGGKVEILKFAGGALEPVTSIQAHSHQVECL 180
Query: 541 AVSISKDGRKLAVGASDASCSLWDLEELICERVIPRHDYGIRAVSFSCNGQLLASGSEDH 720
AVSISKDGRKLAVGASDASCSLWDLEELICERVIPRHDYGIRAVSFSCNGQLLASGSEDH
Sbjct: 181 AVSISKDGRKLAVGASDASCSLWDLEELICERVIPRHDYGIRAVSFSCNGQLLASGSEDH 240
Query: 721 SIDIAYVPDGSRCHEIKHTGETYSVAWHPNSLLLAYTASDSMDNREAAHVKTFGHSTV 894
SIDIAYVPDGSRCHEIKHTGETYSVAWHPNSLLLAYTASDSMDNREAAHVKTFGHSTV
Sbjct: 241 SIDIAYVPDGSRCHEIKHTGETYSVAWHPNSLLLAYTASDSMDNREAAHVKTFGHSTV 298
>gi|7500364|pir||T21672 hypothetical protein F32H2.4 - Caenorhabditis
elegans
Length = 469
Score = 574 bits (1480), Expect = e-163
Identities = 281/298 (94%), Positives = 281/298 (94%)
Frame = +1
Query: 1 MKVQQCQSIAFNCDGTKLVCGAFDKKVSVANVDGGRLRFXXXXXXXXXXXXXXXXXEKQP 180
MKVQQCQSIAFNCDGTKLVCGAFDKKVSVANVDGGRLRF EKQP
Sbjct: 172 MKVQQCQSIAFNCDGTKLVCGAFDKKVSVANVDGGRLRFSWVGSSHSSSVEQVACSEKQP 231
Query: 181 NLFASASADRNICVWDIRQSKPTHRISNRVGNFFISWSPCDEYFIFLDKDNRINTVDIRN 360
NLFASASADRNICVWDIRQSKPTHRISNRVGNFFISWSPCDEYFIFLDKDNRINTVDIRN
Sbjct: 232 NLFASASADRNICVWDIRQSKPTHRISNRVGNFFISWSPCDEYFIFLDKDNRINTVDIRN 291
Query: 361 YQVVNSYEMKTFSHELTFHPLSNHVFVAESGGKVEILKFAGGALEPVTSIQAHSHQVECL 540
YQVVNSYEMKTFSHELTFHPLSNHVFVAESGGKVEILKFAGGALEPVTSIQAHSHQVECL
Sbjct: 292 YQVVNSYEMKTFSHELTFHPLSNHVFVAESGGKVEILKFAGGALEPVTSIQAHSHQVECL 351
Query: 541 AVSISKDGRKLAVGASDASCSLWDLEELICERVIPRHDYGIRAVSFSCNGQLLASGSEDH 720
AVSISKDGRKLAVGASDASCSLWDLEELICERVIPRHDYGIRAVSFSCNGQLLASGSEDH
Sbjct: 352 AVSISKDGRKLAVGASDASCSLWDLEELICERVIPRHDYGIRAVSFSCNGQLLASGSEDH 411
Query: 721 SIDIAYVPDGSRCHEIKHTGETYSVAWHPNSLLLAYTASDSMDNREAAHVKTFGHSTV 894
SIDIAYVPDGSRCHEIKHTGETYSVAWHPNSLLLAYTASDSMDNREAAHVKTFGHSTV
Sbjct: 412 SIDIAYVPDGSRCHEIKHTGETYSVAWHPNSLLLAYTASDSMDNREAAHVKTFGHSTV 469