Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F33A8_4
(627 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17533635|ref|NP_496366.1| C.Elegans Y-box (21.3 kD) (cey-1) [... 249 2e-65
gi|39597353|emb|CAE59581.1| Hypothetical protein CBG02981 [Caeno... 230 1e-59
gi|14602477|gb|AAH09744.1| CSDA protein [Homo sapiens] 152 5e-36
gi|140245|sp|P21573|YB1_XENLA Nuclease sensitive element binding... 152 7e-36
gi|27370848|gb|AAH41191.1| MGC52597 protein [Xenopus laevis] 152 7e-36
gi|25742629|ref|NP_114185.1| muscle Y-box protein YB2 [Rattus no... 151 9e-36
gi|20806532|ref|NP_035863.1| cold shock domain protein A short i... 151 1e-35
gi|181484|gb|AAA35749.1| DNA-binding protein A 151 1e-35
gi|16198465|gb|AAH15913.1| CSDA protein [Homo sapiens] 151 1e-35
gi|2135011|pir||I53354 DNA-binding protein A - human >gnl|BL_ORD... 151 1e-35
gi|47059495|ref|NP_620817.2| cold shock domain protein A long is... 151 1e-35
gi|10185723|gb|AAG14418.1| Y-box protein 3 long isoform [Mus mus... 151 1e-35
gi|7385223|gb|AAF61741.1| RNA binding protein MSY4 [Mus musculus] 151 1e-35
gi|1160331|dbj|BAA03376.1| dbpA murine homologue [Mus musculus] 151 1e-35
gi|2135012|pir||S69501 DNA-binding protein A variant - human >gn... 151 1e-35
gi|20070160|ref|NP_003642.2| cold shock domain protein A; Cold-s... 151 1e-35
gi|18859137|ref|NP_571695.1| nuclease sensitive element binding ... 150 1e-35
gi|29477111|gb|AAH50156.1| Nuclease sensitive element binding pr... 150 1e-35
gi|2073109|dbj|BAA19849.1| Y box protein 1 [Carassius auratus] 150 1e-35
gi|33875177|gb|AAH00064.1| NSEP1 protein [Homo sapiens] >gnl|BL_... 150 2e-35
gi|189299|gb|AAA59949.1| DNA-binding protein 150 2e-35
gi|465508|sp|Q06066|YB1_CHICK Nuclease sensitive element binding... 150 2e-35
gi|6756033|ref|NP_035862.1| nuclease sensitive element binding p... 150 2e-35
gi|423015|pir||S34426 nuclease sensitive element-binding protein... 150 2e-35
gi|112410|pir||A23677 Y box-binding protein 1 - rat >gnl|BL_ORD_... 150 2e-35
gi|115848|sp|P27817|YB1_MOUSE Nuclease sensitive element binding... 150 2e-35
gi|2137863|pir||I58195 Y box-binding protein 1 - mouse >gnl|BL_O... 150 2e-35
gi|988281|gb|AAA75475.1| mYB-1a 150 2e-35
gi|9653686|gb|AAB46889.2| TSH receptor suppressor element-bindin... 150 2e-35
gi|988283|gb|AAA75476.1| mYB-1b 150 2e-35
gi|457262|gb|AAA36569.1| nuclease sensitive element binding prot... 150 2e-35
gi|31543347|ref|NP_113751.2| nuclease sensitive element binding ... 150 2e-35
gi|1353778|gb|AAB01787.1| Y-Box binding protein 150 2e-35
gi|29437175|gb|AAH49977.1| Nsep1 protein [Mus musculus] 150 2e-35
gi|27807361|ref|NP_777240.1| nuclease sensitive element binding ... 150 2e-35
gi|1363073|pir||A55971 Y box-binding protein 1 - rabbit >gnl|BL_... 150 2e-35
gi|45383329|ref|NP_989745.1| nuclease sensitive element binding ... 150 2e-35
gi|181486|gb|AAA35750.1| DNA-binding protein B 150 2e-35
gi|2745892|gb|AAB94768.1| Y box transcription factor [Mus musculus] 150 2e-35
gi|340419|gb|AAA61308.1| Y box binding protein-1 149 3e-35
gi|8100510|gb|AAF72335.1| Y-box protein ZONAB-A [Canis familiaris] 149 4e-35
gi|27503841|gb|AAH42217.1| Nsep1-prov protein [Xenopus laevis] 149 4e-35
gi|34870882|ref|XP_342899.1| similar to Y box transcription fact... 149 4e-35
gi|532211|gb|AAC34193.1| Y-box binding protein [Mus musculus] 149 4e-35
gi|8100512|gb|AAF72336.1| Y-box protein ZONAB-B [Canis familiaris] 149 4e-35
gi|47220428|emb|CAG03208.1| unnamed protein product [Tetraodon n... 148 1e-34
gi|27348122|dbj|BAC45236.1| Y-box binding protein [Oryzias latipes] 148 1e-34
gi|47123238|gb|AAH70000.1| Unknown (protein for MGC:85599) [Dani... 147 1e-34
gi|1175568|sp|P41824|YBFH_APLCA Y-box factor homolog (APY1) >gnl... 147 1e-34
gi|38142418|dbj|BAC99313.2| brain Y-box binding protein 1 [Rattu... 147 2e-34
gi|14270385|emb|CAC39432.1| cold-shock domain protein [Takifugu ... 147 2e-34
gi|50791016|ref|XP_423576.1| PREDICTED: similar to muscle Y-box ... 146 3e-34
gi|140247|sp|Q00436|YB3_XENLA B BOX BINDING PROTEIN (YB3 PROTEIN... 146 4e-34
gi|2502064|gb|AAB80761.1| Y-box binding protein A [Columba livia] 145 8e-34
gi|45382293|ref|NP_990737.1| Rous sarcoma virus transcription en... 144 1e-33
gi|30089118|emb|CAD27800.1| Y1 protein [Dugesia etrusca] 144 1e-33
gi|7441977|pir||S51608 RYB-a protein - rat >gnl|BL_ORD_ID|106414... 144 1e-33
gi|1083796|pir||S48055 RYB-a protein - rat 144 1e-33
gi|34871368|ref|XP_343896.1| similar to Nuclease sensitive eleme... 144 1e-33
gi|34871657|ref|XP_220618.2| similar to Y-box protein MSY2 [Ratt... 144 1e-33
gi|26344984|dbj|BAC36141.1| unnamed protein product [Mus musculus] 143 2e-33
gi|7705751|ref|NP_057066.1| germ cell specific Y-box binding pro... 142 4e-33
gi|21707292|gb|AAH33800.1| Germ cell specific Y-box binding prot... 142 4e-33
gi|8393791|ref|NP_058571.1| Y box protein 2; Y-box protein MSY2 ... 142 5e-33
gi|1175535|sp|P21574|YB56_XENLA Cytoplasmic RNA-binding protein ... 141 1e-32
gi|104266|pir||B38274 Y box-binding protein 2 - African clawed f... 141 1e-32
gi|22901742|gb|AAN10050.1| Y-box protein Ct-p50 [Chironomus tent... 139 4e-32
gi|22901740|gb|AAN10049.1| Y-box protein Ct-p40 [Chironomus tent... 139 4e-32
gi|2073111|dbj|BAA19850.1| Y box protein 2 [Carassius auratus] 136 4e-31
gi|24663131|ref|NP_524033.2| CG5654-PA [Drosophila melanogaster]... 134 1e-30
gi|38081844|ref|XP_128452.3| similar to TSH receptor suppressor ... 134 2e-30
gi|1175534|sp|P45441|YB54_XENLA Cytoplasmic RNA-binding protein ... 134 2e-30
gi|12862280|dbj|BAB32397.1| unnamed protein product [Mus musculus] 133 3e-30
gi|47214045|emb|CAG00703.1| unnamed protein product [Tetraodon n... 132 4e-30
gi|4071323|gb|AAC98674.1| Y-box protein MSY2 isoform a [Mus musc... 132 4e-30
gi|49532669|dbj|BAD26606.1| Y-box protein [Bombyx mori] 132 7e-30
gi|48134295|ref|XP_393344.1| similar to Y-box protein Ct-p40 [Ap... 132 7e-30
gi|2970679|gb|AAC06034.1| Y box protein [Drosophila silvestris] 131 1e-29
gi|14270383|emb|CAC39436.1| cold-shock domain protein [Oryzias l... 130 2e-29
gi|2739396|gb|AAB94634.1| Y-box protein [Drosophila melanogaster] 130 3e-29
gi|5441543|emb|CAB46826.1| DNA binding protein [Canis familiaris] 126 3e-28
gi|1477478|gb|AAC47760.1| Y-box binding protein [Schistosoma man... 125 7e-28
gi|20150005|pdb|1H95|A Chain A, Solution Structure Of The Single... 125 9e-28
gi|14039811|gb|AAK53394.1| Y-box binding protein [Schistosoma ja... 122 4e-27
gi|1362721|pir||A49594 enhancer factor protein 1 - chicken (frag... 122 7e-27
gi|31216118|ref|XP_316169.1| ENSANGP00000020458 [Anopheles gambi... 120 2e-26
gi|1483311|emb|CAA68079.1| Y-box protein [Dugesia japonica] 107 1e-22
gi|39582486|emb|CAE66577.1| Hypothetical protein CBG11894 [Caeno... 106 4e-22
gi|39580797|emb|CAE58966.1| Hypothetical protein CBG02238 [Caeno... 105 5e-22
gi|17555742|ref|NP_499393.1| C.Elegans Y-box (32.4 kD) (cey-4) [... 105 7e-22
gi|39598221|emb|CAE68913.1| Hypothetical protein CBG14892 [Caeno... 104 1e-21
gi|34866233|ref|XP_232603.2| similar to nuclease sensitive eleme... 102 6e-21
gi|17507385|ref|NP_491645.1| C.Elegans Y-box (29.4 kD) (cey-2) [... 101 1e-20
gi|162985|gb|AAA21677.1| transcription factor EF1(A) 98 1e-19
gi|17508335|ref|NP_491631.1| C.Elegans Y-box (29.2 kD) (cey-3) [... 97 2e-19
gi|39591813|emb|CAE71391.1| Hypothetical protein CBG18298 [Caeno... 96 7e-19
gi|34851491|ref|XP_344731.1| similar to Y box protein 1 [Rattus ... 95 1e-18
gi|38091806|ref|XP_354641.1| similar to nuclease sensitive eleme... 91 2e-17
gi|21322752|dbj|BAB78536.2| cold shock protein-1 [Triticum aesti... 78 2e-13
gi|42391858|dbj|BAD08701.1| cold shock domain protein 3 [Triticu... 77 4e-13
gi|40363759|dbj|BAD06324.1| putative glycine-rich protein [Triti... 73 4e-12
gi|121631|sp|P27484|GRP2_NICSY Glycine-rich protein 2 >gnl|BL_OR... 72 7e-12
gi|15226451|ref|NP_179702.1| cold-shock DNA-binding family prote... 72 9e-12
gi|24658520|ref|NP_647983.1| CG17334-PA [Drosophila melanogaster... 69 6e-11
gi|41052630|dbj|BAD08139.1| putative Glycine-rich protein 2 [Ory... 69 6e-11
gi|31248028|ref|XP_316618.1| ENSANGP00000011455 [Anopheles gambi... 68 2e-10
gi|15234010|ref|NP_195580.1| cold-shock DNA-binding family prote... 67 3e-10
gi|46363945|ref|ZP_00226622.1| COG1278: Cold shock proteins [Kin... 66 5e-10
gi|46228824|gb|EAK89694.1| cold shock RNA binding domain of the ... 66 5e-10
gi|29467522|dbj|BAC66711.1| putative cold shock protein-1 [Oryza... 66 5e-10
gi|15617086|ref|NP_240299.1| cold shock-like protein cspE [Buchn... 65 8e-10
gi|27904911|ref|NP_778037.1| cold shock protein CspA [Buchnera a... 65 8e-10
gi|6225210|sp|O30875|CSPA_MICLU Major cold-shock protein >gnl|BL... 65 8e-10
gi|41147280|ref|XP_371842.1| hypothetical protein XP_376524 [Hom... 65 8e-10
gi|47077279|dbj|BAD18558.1| unnamed protein product [Homo sapiens] 65 8e-10
gi|16759589|ref|NP_455206.1| cold shock-like protein cspE [Salmo... 65 1e-09
gi|32490926|ref|NP_871180.1| cspE [Wigglesworthia glossinidia en... 65 1e-09
gi|16765332|ref|NP_460947.1| putative cold-shock protein [Salmon... 65 1e-09
gi|22125069|ref|NP_668492.1| cold shock protein [Yersinia pestis... 65 1e-09
gi|16122808|ref|NP_406121.1| putative cold shock protein [Yersin... 65 1e-09
gi|50120233|ref|YP_049400.1| cold shock-like protein [Erwinia ca... 65 1e-09
gi|1778540|gb|AAB40823.1| cold shock-like protein [Escherichia c... 64 2e-09
gi|26246604|ref|NP_752643.1| Cold shock-like protein cspE [Esche... 64 2e-09
gi|47214418|emb|CAG00259.1| unnamed protein product [Tetraodon n... 64 2e-09
gi|24112787|ref|NP_707297.1| cold shock protein [Shigella flexne... 64 2e-09
gi|41690441|ref|ZP_00146973.1| COG1278: Cold shock proteins [Psy... 64 3e-09
gi|39995317|ref|NP_951268.1| cold-shock domain family protein [G... 64 3e-09
gi|25026862|ref|NP_736916.1| putative cold shock protein [Coryne... 64 3e-09
gi|15800910|ref|NP_286926.1| homolog of Salmonella cold shock pr... 63 4e-09
gi|15830399|ref|NP_309172.1| cold shock-like protein; CspG [Esch... 63 4e-09
gi|16760938|ref|NP_456555.1| cold shock protein [Salmonella ente... 63 4e-09
gi|24112076|ref|NP_706586.1| cold shock-like protein [Shigella f... 63 4e-09
gi|15800338|ref|NP_286350.1| cold shock protein [Escherichia col... 63 4e-09
gi|41055233|ref|NP_957385.1| similar to RNA-binding protein LIN-... 63 4e-09
gi|21842301|gb|AAM77750.1| RNA-binding protein LIN-28A [Xenopus ... 63 4e-09
gi|37526673|ref|NP_930017.1| cold shock protein [Photorhabdus lu... 63 5e-09
gi|50121319|ref|YP_050486.1| cold shock protein [Erwinia carotov... 63 5e-09
gi|16122003|ref|NP_405316.1| cold shock protein [Yersinia pestis... 63 5e-09
gi|15923806|ref|NP_371340.1| cold-shock protein C [Staphylococcu... 62 7e-09
gi|39997003|ref|NP_952954.1| cold shock domain family protein [G... 62 7e-09
gi|15616172|ref|NP_244477.1| cold-shock protein [Bacillus halodu... 62 7e-09
gi|27366046|ref|NP_761574.1| Cold shock protein [Vibrio vulnific... 62 7e-09
gi|46104075|ref|ZP_00198859.1| COG1278: Cold shock proteins [Kin... 62 7e-09
gi|19551558|ref|NP_599560.1| cold shock protein [Corynebacterium... 62 7e-09
gi|15802236|ref|NP_288259.1| cold shock protein [Escherichia col... 62 7e-09
gi|49236236|ref|ZP_00330297.1| COG1278: Cold shock proteins [Moo... 62 9e-09
gi|37725743|gb|AAO32341.1| cold shock protein 1 [Streptomyces sp... 62 9e-09
gi|16129516|ref|NP_416075.1| cold shock-like protein; Qin propha... 62 9e-09
gi|26249026|ref|NP_755066.1| Cold shock-like protein cspB [Esche... 62 9e-09
gi|21222890|ref|NP_628669.1| cold shock protein [Streptomyces co... 62 9e-09
gi|33519902|ref|NP_878734.1| cold shock-like protein CspC [Candi... 62 9e-09
gi|48833769|ref|ZP_00290786.1| COG1278: Cold shock proteins [Mag... 62 1e-08
gi|27467496|ref|NP_764133.1| cold-shock protein C [Staphylococcu... 62 1e-08
gi|42784343|ref|NP_981590.1| cold shock protein CspC [Bacillus c... 62 1e-08
gi|48732705|ref|ZP_00266448.1| COG1278: Cold shock proteins [Pse... 62 1e-08
gi|29831363|ref|NP_825997.1| putative cold shock protein [Strept... 62 1e-08
gi|30527347|gb|AAN77901.2| putative nucleic acid binding protein... 62 1e-08
gi|30249291|ref|NP_841361.1| Cold-shock DNA-binding domain [Nitr... 61 2e-08
gi|27366937|ref|NP_762464.1| Cold shock protein [Vibrio vulnific... 61 2e-08
gi|34498661|ref|NP_902876.1| cold shock transcription regulator ... 61 2e-08
gi|41406767|ref|NP_959603.1| CspA_2 [Mycobacterium avium subsp. ... 61 2e-08
gi|34853250|ref|XP_345125.1| similar to lin-28 homolog; RNA-bind... 61 2e-08
gi|25029285|ref|NP_739339.1| conserved hypothetical protein [Cor... 61 2e-08
gi|39995688|ref|NP_951639.1| cold-shock domain family protein [G... 61 2e-08
gi|30062528|ref|NP_836699.1| putative cold shock protein [Shigel... 61 2e-08
gi|349561|gb|AAB66357.1| DNA-binding protein 61 2e-08
gi|15606511|ref|NP_213891.1| cold shock protein [Aquifex aeolicu... 61 2e-08
gi|38090872|ref|XP_354572.1| similar to lin-28 homolog; RNA-bind... 61 2e-08
gi|27503403|gb|AAH42225.1| LOC373796 protein [Xenopus laevis] 61 2e-08
gi|50744644|ref|XP_419813.1| PREDICTED: hypothetical protein XP_... 60 3e-08
gi|38232941|ref|NP_938708.1| cold-shock protein [Corynebacterium... 60 3e-08
gi|16801058|ref|NP_471326.1| similar to cold shock protein [List... 60 3e-08
gi|30265215|ref|NP_847592.1| cold shock protein CspC [Bacillus a... 60 3e-08
gi|45532867|ref|ZP_00183865.1| COG1278: Cold shock proteins [Exi... 60 3e-08
gi|21397653|ref|NP_653638.1| cold, Cold Shock RNA binding domain... 60 3e-08
gi|16077579|ref|NP_388393.1| cold-shock protein [Bacillus subtil... 60 3e-08
gi|37527652|ref|NP_930996.1| cold shock-like protein (CPS-I) [Ph... 60 3e-08
gi|21230743|ref|NP_636660.1| cold shock protein [Xanthomonas cam... 60 3e-08
gi|48857489|ref|ZP_00311489.1| COG1278: Cold shock proteins [Clo... 60 3e-08
gi|15233440|ref|NP_195326.1| cold-shock DNA-binding family prote... 60 3e-08
gi|39995301|ref|NP_951252.1| cold-shock domain family protein [G... 60 4e-08
gi|37725747|gb|AAO32342.1| cold shock protein 2 [Streptomyces sp... 60 4e-08
gi|15596356|ref|NP_249850.1| probable cold-shock protein [Pseudo... 60 4e-08
gi|2970685|gb|AAC06037.1| cold shock protein C [Salmonella typhi... 60 4e-08
gi|1706172|sp|P54584|CSP_ARTGO COLD SHOCK PROTEIN >gnl|BL_ORD_ID... 60 4e-08
gi|45532385|ref|ZP_00183393.1| COG1278: Cold shock proteins [Exi... 60 4e-08
gi|37525773|ref|NP_929117.1| hypothetical protein [Photorhabdus ... 60 4e-08
gi|27550093|gb|AAO18076.1| unknown [Photorhabdus luminescens] 60 4e-08
gi|23105112|ref|ZP_00091570.1| COG1278: Cold shock proteins [Azo... 60 4e-08
gi|33593717|ref|NP_881361.1| putative cold-shock protein [Bordet... 60 4e-08
gi|23099198|ref|NP_692664.1| cold shock protein [Oceanobacillus ... 60 4e-08
gi|23004357|ref|ZP_00047730.1| COG1278: Cold shock proteins [Mag... 60 4e-08
gi|45522295|ref|ZP_00173810.1| COG1278: Cold shock proteins [Met... 60 4e-08
gi|15896242|ref|NP_349591.1| Cold shock protein [Clostridium ace... 60 4e-08
gi|49082348|gb|AAT50574.1| PA1159 [synthetic construct] 60 4e-08
gi|3891780|pdb|3MEF|A Chain A, Major Cold-Shock Protein From Esc... 59 6e-08
gi|15675836|ref|NP_270010.1| putative cold shock protein [Strept... 59 6e-08
gi|16800469|ref|NP_470737.1| similar to cold shock protein [List... 59 6e-08
gi|46365711|ref|ZP_00228151.1| COG1278: Cold shock proteins [Kin... 59 6e-08
gi|15804102|ref|NP_290141.1| cold shock protein 7.4, transcripti... 59 6e-08
gi|1001878|emb|CAA62903.1| CspA protein [Listeria monocytogenes] 59 6e-08
gi|16121922|ref|NP_405235.1| cold shock protein [Yersinia pestis... 59 6e-08
gi|576191|pdb|1MJC| Major Cold Shock Protein 7.4 (Cspa (Cs 7.4)... 59 6e-08
gi|46913580|emb|CAG20366.1| Putative cold shock-like protein csp... 59 6e-08
gi|37525256|ref|NP_928600.1| cold shock-like protein [Photorhabd... 59 6e-08
gi|28896678|ref|NP_803028.1| putative cold shock protein [Strept... 59 6e-08
gi|26987721|ref|NP_743146.1| cold-shock domain family protein [P... 59 6e-08
gi|46913581|emb|CAG20367.1| putative Cold shock-like protein [Ph... 59 8e-08
gi|48784919|ref|ZP_00281224.1| COG1278: Cold shock proteins [Bur... 59 8e-08
gi|15616931|ref|NP_240144.1| cold shock-like protein CspC [Buchn... 59 8e-08
gi|48845997|ref|ZP_00300265.1| COG1278: Cold shock proteins [Geo... 59 8e-08
gi|16129511|ref|NP_416070.1| cold shock-like protein; Qin propha... 59 8e-08
gi|29376277|ref|NP_815431.1| cold-shock domain family protein [E... 59 8e-08
gi|26249019|ref|NP_755059.1| Cold shock-like protein cspI [Esche... 59 8e-08
gi|28901144|ref|NP_800799.1| cold shock transcriptional regulato... 59 8e-08
gi|29827367|ref|NP_822001.1| putative cold shock protein [Strept... 59 1e-07
gi|16974803|pdb|1HZA|A Chain A, Bacillus Caldolyticus Cold-Shock... 59 1e-07
gi|4193398|gb|AAD10037.1| CspE [Myxococcus xanthus] 59 1e-07
gi|45532868|ref|ZP_00183866.1| COG1278: Cold shock proteins [Exi... 59 1e-07
gi|15600936|ref|NP_232566.1| cold shock transcriptional regulato... 59 1e-07
gi|1778828|gb|AAB40924.1| major cold shock protein CSPA2 [Yersin... 58 1e-07
gi|22957798|ref|ZP_00005487.1| COG1278: Cold shock proteins [Rho... 58 1e-07
gi|23023854|ref|ZP_00063083.1| COG1278: Cold shock proteins [Leu... 58 1e-07
gi|50084936|ref|YP_046446.1| cold shock-like protein [Acinetobac... 58 2e-07
gi|1169112|sp|P42016|CSPB_BACST COLD SHOCK PROTEIN CSPB (MAJOR C... 58 2e-07
gi|22256741|sp|Q9S170|CSPG_SHEVI Cold shock-like protein cspG >g... 58 2e-07
gi|15644617|ref|NP_229670.1| cold shock protein [Thermotoga mari... 58 2e-07
gi|23098034|ref|NP_691500.1| cold shock protein [Oceanobacillus ... 58 2e-07
gi|48835679|ref|ZP_00292678.1| COG1278: Cold shock proteins [The... 58 2e-07
gi|22957054|ref|ZP_00004775.1| COG1278: Cold shock proteins [Rho... 58 2e-07
gi|21402908|ref|NP_658893.1| cold, Cold Shock RNA binding domain... 57 2e-07
gi|46131674|ref|ZP_00170040.2| COG1278: Cold shock proteins [Ral... 57 2e-07
gi|15595653|ref|NP_249147.1| probable cold-shock protein [Pseudo... 57 2e-07
gi|49082304|gb|AAT50552.1| PA0456 [synthetic construct] 57 2e-07
gi|40644037|emb|CAD92346.1| cold shock protein A [Lactobacillus ... 57 2e-07
gi|26990715|ref|NP_746140.1| cold-shock protein CspD [Pseudomona... 57 2e-07
gi|13095918|ref|NP_076827.1| Csp [Bacteriophage bIL312] >gnl|BL_... 57 2e-07
gi|48788555|ref|ZP_00284534.1| COG1278: Cold shock proteins [Bur... 57 2e-07
gi|46916875|emb|CAG23638.1| putative cold shock protein [Photoba... 57 2e-07
gi|46913527|emb|CAG20313.1| putative Cold shock-like protein [Ph... 57 2e-07
gi|39595769|emb|CAE67272.1| Hypothetical protein CBG12720 [Caeno... 57 2e-07
gi|50591796|ref|ZP_00333099.1| COG1278: Cold shock proteins [Str... 57 3e-07
gi|48782594|ref|ZP_00279100.1| COG1278: Cold shock proteins [Bur... 57 3e-07
gi|4193396|gb|AAD10036.1| CspD [Myxococcus xanthus] 57 3e-07
gi|33598908|ref|NP_886551.1| putative cold shock-like protein [B... 57 3e-07
gi|2493764|sp|Q45099|CSPD_BACCE Cold shock-like protein cspD >gn... 57 3e-07
gi|28898663|ref|NP_798268.1| cold shock transcriptional regulato... 57 3e-07
gi|46203051|ref|ZP_00052170.2| COG1278: Cold shock proteins [Mag... 57 3e-07
gi|50759608|ref|XP_425765.1| PREDICTED: similar to RNA-binding p... 57 3e-07
gi|2493762|sp|Q45097|CSPB_BACCE COLD SHOCK-LIKE PROTEIN CSPB >gn... 57 4e-07
gi|15924392|ref|NP_371926.1| major cold shock protein [Staphyloc... 57 4e-07
gi|729217|sp|P41016|CSPB_BACCL Cold shock protein cspB >gnl|BL_O... 57 4e-07
gi|16974805|pdb|1HZB|A Chain A, Bacillus Caldolyticus Cold-Shock... 57 4e-07
gi|19551424|ref|NP_599426.1| cold shock protein [Corynebacterium... 57 4e-07
gi|4193390|gb|AAD10033.1| CspA [Myxococcus xanthus] 57 4e-07
gi|15894094|ref|NP_347443.1| Cold shock protein [Clostridium ace... 57 4e-07
gi|4193392|gb|AAD10034.1| CspB [Myxococcus xanthus] 57 4e-07
gi|27468004|ref|NP_764641.1| major cold shock protein CspA [Stap... 57 4e-07
gi|41725001|ref|ZP_00151811.1| COG1278: Cold shock proteins [Dec... 57 4e-07
gi|13375938|ref|NP_078950.1| lin-28 homolog; RNA-binding protein... 57 4e-07
gi|2493774|sp|P72366|CSPA_STIAU COLD SHOCK-LIKE PROTEIN CSPA >gn... 56 5e-07
gi|16974809|pdb|1I5F|A Chain A, Bacillus Caldolyticus Cold-Shock... 56 5e-07
gi|18310224|ref|NP_562158.1| cold shock protein [Clostridium per... 56 5e-07
gi|9587215|gb|AAF89211.1| cold-shock protein CspA [Mycobacterium... 56 5e-07
gi|22256742|sp|Q9S1B7|CSPA_SHEVI Cold shock-like protein cspA >g... 56 5e-07
gi|16079252|ref|NP_390076.1| cold-shock protein [Bacillus subtil... 56 5e-07
gi|20808157|ref|NP_623328.1| Cold shock proteins [Thermoanaeroba... 56 5e-07
gi|48865211|ref|ZP_00319074.1| COG1278: Cold shock proteins [Oen... 56 5e-07
gi|45548311|ref|ZP_00188344.1| COG1278: Cold shock proteins [Rub... 56 5e-07
gi|18398546|ref|NP_565427.1| cold-shock DNA-binding family prote... 56 5e-07
gi|20846744|ref|XP_144090.1| similar to hypothetical protein FLJ... 56 5e-07
gi|27716239|ref|XP_233546.1| similar to lin-28 homolog; RNA-bind... 56 5e-07
gi|46329818|gb|AAH68304.1| RNA-binding protein LIN-28 [Mus muscu... 56 5e-07
gi|1763346|gb|AAC47477.1| LIN-28 [Caenorhabditis remanei] 56 5e-07
gi|7442089|pir||T00837 glycine-rich protein T13L16.11 - Arabidop... 56 5e-07
gi|3850776|emb|CAA76697.1| cold shock protein D [Lactococcus lac... 56 6e-07
gi|15827003|ref|NP_301266.1| putative cold shock protein [Mycoba... 56 6e-07
gi|50084495|ref|YP_046005.1| putative cold shock protein [Acinet... 56 6e-07
gi|4193394|gb|AAD10035.1| CspC [Myxococcus xanthus] 56 6e-07
gi|6073870|gb|AAB40923.2| major cold shock protein CSPA1 [Yersin... 56 6e-07
gi|29827434|ref|NP_822068.1| putative cold shock protein [Strept... 56 6e-07
gi|46916945|emb|CAG23708.1| putative Cold shock-like protein [Ph... 56 6e-07
gi|1763348|gb|AAC47478.1| LIN-28 [Caenorhabditis vulgaris] 56 6e-07
gi|7498486|pir||T20509 hypothetical protein F02E9.2a - Caenorhab... 56 6e-07
gi|17508259|ref|NP_492281.1| abnormal cell LINeage LIN-28, heter... 56 6e-07
gi|15610784|ref|NP_218165.1| cspA [Mycobacterium tuberculosis H3... 55 8e-07
gi|32040969|ref|ZP_00138552.1| COG1278: Cold shock proteins [Pse... 55 8e-07
gi|22125131|ref|NP_668554.1| homolog of Salmonella cold shock pr... 55 8e-07
gi|22994656|ref|ZP_00039151.1| COG1278: Cold shock proteins [Xyl... 55 8e-07
gi|15602520|ref|NP_245592.1| MsmB [Pasteurella multocida Pm70] >... 55 8e-07
gi|16123786|ref|NP_407099.1| major cold shock protein Cspa1 [Yer... 55 8e-07
gi|15838943|ref|NP_299631.1| cold shock protein [Xylella fastidi... 55 8e-07
gi|22124143|ref|NP_667566.1| cold shock-like protein [Yersinia p... 55 8e-07
gi|9968446|emb|CAC06102.1| cold shock protein [Lactobacillus pla... 55 8e-07
gi|16122865|ref|NP_406178.1| cold shock protein [Yersinia pestis... 55 8e-07
gi|1421212|pdb|1CSP| Major Cold Shock Protein (Cspb) 55 8e-07
gi|16077975|ref|NP_388791.1| major cold-shock protein [Bacillus ... 55 8e-07
gi|7498487|pir||T20510 hypothetical protein F02E9.2b - Caenorhab... 55 8e-07
gi|6434276|emb|CAB61009.1| Hypothetical protein F02E9.2b [Caenor... 55 8e-07
gi|4454361|emb|CAA72659.1| cold shock protein, CSPA [Vibrio chol... 55 1e-06
gi|16123785|ref|NP_407098.1| major cold shock protein Cspa2 [Yer... 55 1e-06
gi|22124144|ref|NP_667567.1| cold shock-like protein [Yersinia p... 55 1e-06
gi|1864167|gb|AAB48629.1| major cold-shock protein homolog CspB ... 55 1e-06
gi|28377809|ref|NP_784701.1| cold shock protein CspC [Lactobacil... 55 1e-06
gi|30249693|ref|NP_841763.1| Cold-shock DNA-binding domain [Nitr... 55 1e-06
gi|30020489|ref|NP_832120.1| Cold shock protein [Bacillus cereus... 55 1e-06
gi|46200113|ref|YP_005780.1| cold shock protein [Thermus thermop... 55 1e-06
gi|48784502|ref|ZP_00280868.1| COG1278: Cold shock proteins [Bur... 55 1e-06
gi|21219062|ref|NP_624841.1| cold shock protein [Streptomyces co... 55 1e-06
gi|17547185|ref|NP_520587.1| PROBABLE COLD SHOCK-LIKE CSPD TRANS... 55 1e-06
gi|48862600|ref|ZP_00316496.1| COG1278: Cold shock proteins [Mic... 55 1e-06
gi|46131999|ref|ZP_00202794.1| COG1278: Cold shock proteins [Ral... 55 1e-06
gi|48824672|ref|ZP_00286018.1| COG1278: Cold shock proteins [Ent... 55 1e-06
gi|27374959|dbj|BAC53777.1| cold shock protein homolog [Thermus ... 55 1e-06
gi|28275223|ref|NP_717259.2| cold shock domain family protein [S... 55 1e-06
gi|26989186|ref|NP_744611.1| cold shock protein CspA [Pseudomona... 55 1e-06
gi|16801190|ref|NP_471458.1| similar to major cold-shock protein... 55 1e-06
gi|21673445|ref|NP_661510.1| cold shock-like protein CspG [Chlor... 55 1e-06
gi|24347442|gb|AAN54703.1| cold shock domain family protein [She... 55 1e-06
gi|21230878|ref|NP_636795.1| major cold shock protein [Xanthomon... 55 1e-06
gi|28868485|ref|NP_791104.1| cold shock domain family protein [P... 54 2e-06
gi|29376512|ref|NP_815666.1| cold shock protein CspC [Enterococc... 54 2e-06
gi|20302392|emb|CAC80094.1| cold shock protein [Staphylococcus a... 54 2e-06
gi|48764681|ref|ZP_00269232.1| COG1278: Cold shock proteins [Rho... 54 2e-06
gi|19703863|ref|NP_603425.1| Cold shock protein [Fusobacterium n... 54 2e-06
gi|46314768|ref|ZP_00215353.1| COG1278: Cold shock proteins [Bur... 54 2e-06
gi|29831319|ref|NP_825953.1| putative cold shock protein [Strept... 54 2e-06
gi|46321228|ref|ZP_00221607.1| COG1278: Cold shock proteins [Bur... 54 2e-06
gi|30019750|ref|NP_831381.1| Cold shock protein [Bacillus cereus... 54 2e-06
gi|16974801|pdb|1HZ9|A Chain A, Bacillus Caldolyticus Cold-Shock... 54 2e-06
gi|45514736|ref|ZP_00166293.1| COG1278: Cold shock proteins [Ral... 54 2e-06
gi|15601687|ref|NP_233318.1| cold shock domain family protein [V... 54 2e-06
gi|29830990|ref|NP_825624.1| putative cold shock protein [Strept... 54 2e-06
gi|47574778|ref|ZP_00244813.1| COG1278: Cold shock proteins [Rub... 54 2e-06
gi|42780794|ref|NP_978041.1| cold shock protein CspB [Bacillus c... 54 2e-06
gi|21399520|ref|NP_655505.1| cold, Cold Shock RNA binding domain... 54 2e-06
gi|29375372|ref|NP_814526.1| cold shock domain family protein [E... 54 2e-06
gi|50875251|emb|CAG35091.1| probable cold-shock protein (CspB) [... 54 2e-06
gi|46915136|emb|CAG21909.1| putative Cold shock-like protein [Ph... 54 2e-06
gi|45514738|ref|ZP_00166295.1| COG1278: Cold shock proteins [Ral... 54 2e-06
gi|41690702|ref|ZP_00147234.1| COG1278: Cold shock proteins [Psy... 54 2e-06
gi|16974807|pdb|1HZC|A Chain A, Bacillus Caldolyticus Cold-Shock... 54 2e-06
gi|23098474|ref|NP_691940.1| cold shock protein [Oceanobacillus ... 54 2e-06
gi|21633215|gb|AAM52983.1| CspA protein [Lactobacillus delbrueck... 54 3e-06
gi|15600954|ref|NP_232584.1| cold shock DNA-binding domain prote... 54 3e-06
gi|33594722|ref|NP_882366.1| putative cold shock-like protein [B... 54 3e-06
gi|22958643|ref|ZP_00006310.1| COG1278: Cold shock proteins [Rho... 54 3e-06
gi|48871276|ref|ZP_00323992.1| COG1278: Cold shock proteins [Ped... 54 3e-06
gi|21541531|gb|AAM61873.1| cold shock protein [Lactobacillus pla... 54 3e-06
gi|50875824|emb|CAG35664.1| probable cold-shock protein (CspD) [... 54 3e-06
gi|46188317|ref|ZP_00205651.1| COG1278: Cold shock proteins [Pse... 54 3e-06
gi|21222143|ref|NP_627922.1| cold-shock protein [Streptomyces co... 54 3e-06
gi|29377389|ref|NP_816543.1| cold-shock domain family protein [E... 54 3e-06
gi|27379097|ref|NP_770626.1| cold shock protein [Bradyrhizobium ... 53 4e-06
gi|3892590|emb|CAA76698.1| cold shock protein E [Lactococcus lac... 53 4e-06
gi|33596619|ref|NP_884262.1| cold shock-like protein [Bordetella... 53 4e-06
gi|50875822|emb|CAG35662.1| probable cold shock protein [Desulfo... 53 4e-06
gi|11933034|emb|CAC19354.1| cold-shock like protein [Streptomyce... 53 4e-06
gi|39936116|ref|NP_948392.1| cold shock DNA binding protein [Rho... 53 4e-06
gi|34499122|ref|NP_903337.1| cold shock transcription regulator ... 53 4e-06
gi|21222688|ref|NP_628467.1| cold shock protein [Streptomyces co... 53 4e-06
gi|11933043|emb|CAC19357.1| cold-shock like protein [Streptomyce... 53 4e-06
gi|9957540|gb|AAG09405.1| cold shock protein B [Yersinia enteroc... 53 4e-06
gi|42560588|ref|NP_975039.1| COLD SHOCK PROTEIN [Mycoplasma myco... 53 4e-06
gi|29830475|ref|NP_825109.1| putative cold shock protein [Strept... 53 5e-06
gi|50121397|ref|YP_050564.1| cold shock protein [Erwinia carotov... 53 5e-06
gi|48861495|ref|ZP_00315396.1| COG1278: Cold shock proteins [Mic... 53 5e-06
gi|23115214|ref|ZP_00100402.1| COG1278: Cold shock proteins [Des... 53 5e-06
gi|29375934|ref|NP_815088.1| cold-shock domain family protein [E... 53 5e-06
gi|15839211|ref|NP_299899.1| temperature acclimation protein B [... 53 5e-06
gi|17549274|ref|NP_522614.1| PROBABLE COLD SHOCK-LIKE TRANSCRIPT... 53 5e-06
gi|48768368|ref|ZP_00272718.1| COG1278: Cold shock proteins [Ral... 53 5e-06
gi|46188432|ref|ZP_00125899.2| COG1278: Cold shock proteins [Pse... 53 5e-06
gi|28199859|ref|NP_780173.1| temperature acclimation protein B [... 53 5e-06
gi|21222160|ref|NP_627939.1| cold shock protein [Streptomyces co... 53 5e-06
gi|28871129|ref|NP_793748.1| cold shock domain family protein [P... 53 5e-06
gi|15644431|ref|NP_229483.1| cold shock protein [Thermotoga mari... 53 5e-06
gi|26987944|ref|NP_743369.1| cold-shock domain family protein [P... 53 5e-06
gi|48830985|ref|ZP_00288072.1| COG1278: Cold shock proteins [Mag... 53 5e-06
gi|48730414|ref|ZP_00264162.1| COG1278: Cold shock proteins [Pse... 53 5e-06
gi|48784817|ref|ZP_00281122.1| COG1278: Cold shock proteins [Bur... 52 7e-06
gi|29830697|ref|NP_825331.1| putative cold shock protein [Strept... 52 7e-06
gi|26988254|ref|NP_743679.1| cold shock protein CspA [Pseudomona... 52 7e-06
gi|27379238|ref|NP_770767.1| cold shock protein [Bradyrhizobium ... 52 7e-06
gi|47575193|ref|ZP_00245228.1| COG1278: Cold shock proteins [Rub... 52 7e-06
gi|13475110|ref|NP_106674.1| cold-shock protein [Mesorhizobium l... 52 7e-06
gi|48730789|ref|ZP_00264536.1| COG1278: Cold shock proteins [Pse... 52 7e-06
gi|24374322|ref|NP_718365.1| cold shock domain family protein [S... 52 7e-06
gi|33592839|ref|NP_880483.1| cold shock-like protein [Bordetella... 52 7e-06
gi|37725749|gb|AAO32343.1| cold shock protein 3 [Streptomyces sp... 52 9e-06
gi|15793998|ref|NP_283820.1| putative transcriptional regulator ... 52 9e-06
gi|15925694|ref|NP_373228.1| cold shock protein [Staphylococcus ... 52 9e-06
gi|46320510|ref|ZP_00220897.1| COG1278: Cold shock proteins [Bur... 52 9e-06
gi|46163746|ref|ZP_00204853.1| COG1278: Cold shock proteins [Pse... 52 9e-06
gi|41690016|ref|ZP_00146548.1| COG1278: Cold shock proteins [Psy... 52 9e-06
gi|49487482|ref|YP_044703.1| cold shock protein [Staphylococcus ... 52 9e-06
gi|48731807|ref|ZP_00265551.1| COG1278: Cold shock proteins [Pse... 52 9e-06
gi|231915|sp|Q01761|CSP7_STRCL Cold shock-like protein 7.0 >gnl|... 52 9e-06
gi|48862050|ref|ZP_00315948.1| COG1278: Cold shock proteins [Mic... 52 9e-06
gi|48781659|ref|ZP_00278250.1| COG1278: Cold shock proteins [Bur... 52 9e-06
gi|49484900|ref|YP_042124.1| cold shock protein [Staphylococcus ... 52 9e-06
gi|15672150|ref|NP_266324.1| cold shock protein E [Lactococcus l... 52 9e-06
gi|23105359|ref|ZP_00091815.1| COG1278: Cold shock proteins [Azo... 52 9e-06
gi|46312719|ref|ZP_00213313.1| COG1278: Cold shock proteins [Bur... 52 9e-06
gi|15597818|ref|NP_251312.1| cold-shock protein CspD [Pseudomona... 52 9e-06
gi|23104216|ref|ZP_00090684.1| COG1278: Cold shock proteins [Azo... 52 9e-06
gi|15602346|ref|NP_245418.1| CspD [Pasteurella multocida Pm70] >... 52 1e-05
gi|46311819|ref|ZP_00212421.1| COG1278: Cold shock proteins [Bur... 52 1e-05
gi|32034585|ref|ZP_00134741.1| COG1278: Cold shock proteins [Act... 52 1e-05
gi|21223064|ref|NP_628843.1| cold shock protein [Streptomyces co... 52 1e-05
gi|27366952|ref|NP_762479.1| Cold shock protein [Vibrio vulnific... 52 1e-05
gi|21224260|ref|NP_630039.1| cold-shock domain protein [Streptom... 52 1e-05
gi|48781281|ref|ZP_00277913.1| COG1278: Cold shock proteins [Bur... 52 1e-05
gi|17548223|ref|NP_521563.1| PROBABLE COLD SHOCK-LIKE TRANSCRIPT... 52 1e-05
gi|28377937|ref|NP_784829.1| cold shock protein CspP [Lactobacil... 52 1e-05
gi|2493773|sp|P72192|TAPB_PSEFR Temperature acclimation protein ... 52 1e-05
gi|15676734|ref|NP_273879.1| cold-shock domain family protein [N... 52 1e-05
gi|13625473|gb|AAK35071.1| cold acclimation protein CapB [Pseudo... 52 1e-05
gi|20135600|gb|AAM09094.1| cold-shock protein CspD [Burkholderia... 51 2e-05
gi|30262422|ref|NP_844799.1| cold shock protein CspA [Bacillus a... 51 2e-05
gi|46188995|ref|ZP_00205874.1| COG1278: Cold shock proteins [Pse... 51 2e-05
gi|23473001|ref|ZP_00128320.1| COG1278: Cold shock proteins [Pse... 51 2e-05
gi|37525576|ref|NP_928920.1| hypothetical protein [Photorhabdus ... 51 2e-05
gi|28869573|ref|NP_792192.1| cold shock domain family protein [P... 51 2e-05
gi|22126652|ref|NP_670075.1| cold shock protein [Yersinia pestis... 51 2e-05
gi|48847569|ref|ZP_00301820.1| COG1278: Cold shock proteins [Nov... 51 2e-05
gi|50877089|emb|CAG36929.1| probable cold-shock protein [Desulfo... 51 2e-05
gi|50085086|ref|YP_046596.1| cold shock-like protein [Acinetobac... 51 2e-05
gi|50876761|emb|CAG36601.1| probable cold-shock protein (CspB) [... 51 2e-05
gi|50875849|emb|CAG35689.1| probable cold-shock protein [Desulfo... 51 2e-05
gi|21399058|ref|NP_655043.1| CSD, 'Cold-shock' DNA-binding domai... 51 2e-05
gi|46192743|ref|ZP_00006109.2| COG1278: Cold shock proteins [Rho... 51 2e-05
gi|30021641|ref|NP_833272.1| Cold shock protein [Bacillus cereus... 51 2e-05
gi|15598462|ref|NP_251956.1| cold acclimation protein B [Pseudom... 50 3e-05
gi|32038349|ref|ZP_00136621.1| COG1278: Cold shock proteins [Pse... 50 3e-05
gi|42780307|ref|NP_977554.1| cold shock protein CspA [Bacillus c... 50 3e-05
gi|33152145|ref|NP_873498.1| cold shock-like protein CspC [Haemo... 50 3e-05
gi|36958641|gb|AAQ87109.1| Cold shock protein cspA [Rhizobium sp... 50 3e-05
gi|49082396|gb|AAT50598.1| PA3266 [synthetic construct] 50 3e-05
gi|15965810|ref|NP_386163.1| COLD SHOCK TRANSCRIPTION REGULATOR ... 50 3e-05
gi|20803992|emb|CAD31569.1| PUTATIVE TRANSCRIPTION REGULATOR COL... 50 4e-05
gi|15596158|ref|NP_249652.1| probable cold-shock protein [Pseudo... 50 4e-05
gi|15800638|ref|NP_286652.1| cold shock protein [Escherichia col... 50 4e-05
gi|2370256|emb|CAA71254.1| cold shock protein [Lactococcus lacti... 50 4e-05
gi|48826380|ref|ZP_00287590.1| COG1278: Cold shock proteins [Ent... 50 4e-05
gi|49082320|gb|AAT50560.1| PA0961 [synthetic construct] 50 4e-05
gi|26246906|ref|NP_752946.1| Cold shock-like protein cspD [Esche... 50 4e-05
gi|22959242|ref|ZP_00006898.1| COG1278: Cold shock proteins [Rho... 50 4e-05
gi|15604514|ref|NP_221032.1| COLD SHOCK-LIKE PROTEIN (cspA) [Ric... 50 4e-05
gi|16121678|ref|NP_404991.1| cold shock-like protein [Yersinia p... 50 4e-05
gi|22538234|ref|NP_689085.1| cold shock protein, CSD family [Str... 50 4e-05
gi|48854828|ref|ZP_00308989.1| COG1278: Cold shock proteins [Cyt... 50 5e-05
gi|23007963|ref|ZP_00049605.1| COG1278: Cold shock proteins [Mag... 50 5e-05
gi|48856764|ref|ZP_00310921.1| COG1278: Cold shock proteins [Cyt... 50 5e-05
gi|28871287|ref|NP_793906.1| cold shock protein CapB [Pseudomona... 50 5e-05
gi|48862533|ref|ZP_00316429.1| COG1278: Cold shock proteins [Mic... 50 5e-05
gi|46106946|ref|ZP_00188090.2| COG1278: Cold shock proteins [Rub... 50 5e-05
gi|39939157|ref|NP_950923.1| cold shock protein [Onion yellows p... 50 5e-05
gi|23105618|ref|ZP_00092074.1| COG1278: Cold shock proteins [Azo... 50 5e-05
gi|16519680|ref|NP_443800.1| Y4cH [Rhizobium sp. NGR234] >gnl|BL... 50 5e-05
gi|2493761|sp|Q45096|CSPA_BACCE Major cold shock protein cspA >g... 50 5e-05
gi|47567592|ref|ZP_00238303.1| hypothetical protein BCE_G9241_11... 50 5e-05
gi|24374170|ref|NP_718213.1| stress response protein CspD [Shewa... 50 5e-05
gi|48863031|ref|ZP_00316925.1| COG1278: Cold shock proteins [Mic... 49 6e-05
gi|22957053|ref|ZP_00004774.1| COG1278: Cold shock proteins [Rho... 49 6e-05
gi|49475887|ref|YP_033928.1| Cold shock protein [Bartonella hens... 49 6e-05
gi|2493771|sp|P72188|CAPA_PSEFR COLD SHOCK PROTEIN CAPA (COLD AC... 49 6e-05
gi|21243129|ref|NP_642711.1| major cold shock protein [Xanthomon... 49 6e-05
gi|48860808|ref|ZP_00314717.1| COG1278: Cold shock proteins [Mic... 49 8e-05
gi|15891806|ref|NP_357478.1| AGR_L_3376p [Agrobacterium tumefaci... 49 8e-05
gi|17936832|ref|NP_533621.1| cold shock protein [Agrobacterium t... 49 8e-05
gi|28377002|ref|NP_783894.1| cold shock protein CspL [Lactobacil... 49 8e-05
gi|45517033|ref|ZP_00168585.1| COG1278: Cold shock proteins [Ral... 49 8e-05
gi|48853825|ref|ZP_00307991.1| COG1278: Cold shock proteins [Cyt... 49 8e-05
gi|28897786|ref|NP_797391.1| cold shock-like protein CspD [Vibri... 49 8e-05
gi|15887459|ref|NP_353140.1| AGR_C_161p [Agrobacterium tumefacie... 49 1e-04
gi|17934025|ref|NP_530815.1| cold shock protein [Agrobacterium t... 49 1e-04
gi|27383360|ref|NP_774889.1| cold shock protein [Bradyrhizobium ... 49 1e-04
gi|3850772|emb|CAA76694.1| cold shock protein A [Lactococcus lac... 49 1e-04
gi|33596617|ref|NP_884260.1| cold shock-like protein [Bordetella... 49 1e-04
gi|33592837|ref|NP_880481.1| cold shock-like protein [Bordetella... 49 1e-04
gi|27365451|ref|NP_760979.1| Cold shock-like protein CspD [Vibri... 48 1e-04
gi|28870519|ref|NP_793138.1| cold shock domain family protein [P... 48 1e-04
gi|49474484|ref|YP_032526.1| Cold shock protein [Bartonella quin... 48 1e-04
gi|729219|sp|P41018|CSPB_BACGO COLD SHOCK PROTEIN CSPB >gnl|BL_O... 48 1e-04
gi|23464629|ref|NP_695232.1| cold shock protein [Bifidobacterium... 48 1e-04
gi|46199928|ref|YP_005595.1| cold shock protein [Thermus thermop... 48 1e-04
gi|38076600|ref|XP_357305.1| similar to mYB-1b [Mus musculus] 48 2e-04
gi|15805932|ref|NP_294631.1| cold shock protein, CSD family [Dei... 48 2e-04
gi|37955684|gb|AAP22523.1| CspA [Pseudomonas aeruginosa] 48 2e-04
gi|28900407|ref|NP_800062.1| cold shock DNA-binding domain prote... 48 2e-04
gi|15892944|ref|NP_360658.1| cold shock-like protein [Rickettsia... 48 2e-04
gi|16759816|ref|NP_455433.1| cold shock-like protein CspD [Salmo... 48 2e-04
gi|39934248|ref|NP_946524.1| cold shock DNA binding protein [Rho... 47 2e-04
gi|27382579|ref|NP_774108.1| cold shock protein [Bradyrhizobium ... 47 2e-04
gi|21231725|ref|NP_637642.1| major cold shock protein [Xanthomon... 47 2e-04
gi|16121646|ref|NP_404959.1| cold shock-like protein [Yersinia p... 47 2e-04
gi|456238|emb|CAA51842.1| cold shock protein [Bacillus subtilis]... 47 2e-04
gi|23009266|ref|ZP_00050379.1| COG1278: Cold shock proteins [Mag... 47 2e-04
gi|45684959|ref|ZP_00196389.1| COG1278: Cold shock proteins [Mes... 47 2e-04
>gi|17533635|ref|NP_496366.1| C.Elegans Y-box (21.3 kD) (cey-1)
[Caenorhabditis elegans]
gi|7500378|pir||T21689 hypothetical protein F33A8.3 -
Caenorhabditis elegans
gi|3876637|emb|CAB04257.1| C. elegans CEY-1 protein (corresponding
sequence F33A8.3) [Caenorhabditis elegans]
Length = 208
Score = 249 bits (637), Expect = 2e-65
Identities = 132/174 (75%), Positives = 132/174 (75%)
Frame = -1
Query: 627 MAEKNDVAEQPADKPVKATKVKGTVKWFNVKNGYGFINRTDTNEDIFVHQTAIINNNPNK 448
MAEKNDVAEQPADKPVKATKVKGTVKWFNVKNGYGFINRTDTNEDIFVHQTAIINNNPNK
Sbjct: 1 MAEKNDVAEQPADKPVKATKVKGTVKWFNVKNGYGFINRTDTNEDIFVHQTAIINNNPNK 60
Query: 447 YLRSLGDNEEVMFDIVEGSKGLEAASVTGPDGGPVQGSKYAADRDAENAAXXXXXXXXXX 268
YLRSLGDNEEVMFDIVEGSKGLEAASVTGPDGGPVQGSKYAADRDAENAA
Sbjct: 61 YLRSLGDNEEVMFDIVEGSKGLEAASVTGPDGGPVQGSKYAADRDAENAARGRGGRGRGR 120
Query: 267 XXXXXGIRHDSGSRDAEEXXXXXXXXXXXXXXXXXXXXXXXXXXXGEETARDTD 106
GIRHDSGSRDAEE GEETARDTD
Sbjct: 121 RGGRGGIRHDSGSRDAEEGGAPRGGGRGGSRRGGGGRGGGRTNSGGEETARDTD 174