Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F33D11_3
(846 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17507107|ref|NP_491694.1| COLlagen structural gene (col-54) [... 313 3e-84
gi|39595378|emb|CAE60416.1| Hypothetical protein CBG04022 [Caeno... 264 2e-69
gi|17508163|ref|NP_492936.1| COLlagen structural gene (col-65) [... 86 1e-15
gi|32566500|ref|NP_872105.1| COLlagen structural gene (27.6 kD) ... 84 3e-15
gi|39580427|emb|CAE69309.1| Hypothetical protein CBG15367 [Caeno... 83 7e-15
gi|25385147|pir||A88640 protein C34H4.4 [imported] - Caenorhabdi... 70 4e-11
gi|17563988|ref|NP_505486.1| COLlagen structural gene (27.2 kD) ... 69 1e-10
gi|17539048|ref|NP_500094.1| COLlagen structural gene (col-107) ... 69 1e-10
gi|17563992|ref|NP_505484.1| COLlagen structural gene (27.4 kD) ... 68 2e-10
gi|39587723|emb|CAE58661.1| Hypothetical protein CBG01830 [Caeno... 67 4e-10
gi|17558722|ref|NP_506300.1| COLlagen structural gene (col-161) ... 66 1e-09
gi|39587940|emb|CAE67959.1| Hypothetical protein CBG13563 [Caeno... 65 1e-09
gi|17565206|ref|NP_506334.1| COLlagen structural gene (col-162) ... 65 2e-09
gi|17539720|ref|NP_502372.1| COLlagen structural gene (28.8 kD) ... 64 3e-09
gi|39594640|emb|CAE72218.1| Hypothetical protein CBG19329 [Caeno... 64 3e-09
gi|39592976|emb|CAE62590.1| Hypothetical protein CBG06704 [Caeno... 64 4e-09
gi|39595633|emb|CAE67135.1| Hypothetical protein CBG12558 [Caeno... 64 5e-09
gi|687634|gb|AAA62504.1| collagen 63 7e-09
gi|32563747|ref|NP_494878.2| COLlagen structural gene (col-17) [... 63 9e-09
gi|39585657|emb|CAE59859.1| Hypothetical protein CBG03334 [Caeno... 63 9e-09
gi|17539090|ref|NP_502514.1| COLlagen structural gene (col-132) ... 61 3e-08
gi|17506643|ref|NP_492948.1| predicted CDS, COLlagen structural ... 60 6e-08
gi|17555486|ref|NP_497131.1| COLlagen structural gene (29.1 kD) ... 60 6e-08
gi|39593374|emb|CAE64844.1| Hypothetical protein CBG09640 [Caeno... 58 2e-07
gi|13235592|emb|CAC33779.1| SclB protein [Streptococcus pyogenes] 57 5e-07
gi|17158629|ref|NP_478050.1| wsv528 [shrimp white spot syndrome ... 57 7e-07
gi|17560484|ref|NP_505709.1| COLlagen structural gene (col-152) ... 57 7e-07
gi|20178621|gb|AAL50184.1| collagen-like protein 2 [Streptococcu... 56 9e-07
gi|39586115|emb|CAE69191.1| Hypothetical protein CBG15226 [Caeno... 55 2e-06
gi|11096145|gb|AAG30212.1| collagen-like surface protein [Strept... 55 2e-06
gi|39597388|emb|CAE59617.1| Hypothetical protein CBG03026 [Caeno... 55 2e-06
gi|39597390|emb|CAE59619.1| Hypothetical protein CBG03028 [Caeno... 55 2e-06
gi|30145696|emb|CAD89749.1| Hypothetical protein M199.5 [Caenorh... 55 2e-06
gi|39594071|emb|CAE70181.1| Hypothetical protein CBG16654 [Caeno... 55 2e-06
gi|13235584|emb|CAC33775.1| SclB protein [Streptococcus pyogenes] 54 3e-06
gi|39597391|emb|CAE59620.1| Hypothetical protein CBG03029 [Caeno... 54 3e-06
gi|4140029|dbj|BAA36973.1| alpha 1 type I collagen [Cynops pyrrh... 54 4e-06
gi|13560506|gb|AAK30079.1| collagen-like protein B [Streptococcu... 54 4e-06
gi|17532627|ref|NP_496309.1| COLlagen structural gene (31.6 kD) ... 54 4e-06
gi|13235596|emb|CAC33780.1| SclB protein [Streptococcus pyogenes] 54 4e-06
gi|17552984|ref|NP_498814.1| COLlagen structural gene (col-91) [... 54 4e-06
gi|17540820|ref|NP_500070.1| COLlagen structural gene (28.0 kD) ... 54 6e-06
gi|4379341|emb|CAA08789.1| fibrillar collagen [Podocoryne carnea] 54 6e-06
gi|38173761|gb|AAH60753.1| MGC69046 protein [Xenopus laevis] 54 6e-06
gi|39586155|emb|CAE69231.1| Hypothetical protein CBG15273 [Caeno... 53 7e-06
gi|39597389|emb|CAE59618.1| Hypothetical protein CBG03027 [Caeno... 53 7e-06
gi|39594639|emb|CAE72217.1| Hypothetical protein CBG19328 [Caeno... 53 7e-06
gi|21745458|gb|AAM77398.1| fibrillar collagen precursor [Hydra v... 53 9e-06
gi|687636|gb|AAA62505.1| collagen [Caenorhabditis elegans] 53 9e-06
gi|13235586|emb|CAC33776.1| SclB protein [Streptococcus pyogenes] 53 9e-06
gi|15675046|ref|NP_269220.1| putative collagen-like protein [Str... 53 9e-06
gi|17538706|ref|NP_499957.1| predicted CDS, COLlagen structural ... 53 9e-06
gi|17559154|ref|NP_505981.1| COLlagen structural gene (33.2 kD) ... 52 1e-05
gi|13365553|dbj|BAB39148.1| scavenger receptor with C-type lecti... 52 1e-05
gi|18641358|ref|NP_110408.2| collectin sub-family member 12 isof... 52 1e-05
gi|17533809|ref|NP_496362.1| COLlagen structural gene (29.2 kD) ... 52 1e-05
gi|18641360|ref|NP_569057.1| collectin sub-family member 12 isof... 52 1e-05
gi|25392184|pir||JC7595 scavenger receptor with C-type lectin ty... 52 1e-05
gi|38174510|gb|AAH60789.1| Collectin sub-family member 12, isofo... 52 1e-05
gi|38490686|emb|CAE53096.1| alpha-5 collagen [Paracentrotus livi... 52 2e-05
gi|39596974|emb|CAE59201.1| Hypothetical protein CBG02512 [Caeno... 52 2e-05
gi|13235588|emb|CAC33777.1| SclB protein [Streptococcus pyogenes] 52 2e-05
gi|112628|pir||A41207 collagen 13, nonfibrillar - freshwater spo... 52 2e-05
gi|115659|sp|P18503|CAS4_EPHMU SHORT-CHAIN COLLAGEN C4 >gnl|BL_O... 52 2e-05
gi|4538570|emb|CAA40203.2| Non-fibrillar collagen EmC13 [Ephydat... 52 2e-05
gi|39594379|emb|CAE71957.1| Hypothetical protein CBG19026 [Caeno... 52 2e-05
gi|50757087|ref|XP_429250.1| PREDICTED: hypothetical protein XP_... 52 2e-05
gi|39592067|emb|CAE75287.1| Hypothetical protein CBG23255 [Caeno... 52 2e-05
gi|46048885|ref|NP_990121.1| alpha 1 (V) collagen [Gallus gallus... 52 2e-05
gi|19745166|ref|NP_604447.1| collagen, type V, alpha 1 [Rattus n... 52 2e-05
gi|191151|gb|AAA37002.1| pro-alpha-1 type V collagen 52 2e-05
gi|551558|gb|AAA62386.1| type V collagen 52 2e-05
gi|1071999|pir||A55047 collagen alpha 1(V) - chicken (fragment) 52 2e-05
gi|47551003|ref|NP_999675.1| alpha-2 collagen [Strongylocentrotu... 52 2e-05
gi|115313|sp|P20908|CA15_HUMAN Collagen alpha 1(V) chain precurs... 52 2e-05
gi|1360669|pir||CGHU1V collagen alpha 1(V) chain precursor - hum... 52 2e-05
gi|16554579|ref|NP_000084.2| alpha 1 type V collagen preproprote... 52 2e-05
gi|7441219|pir||S18803 collagen alpha 1(V) chain - hamster 52 2e-05
gi|39586197|emb|CAE66608.1| Hypothetical protein CBG11934 [Caeno... 52 2e-05
gi|17532625|ref|NP_495810.1| COLlagen structural gene (col-38) [... 52 2e-05
gi|37619788|emb|CAA86755.2| Hypothetical protein C09G5.6 [Caenor... 51 3e-05
gi|17538077|ref|NP_495159.1| COLlagen structural gene (col-74) [... 51 3e-05
gi|50511151|dbj|BAD32561.1| mKIAA1870 protein [Mus musculus] 51 3e-05
gi|7670050|dbj|BAA94972.1| type I collagen alpha 1 [Xenopus laevis] 51 3e-05
gi|37202117|ref|NP_079961.2| procollagen, type XXVII, alpha 1 [M... 51 3e-05
gi|28172191|emb|CAD62259.1| bM340H1.1 (novel collagen triple hel... 51 3e-05
gi|39579122|emb|CAE56687.1| Hypothetical protein CBG24465 [Caeno... 51 3e-05
gi|17531393|ref|NP_496311.1| nematode cuticle collagen, BLIstere... 51 3e-05
gi|17541560|ref|NP_502297.1| COLlagen structural gene (33.5 kD) ... 51 3e-05
gi|39593314|emb|CAE64784.1| Hypothetical protein CBG09577 [Caeno... 51 3e-05
gi|39587116|emb|CAE57583.1| Hypothetical protein CBG00562 [Caeno... 51 3e-05
gi|39593008|emb|CAE62622.1| Hypothetical protein CBG06744 [Caeno... 51 3e-05
gi|29466645|dbj|BAC66788.1| collagen like protein ClgA [Streptoc... 51 4e-05
gi|13560496|gb|AAK30077.1| collagen-like protein B [Streptococcu... 51 4e-05
gi|20380052|gb|AAH28178.1| COL3A1 protein [Homo sapiens] 51 4e-05
gi|15021422|gb|AAK77699.1| ORF30, putative collagen [shrimp whit... 51 4e-05
gi|17158634|ref|NP_477523.1| wsv001 [shrimp white spot syndrome ... 51 4e-05
gi|1070603|pir||CGHU7L collagen alpha 1(III) chain precursor - h... 51 4e-05
gi|4502951|ref|NP_000081.1| alpha 1 type III collagen; Collagen ... 51 4e-05
gi|23466431|ref|ZP_00122019.1| COG5295: Autotransporter adhesin ... 51 4e-05
gi|159960|gb|AAA29439.1| collagen-like protein 51 4e-05
gi|930045|emb|CAA33387.1| alpha-1 (III) collagen [Homo sapiens] 51 4e-05
gi|103623|pir||A32249 collagen - sea urchin (Paracentrotus livid... 51 4e-05
gi|39595517|emb|CAE60555.1| Hypothetical protein CBG04182 [Caeno... 51 4e-05
gi|39587231|emb|CAE57699.1| Hypothetical protein CBG00703 [Caeno... 51 4e-05
gi|31239129|ref|XP_319978.1| ENSANGP00000016652 [Anopheles gambi... 51 4e-05
gi|41393113|ref|NP_958886.1| collagen, type I, alpha 3 [Danio re... 50 5e-05
gi|42542708|gb|AAH66384.1| Collagen, type I, alpha 3 [Danio rerio] 50 5e-05
gi|25395729|pir||H88449 protein F54D8.1 [imported] - Caenorhabdi... 50 5e-05
gi|2147194|pir||S53787 collagen alpha chain - Paralvinella grass... 50 5e-05
gi|39588000|emb|CAE57231.1| Hypothetical protein CBG00101 [Caeno... 50 5e-05
gi|17553572|ref|NP_498086.1| collagen alpha precursor, DumPY : s... 50 5e-05
gi|476420|pir||CGBO1S collagen alpha 1(I) chain - bovine (tentat... 50 5e-05
gi|450048|prf||1920343A fibrillar collagen 50 5e-05
gi|27734650|sp||P02453_2 [Segment 2 of 2] Collagen alpha 1(I) chain 50 5e-05
gi|11875612|gb|AAG40729.1| type IV collagen alpha 1 chain precur... 50 5e-05
gi|17564310|ref|NP_504735.1| COLlagen structural gene (col-141) ... 50 5e-05
gi|26788083|emb|CAD58730.1| SI:bY143E18.1 (novel protein similar... 50 5e-05
gi|7656987|ref|NP_056549.1| procollagen, type V, alpha 1; pro-al... 50 5e-05
gi|115268|sp|P02457|CA11_CHICK Collagen alpha 1(I) chain precursor 50 5e-05
gi|34877879|ref|XP_341575.1| similar to collectin placenta 1 [Ra... 50 5e-05
gi|2894106|emb|CAB01633.1| Collagen alpha1 [Rattus norvegicus] 50 5e-05
gi|323158|pir||S31521 collagen COLF1 - freshwater sponge (Ephyda... 50 5e-05
gi|26335321|dbj|BAC31361.1| unnamed protein product [Mus musculus] 50 5e-05
gi|21901969|dbj|BAC05523.1| collectin placenta 1 [Mus musculus] ... 50 5e-05
gi|18485494|ref|NP_569716.1| collectin sub-family member 12 [Mus... 50 5e-05
gi|39583250|emb|CAE60042.1| Hypothetical protein CBG03553 [Caeno... 50 5e-05
gi|47222238|emb|CAG11117.1| unnamed protein product [Tetraodon n... 50 5e-05
gi|71405|pir||CGCH1S collagen alpha 1(I) chain - chicken (tentat... 50 5e-05
gi|39595564|emb|CAE67065.1| Hypothetical protein CBG12473 [Caeno... 50 6e-05
gi|24210303|emb|CAD54661.1| SI:dZ12F11.3 (collagen type XI alpha... 50 6e-05
gi|29436389|gb|AAH49829.1| Col1a1-prov protein [Xenopus laevis] 50 6e-05
gi|39583745|emb|CAE63849.1| Hypothetical protein CBG08408 [Caeno... 50 6e-05
gi|6230372|dbj|BAA86201.1| CSR1 [Homo sapiens] 50 6e-05
gi|33598924|ref|NP_057324.2| scavenger receptor class A, member ... 50 6e-05
gi|5921191|sp|Q05722|CA19_MOUSE Collagen alpha 1(IX) chain precu... 50 6e-05
gi|34852378|ref|XP_342116.1| similar to procollagen, type VI, al... 50 6e-05
gi|37498970|gb|AAQ91576.1| collagen-like protein 3 [Streptococcu... 50 6e-05
gi|13560500|gb|AAK30078.1| collagen-like protein B [Streptococcu... 50 6e-05
gi|223760|prf||0910139A collagen alpha1(I)CN8 50 6e-05
gi|14164349|dbj|BAB55662.1| collagen a3(I) [Oncorhynchus mykiss] 50 6e-05
gi|39594381|emb|CAE71959.1| Hypothetical protein CBG19029 [Caeno... 50 6e-05
gi|17569345|ref|NP_510110.1| COLlagen structural gene (col-182) ... 50 8e-05
gi|17543166|ref|NP_500138.1| COLlagen structural gene (29.0 kD) ... 50 8e-05
gi|105675|pir||S13580 collagen alpha 1(IX) chain precursor, long... 50 8e-05
gi|13435125|ref|NP_001835.2| alpha 1 type II collagen isoform 1;... 50 8e-05
gi|1070602|pir||CGHU6C collagen alpha 1(II) chain precursor [val... 50 8e-05
gi|10947027|gb|AAC62178.2| type IIA procollagen [Canis familiaris] 50 8e-05
gi|930050|emb|CAA32030.1| alpha-1 type 2 collagen (714 AA) [Homo... 50 8e-05
gi|13235606|emb|CAC33782.1| SclB protein [Streptococcus pyogenes] 50 8e-05
gi|30041|emb|CAA34683.1| COL2A1 [Homo sapiens] 50 8e-05
gi|41688514|sp|Q9JMH4|CA1G_MESAU Collagen alpha 1(XVII) chain (B... 50 8e-05
gi|3510535|gb|AAC33527.1| collagen type IX alpha I chain, long f... 50 8e-05
gi|20141212|sp|P20849|CA19_HUMAN Collagen alpha 1(IX) chain prec... 50 8e-05
gi|17978502|ref|NP_001842.2| alpha 1 type IX collagen isoform 1 ... 50 8e-05
gi|11990227|emb|CAC19501.1| dJ149L1.1.2 (collagen type IX alpha ... 50 8e-05
gi|28380296|sp||P02459_1 [Segment 1 of 2] Collagen alpha 1(II) c... 50 8e-05
gi|2144804|pir||CGBO6C collagen alpha 1(II) chain precursor - bo... 50 8e-05
gi|11990228|emb|CAC19502.1| dJ149L1.1.1 (collagen type IX alpha ... 50 8e-05
gi|39645587|gb|AAH63646.1| Alpha 1 type IX collagen, isoform 2 p... 50 8e-05
gi|17978504|ref|NP_511040.1| alpha 1 type IX collagen isoform 2 ... 50 8e-05
gi|3510536|gb|AAC33528.1| collagen type IX alpha I chain, short ... 50 8e-05
gi|50752016|ref|XP_422615.1| PREDICTED: similar to alpha 4 colla... 50 8e-05
gi|15903446|ref|NP_358996.1| Hypothetical protein [Streptococcus... 50 8e-05
gi|15149479|ref|NP_149162.1| alpha 1 type II collagen isoform 2,... 50 8e-05
gi|7619741|emb|CAB88204.1| putative cuticular collagen [Globoder... 50 8e-05
gi|115287|sp|P02458|CA12_HUMAN Collagen alpha 1(II) chain precur... 50 8e-05
gi|11276913|pir||T45467 collagen alpha 1(II) chain precursor [im... 50 8e-05
gi|38570075|ref|NP_942014.1| collagen, type XXV, alpha 1 isoform... 49 1e-04
gi|13625304|gb|AAK35008.1| collagen-like Alzheimer amyloid plaqu... 49 1e-04
gi|37589303|gb|AAH59281.1| Col1a1 protein [Mus musculus] 49 1e-04
gi|109679|pir||B41182 collagen alpha 1(II) chain precursor (long... 49 1e-04
gi|47229883|emb|CAG07079.1| unnamed protein product [Tetraodon n... 49 1e-04
gi|192262|gb|AAA37333.1| pro-alpha-1 type I collagen >gnl|BL_ORD... 49 1e-04
gi|17481338|dbj|BAB79230.1| type I collagen alpha 2 chain [Oncor... 49 1e-04
gi|3242649|dbj|BAA29028.1| alpha 1 type I collagen [Rana catesbe... 49 1e-04
gi|47223062|emb|CAG07149.1| unnamed protein product [Tetraodon n... 49 1e-04
gi|13624305|ref|NP_112440.1| procollagen, type II, alpha 1; disp... 49 1e-04
gi|200216|gb|AAA68102.1| pro-alpha-1 type II collagen 49 1e-04
gi|17531719|ref|NP_496310.1| COLlagen structural gene (31.3 kD) ... 49 1e-04
gi|8134354|sp|Q9XSJ7|CA11_CANFA Collagen alpha 1(I) chain precur... 49 1e-04
gi|19584340|emb|CAD28466.1| hypothetical protein [Homo sapiens] 49 1e-04
gi|47551001|ref|NP_999674.1| alpha-1 collagen [Strongylocentrotu... 49 1e-04
gi|180879|gb|AAB59383.1| alpha-1 type III collagen 49 1e-04
gi|4519619|dbj|BAA75669.1| collagen pro alpha-chain [Haliotis di... 49 1e-04
gi|45383309|ref|NP_989757.1| alpha 1 type IIA collagen precursor... 49 1e-04
gi|200217|gb|AAA68101.1| pro-alpha-1 type II collagen 49 1e-04
gi|2506305|sp|P11087|CA11_MOUSE Collagen alpha 1(I) chain precur... 49 1e-04
gi|38570073|ref|NP_115907.2| collagen, type XXV, alpha 1 isoform... 49 1e-04
gi|13625306|gb|AAK35009.1| collagen-like Alzheimer amyloid plaqu... 49 1e-04
gi|27688933|ref|XP_213440.1| similar to Collagen alpha1 [Rattus ... 49 1e-04
gi|34328108|ref|NP_031768.2| procollagen, type I, alpha 1 [Mus m... 49 1e-04
gi|115288|sp|P28481|CA12_MOUSE Collagen alpha 1(II) chain precur... 49 1e-04
gi|31231753|ref|XP_318588.1| ENSANGP00000021001 [Anopheles gambi... 49 1e-04
gi|4502945|ref|NP_000079.1| alpha 1 type I collagen preproprotei... 49 1e-04
gi|2144803|pir||CGHU1S collagen alpha 1(I) chain precursor - human 49 1e-04
gi|22328092|gb|AAH36531.1| Alpha 1 type I collagen, preproprotei... 49 1e-04
gi|115269|sp|P02452|CA11_HUMAN Collagen alpha 1(I) chain precursor 49 1e-04
gi|1888409|emb|CAA67261.1| collagen type I alpha 1 [Homo sapiens] 49 1e-04
gi|109680|pir||A41182 collagen alpha 1(II) chain precursor - mouse 49 1e-04
gi|30410850|gb|AAH51383.1| Col2a1 protein [Mus musculus] 49 1e-04
gi|6978677|ref|NP_037061.1| procollagen, type II, alpha 1; Proco... 49 1e-04
gi|4755085|gb|AAB94054.2| pro alpha 1(I) collagen [Homo sapiens] 49 1e-04
gi|30353888|gb|AAH52326.1| Col2a1 protein [Mus musculus] 49 1e-04
gi|180392|gb|AAA51995.1| alpha 1 (I) chain propeptide 49 1e-04
gi|39580830|emb|CAE73091.1| Hypothetical protein CBG20470 [Caeno... 49 1e-04
gi|31340542|gb|AAO33039.2| alpha 1 type II procollagen [Gallus g... 49 1e-04
gi|47229302|emb|CAG04054.1| unnamed protein product [Tetraodon n... 49 1e-04
gi|38570069|gb|AAR24536.1| chihuahua [Danio rerio] 49 1e-04
gi|38649122|gb|AAH63249.1| Col1a1 protein [Danio rerio] 49 1e-04
gi|47220201|emb|CAF98966.1| unnamed protein product [Tetraodon n... 49 1e-04
gi|39586422|emb|CAE74080.1| Hypothetical protein CBG21735 [Caeno... 49 1e-04
gi|39593890|emb|CAE62183.1| Hypothetical protein CBG06230 [Caeno... 49 1e-04
gi|263810|gb|AAB24972.1| collagen alpha chain [Riftia pachyptila... 49 1e-04
gi|399170|sp|P30754|CAFF_RIFPA Fibril-forming collagen alpha chain 49 1e-04
gi|2119156|pir||S28774 collagen alpha chain - tube worm (Riftia ... 49 1e-04
gi|242005|gb|AAB20836.1| collagen type VI alpha 2(VI) chain [Hom... 49 1e-04
gi|2645088|dbj|BAA23626.1| collagen [Hydra vulgaris] 49 1e-04
gi|115290|sp|P04258|CA13_BOVIN Collagen alpha 1(III) chain >gnl|... 49 1e-04
gi|50603950|gb|AAH77461.1| Unknown (protein for MGC:82441) [Xeno... 49 1e-04
gi|31982452|ref|NP_031766.2| procollagen, type IX, alpha 1 [Mus ... 49 1e-04
gi|25012707|gb|AAN71447.1| RE59052p [Drosophila melanogaster] 49 1e-04
gi|45549584|ref|NP_573262.2| CG6867-PA [Drosophila melanogaster]... 49 1e-04
gi|1085500|pir||S42617 collagen alpha 1(IX) chain - mouse >gnl|B... 49 1e-04
gi|12847742|dbj|BAB27690.1| unnamed protein product [Mus musculu... 49 1e-04
gi|41350923|gb|AAH65509.1| Alpha 2 type VI collagen, isoform 2C2... 49 1e-04
gi|27808647|sp|P12110|CA26_HUMAN Collagen alpha 2(VI) chain prec... 49 1e-04
gi|17402875|ref|NP_001840.2| alpha 2 type VI collagen isoform 2C... 49 1e-04
gi|17402877|ref|NP_478054.1| alpha 2 type VI collagen isoform 2C... 49 1e-04
gi|28422746|gb|AAH46970.1| Col9a1 protein [Mus musculus] 49 1e-04
gi|17402879|ref|NP_478055.1| alpha 2 type VI collagen isoform 2C... 49 1e-04
gi|26339398|dbj|BAC33370.1| unnamed protein product [Mus musculus] 49 1e-04
gi|11096143|gb|AAG30211.1| collagen-like surface protein [Strept... 49 1e-04
gi|47228390|emb|CAG05210.1| unnamed protein product [Tetraodon n... 49 2e-04
gi|27882587|gb|AAH43696.1| Similar to procollagen, type V, alpha... 49 2e-04
gi|17537301|ref|NP_494562.1| COLlagen structural gene (37.0 kD) ... 49 2e-04
gi|9453886|dbj|BAB03287.1| pro-alpha 1 type V/XI collagen [Pagru... 49 2e-04
gi|179521|gb|AAA51839.1| BPAG2 49 2e-04
gi|27924402|gb|AAH44962.1| LOC397739 protein [Xenopus laevis] 49 2e-04
gi|6165883|gb|AAF04726.1| collagen type XI alpha-a isoform B [Ho... 49 2e-04
gi|214044|gb|AAA49679.1| alpha-1 type II' collagen 49 2e-04
gi|18375520|ref|NP_542196.1| alpha 1 type XI collagen isoform B ... 49 2e-04
gi|27734646|sp||P02454_1 [Segment 1 of 2] Collagen alpha 1(I) chain 49 2e-04
gi|179594|gb|AAB59373.1| alpha-1 type I collagen 49 2e-04
gi|71403|pir||CGRT1S collagen alpha 1(I) chain - rat (tentative ... 49 2e-04
gi|4502959|ref|NP_000384.1| alpha 2 type V collagen preproprotei... 49 2e-04
gi|6165881|gb|AAF04724.1| collagen type XI alpha-1 [Homo sapiens] 49 2e-04
gi|18375522|ref|NP_542197.1| alpha 1 type XI collagen isoform C ... 49 2e-04
gi|1340175|emb|CAA28454.1| unnamed protein product [Homo sapiens] 49 2e-04
gi|11096153|gb|AAG30216.1| collagen-like surface protein [Strept... 49 2e-04
gi|85719|pir||A40333 collagen alpha 1'(II) chain precursor - Afr... 49 2e-04
gi|14043173|gb|AAH07574.1| Unknown (protein for IMAGE:3139559) [... 49 2e-04
gi|2137076|pir||I48103 type VII collagen - Chinese hamster (frag... 49 2e-04
gi|50754535|ref|XP_425157.1| PREDICTED: similar to type VII coll... 49 2e-04
gi|34875814|ref|XP_343565.1| collagen, type V, alpha 2 [Rattus n... 49 2e-04
gi|47216921|emb|CAG02093.1| unnamed protein product [Tetraodon n... 49 2e-04
gi|2134839|pir||A61262 collagen alpha 1(XVII) chain - human (fra... 49 2e-04
gi|6680978|ref|NP_031767.1| procollagen, type IX, alpha 2 [Mus m... 49 2e-04
gi|20988703|gb|AAH29697.1| Procollagen, type IX, alpha 2 [Mus mu... 49 2e-04
gi|6165882|gb|AAF04725.1| collagen type XI alpha-1 isoform A [Ho... 49 2e-04
gi|18375518|ref|NP_001845.2| alpha 1 type XI collagen isoform A ... 49 2e-04
gi|21542396|sp|P12107|CA1B_HUMAN Collagen alpha 1(XI) chain prec... 49 2e-04
gi|1360670|pir||CGHU1E collagen alpha 1(XI) chain precursor - hu... 49 2e-04
gi|17567743|ref|NP_509276.1| COLlagen structural gene (30.0 kD) ... 49 2e-04
gi|16197600|gb|AAL13166.1| type V preprocollagen alpha 2 chain [... 49 2e-04
gi|22832760|gb|AAH13626.1| Col3a1 protein [Mus musculus] 49 2e-04
gi|39581950|emb|CAE73812.1| Hypothetical protein CBG21362 [Caeno... 49 2e-04
gi|32822777|gb|AAH55077.1| Procollagen, type V, alpha 2 [Mus mus... 49 2e-04
gi|18641354|ref|NP_000485.2| alpha 1 type XVII collagen; collage... 49 2e-04
gi|9588138|emb|CAC00589.1| bA16H23.2 (collagen, type XVII, alpha... 49 2e-04
gi|17481334|dbj|BAB79229.1| type I collagen alpha 2 chain [Oncor... 49 2e-04
gi|41688524|sp|Q9UMD9|CA1G_HUMAN Collagen alpha 1(XVII) chain (B... 49 2e-04
gi|31240941|ref|XP_320884.1| ENSANGP00000019179 [Anopheles gambi... 49 2e-04
gi|5712087|gb|AAD47357.1| alpha-3 type IX collagen [Homo sapiens] 49 2e-04
gi|1196421|gb|AAC41947.1| alpha-3 type IX collagen >gnl|BL_ORD_I... 49 2e-04
gi|17921995|ref|NP_001844.2| alpha 3 type IX collagen; collagen ... 49 2e-04
gi|20137327|sp|Q14050|CA39_HUMAN Collagen alpha 3(IX) chain prec... 49 2e-04
gi|30016|emb|CAA30731.1| unnamed protein product [Homo sapiens] ... 49 2e-04
gi|18202250|sp|O93484|CA21_ONCMY Collagen alpha 2(I) chain precu... 49 2e-04
gi|2119163|pir||S59856 collagen alpha 1(III) chain precursor - m... 49 2e-04
gi|26334217|dbj|BAC30826.1| unnamed protein product [Mus musculus] 49 2e-04
gi|5921190|sp|P08121|CA13_MOUSE Collagen alpha 1(III) chain prec... 49 2e-04
gi|33859526|ref|NP_034060.1| procollagen, type III, alpha 1; min... 49 2e-04
gi|20380522|gb|AAH28248.1| Col3a1 protein [Mus musculus] 49 2e-04
gi|12859657|dbj|BAB31724.1| unnamed protein product [Mus musculus] 49 2e-04
gi|39597161|emb|CAE59388.1| Hypothetical protein CBG02745 [Caeno... 49 2e-04
gi|39587564|emb|CAE58502.1| Hypothetical protein CBG01652 [Caeno... 48 2e-04
gi|47217758|emb|CAG05980.1| unnamed protein product [Tetraodon n... 48 2e-04
gi|14280020|gb|AAK58847.1| collagen type XX alpha 1 precursor [G... 48 2e-04
gi|50758787|ref|XP_417417.1| PREDICTED: similar to collagen type... 48 2e-04
gi|17137252|ref|NP_477190.1| CG16858-PA [Drosophila melanogaster... 48 2e-04
gi|39585781|emb|CAE59983.1| Hypothetical protein CBG03475 [Caeno... 48 2e-04
gi|48762934|ref|NP_000080.2| alpha 2 type I collagen; Collagen I... 48 2e-04
gi|27369868|ref|NP_766192.1| scavenger receptor class A, member ... 48 2e-04
gi|28422462|gb|AAH46861.1| LOC398560 protein [Xenopus laevis] 48 2e-04
gi|26344061|dbj|BAC35687.1| unnamed protein product [Mus musculus] 48 2e-04
gi|11096141|gb|AAG30210.1| collagen-like surface protein [Strept... 48 2e-04
gi|2388555|gb|AAB69977.1| alpha2(I) collagen [Homo sapiens] 48 2e-04
gi|49481374|ref|YP_038772.1| collagen-like protein [Bacillus thu... 48 2e-04
gi|7441224|pir||T13990 collagen type IV alpha 2 - fruit fly (Dro... 48 2e-04
gi|50750147|ref|XP_421890.1| PREDICTED: alpha-1 type VI collagen... 48 2e-04
gi|11096139|gb|AAG30209.1| collagen-like surface protein [Strept... 48 2e-04
gi|15675773|ref|NP_269947.1| collagen-like surface protei [Strep... 48 2e-04
gi|34785873|gb|AAH57648.1| Unknown (protein for MGC:67937) [Mus ... 48 2e-04
gi|49225581|ref|NP_990438.1| alpha-1 type VI collagen [Gallus ga... 48 2e-04
gi|50750041|ref|XP_421846.1| PREDICTED: similar to procollagen t... 48 2e-04
gi|16716479|ref|NP_444415.1| procollagen, type IV, alpha 6 [Mus ... 48 2e-04
gi|1778210|gb|AAC47545.1| fibrillar collagen [Arenicola marina] 48 2e-04
gi|39594542|emb|CAE72120.1| Hypothetical protein CBG19216 [Caeno... 48 2e-04
gi|47216869|emb|CAG11676.1| unnamed protein product [Tetraodon n... 48 2e-04
gi|50744818|ref|XP_419889.1| PREDICTED: similar to alpha(IX) col... 48 2e-04
gi|20072300|gb|AAH26446.1| Scara3 protein [Mus musculus] 48 2e-04
gi|50751232|ref|XP_422303.1| PREDICTED: similar to alpha-1 type ... 48 2e-04
gi|17570601|ref|NP_509692.1| COLlagen structural gene (28.7 kD) ... 48 2e-04
gi|23510253|ref|NP_700442.1| procollagen, type XXIII, alpha 1; c... 48 2e-04
gi|31745150|ref|NP_853667.1| procollagen, type XXIII, alpha 1 [R... 48 2e-04
gi|543516|pir||A48295 collagen 1 - marine sponge (Microciona pro... 48 2e-04
gi|283868|pir||S28791 collagen alpha 1(XI) chain - chicken (frag... 48 2e-04
gi|30022798|ref|NP_834429.1| hypothetical Membrane Spanning Prot... 48 2e-04
gi|39594380|emb|CAE71958.1| Hypothetical protein CBG19027 [Caeno... 48 2e-04
gi|17564306|ref|NP_504738.1| COLlagen structural gene (col-143) ... 48 2e-04
gi|27469566|gb|AAH42075.1| COL22A1 protein [Homo sapiens] 48 3e-04
gi|39585828|emb|CAE61241.1| Hypothetical protein CBG05041 [Caeno... 48 3e-04
gi|4758028|ref|NP_004360.1| alpha 3 type VI collagen isoform 1 p... 48 3e-04
gi|17511053|ref|NP_492245.1| COLlagen structural gene (37.4 kD) ... 48 3e-04
gi|7656989|ref|NP_056534.1| collagen, type V, alpha 3 preproprot... 48 3e-04
gi|2645084|dbj|BAA23624.1| collagen [Hydra vulgaris] 48 3e-04
gi|17539404|ref|NP_503048.1| COLlagen structural gene (28.0 kD) ... 48 3e-04
gi|34859869|ref|XP_342327.1| procollagen type XI alpha 1 [Rattus... 48 3e-04
gi|17149807|ref|NP_476506.1| alpha 3 type VI collagen isoform 3 ... 48 3e-04
gi|420194|pir||S32605 collagen alpha 3(VI) chain - mouse (fragme... 48 3e-04
gi|29725624|ref|NP_775736.2| collagen, type XXIII, alpha 1; proc... 48 3e-04
gi|86224|pir||A05269 collagen alpha 1(III) chain precursor - chi... 48 3e-04
gi|17149811|ref|NP_476508.1| alpha 3 type VI collagen isoform 5 ... 48 3e-04
gi|30354436|gb|AAH52161.1| Procollagen, type XI, alpha 1 [Mus mu... 48 3e-04
gi|6680958|ref|NP_031755.1| procollagen, type XI, alpha 1; pro-a... 48 3e-04
gi|4519617|dbj|BAA75668.1| collagen pro alpha-chain [Haliotis di... 48 3e-04
gi|3172000|emb|CAA06511.1| collagen alpha 1 (XI) [Rattus norvegi... 48 3e-04
gi|17531395|ref|NP_495104.1| BLIstered cuticle BLI-2, Nematode c... 48 3e-04
gi|47220653|emb|CAG06575.1| unnamed protein product [Tetraodon n... 48 3e-04
gi|17149805|ref|NP_476505.1| alpha 3 type VI collagen isoform 2 ... 48 3e-04
gi|50732501|ref|XP_418665.1| PREDICTED: similar to alpha-2 type ... 48 3e-04
gi|2645086|dbj|BAA23625.1| collagen [Hydra vulgaris] 48 3e-04
gi|47218941|emb|CAF98139.1| unnamed protein product [Tetraodon n... 48 3e-04
gi|38454234|ref|NP_942042.1| collagen, type XXVII, alpha 1; coll... 48 3e-04
gi|115347|sp|P27393|CA24_ASCSU Collagen alpha 2(IV) chain precur... 48 3e-04
gi|115328|sp|P20909|CA1B_RAT COLLAGEN ALPHA 1(XI) CHAIN >gnl|BL_... 48 3e-04
gi|3236370|gb|AAC23667.1| type VI collagen alpha 3 subunit [Mus ... 48 3e-04
gi|22652113|gb|AAN03620.1| alpha 1 type XXII collagen [Homo sapi... 48 3e-04
gi|40805823|ref|NP_690848.1| collagen, type XXII, alpha 1 [Homo ... 48 3e-04
gi|34877775|ref|XP_346074.1| similar to alpha 3 type VI collagen... 48 3e-04
gi|47214275|emb|CAG01332.1| unnamed protein product [Tetraodon n... 48 3e-04
gi|17531717|ref|NP_496308.1| COLlagen structural gene (col-79) [... 48 3e-04
gi|47565152|ref|ZP_00236195.1| hypothetical protein membrane Spa... 48 3e-04
gi|47228041|emb|CAF97670.1| unnamed protein product [Tetraodon n... 48 3e-04
gi|47218417|emb|CAG12688.1| unnamed protein product [Tetraodon n... 48 3e-04
gi|17536809|ref|NP_494568.1| COLlagen structural gene (col-72) [... 48 3e-04
gi|39590860|emb|CAE65233.1| Hypothetical protein CBG10116 [Caeno... 48 3e-04
gi|17149809|ref|NP_476507.1| alpha 3 type VI collagen isoform 4 ... 48 3e-04
gi|17564308|ref|NP_504736.1| COLlagen structural gene (col-142) ... 48 3e-04
gi|47086095|ref|NP_998429.1| zgc:85892 [Danio rerio] >gnl|BL_ORD... 47 4e-04
gi|543912|sp|P13941|CA13_RAT Collagen alpha 1(III) chain >gnl|BL... 47 4e-04
gi|25395484|pir||A88102 protein W09G10.1 [imported] - Caenorhabd... 47 4e-04
gi|26327181|dbj|BAC27334.1| unnamed protein product [Mus musculus] 47 4e-04
gi|17538760|ref|NP_501867.1| COLlagen structural gene (29.1 kD) ... 47 4e-04
gi|39591564|emb|CAE71140.1| Hypothetical protein CBG17995 [Caeno... 47 4e-04
gi|192672|gb|AAA37441.1| alpha-2 type VI collagen 47 4e-04
gi|34866357|ref|XP_238554.2| similar to type VII collagen [Rattu... 47 4e-04
gi|47210096|emb|CAF91382.1| unnamed protein product [Tetraodon n... 47 4e-04
gi|50733060|ref|XP_426008.1| PREDICTED: similar to alpha 3 type ... 47 4e-04
gi|6680962|ref|NP_031757.1| procollagen, type XIII, alpha 1; typ... 47 4e-04
gi|34875810|ref|XP_343564.1| procollagen, type III, alpha 1 [Rat... 47 4e-04
gi|49907|emb|CAA44206.1| alpha-2 collagen type VI, subunit [Mus ... 47 4e-04
gi|48097742|ref|XP_391942.1| similar to ENSANGP00000021001 [Apis... 47 4e-04
gi|22203747|ref|NP_666119.1| procollagen, type VI, alpha 2 [Mus ... 47 4e-04
gi|39583705|emb|CAE63809.1| Hypothetical protein CBG08355 [Caeno... 47 4e-04
gi|115410|sp|P12114|CCS1_CAEEL Cuticle collagen sqt-1 >gnl|BL_OR... 47 4e-04
gi|17535735|ref|NP_496421.1| SQuaT SQT-1, ROLler: helically twis... 47 4e-04
gi|17540094|ref|NP_499869.1| predicted CDS, COLlagen structural ... 47 4e-04
gi|3913189|sp|Q02788|CA26_MOUSE Collagen alpha 2(VI) chain precu... 47 4e-04
gi|34870920|ref|XP_342904.1| similar to procollagen, type IX, al... 47 4e-04
gi|5739073|gb|AAD50327.1| type XIII collagen [Mus musculus] 47 4e-04
gi|48762667|ref|NP_892013.2| collagen, type I, alpha 2 [Danio re... 47 4e-04
gi|15209312|emb|CAC51030.1| procollagen type I alpha 2 chain [Da... 47 4e-04
gi|38077494|ref|XP_193814.2| RIKEN cDNA 2310067L16 [Mus musculus] 47 4e-04
gi|115309|sp|P17139|CA14_CAEEL Collagen alpha 1(IV) chain precur... 47 4e-04
gi|283871|pir||S23296 collagen alpha 2(IX) chain precursor - chi... 47 4e-04
gi|39590997|emb|CAE58777.1| Hypothetical protein CBG01972 [Caeno... 47 4e-04
gi|18157524|dbj|BAB83839.1| collagen type XI alpha 2~partially s... 47 4e-04
gi|31746645|gb|AAC19194.2| Collagen protein 99 [Caenorhabditis e... 47 4e-04
gi|11096151|gb|AAG30215.1| collagen-like surface protein [Strept... 47 4e-04
gi|21706756|gb|AAH34164.1| Col13a1 protein [Mus musculus] 47 4e-04
gi|17506297|ref|NP_492086.1| COLlagen structural gene (col-35) [... 47 4e-04
gi|18202034|sp|O42350|CA21_RANCA Collagen alpha 2(I) chain precu... 47 4e-04
gi|50780502|ref|XP_427455.1| PREDICTED: similar to collagen, typ... 47 4e-04
gi|115310|sp|P08120|CA14_DROME Collagen alpha 1(IV) chain precur... 47 4e-04
gi|227522|prf||1705298A collagen alpha1(IV) 47 4e-04
gi|31231815|ref|XP_318597.1| ENSANGP00000020852 [Anopheles gambi... 47 5e-04
gi|14164347|dbj|BAB55661.1| collagen a1(I) [Oncorhynchus mykiss] 47 5e-04
gi|47226956|emb|CAG05848.1| unnamed protein product [Tetraodon n... 47 5e-04
gi|28302161|gb|AAH46645.1| Unknown (protein for MGC:50861) [Homo... 47 5e-04
gi|3171998|emb|CAA06510.1| collagen alpha 1 (III) [Rattus norveg... 47 5e-04
gi|34868476|ref|XP_216399.2| similar to type XV collagen [Rattus... 47 5e-04
gi|17539522|ref|NP_501150.1| COLlagen structural gene (col-114) ... 47 5e-04
gi|39587054|emb|CAE62989.1| Hypothetical protein CBG07217 [Caeno... 47 5e-04
gi|47218418|emb|CAG12689.1| unnamed protein product [Tetraodon n... 47 5e-04
gi|34874580|ref|XP_223124.2| similar to collagen alpha 1(IX) cha... 47 5e-04
gi|7498195|pir||T34203 hypothetical protein D2024.8 - Caenorhabd... 47 5e-04
gi|47217441|emb|CAG10210.1| unnamed protein product [Tetraodon n... 47 5e-04
gi|39930511|ref|NP_597716.1| KIAA1983 protein [Homo sapiens] >gn... 47 5e-04
gi|48098605|ref|XP_392096.1| similar to CG16858-PA [Apis mellifera] 47 5e-04
gi|25150119|ref|NP_505374.2| COLlagen structural gene (col-144) ... 47 5e-04
gi|47228931|emb|CAG09446.1| unnamed protein product [Tetraodon n... 47 5e-04
gi|103624|pir||A35763 collagen alpha 2 chain - sea urchin (Parac... 47 5e-04
gi|11386161|ref|NP_001843.1| alpha 2 type IX collagen; collagen ... 47 5e-04
gi|48140714|ref|XP_393523.1| similar to ENSANGP00000019179 [Apis... 47 5e-04
gi|17569903|ref|NP_508386.1| COLlagen structural gene (38.6 kD) ... 47 5e-04
gi|39596930|emb|CAE59157.1| Hypothetical protein CBG02463 [Caeno... 47 5e-04
gi|1054873|gb|AAA80977.1| alpha-2 IX collagen 47 5e-04
gi|45382993|ref|NP_990865.1| alpha-3 collagen type VI [Gallus ga... 47 5e-04
gi|17559056|ref|NP_505376.1| COLlagen structural gene (col-10) [... 47 5e-04
gi|47229954|emb|CAG10368.1| unnamed protein product [Tetraodon n... 47 5e-04
gi|18916890|dbj|BAB85569.1| KIAA1983 protein [Homo sapiens] 47 5e-04
gi|7494765|pir||T29837 hypothetical protein B0222.6 - Caenorhabd... 47 5e-04
gi|7498929|pir||T29980 hypothetical protein F11G11.10 - Caenorha... 47 5e-04
gi|39585160|emb|CAE57403.1| Hypothetical protein CBG00356 [Caeno... 47 5e-04
gi|34859865|ref|XP_342326.1| similar to type XI collagen alpha-1... 47 5e-04
gi|5360532|dbj|BAA82043.1| alpha1 type II collagen [Cynops pyrrh... 47 5e-04
gi|47229594|emb|CAG06790.1| unnamed protein product [Tetraodon n... 47 5e-04
gi|50502|emb|CAA29946.1| unnamed protein product [Mus musculus] 47 5e-04
gi|446631|prf||1912189A collagen:SUBUNIT=alpha2:ISOTYPE=IX 47 5e-04
gi|420027|pir||S32436 collagen alpha 2(IX) chain - human (fragment) 47 5e-04
gi|21105303|gb|AAM34601.1| precollagen-D [Mytilus galloprovincia... 47 7e-04
gi|29549|emb|CAA68698.1| unnamed protein product [Homo sapiens] 47 7e-04
gi|7656985|ref|NP_001836.1| alpha 1 type IV collagen preproprote... 47 7e-04
gi|31195073|ref|XP_306484.1| ENSANGP00000014653 [Anopheles gambi... 47 7e-04
gi|33859528|ref|NP_034061.1| procollagen, type IV, alpha 1 [Mus ... 47 7e-04
gi|39584177|emb|CAE61552.1| Hypothetical protein CBG05461 [Caeno... 47 7e-04
gi|39585825|emb|CAE61238.1| Hypothetical protein CBG05038 [Caeno... 47 7e-04
gi|17564278|ref|NP_505913.1| predicted CDS, COLlagen structural ... 47 7e-04
gi|47212298|emb|CAF90561.1| unnamed protein product [Tetraodon n... 47 7e-04
gi|34852376|ref|XP_215375.2| similar to collagen alpha1 type VI-... 47 7e-04
gi|13470791|ref|NP_102360.1| hypothetical glycine-rich protein [... 47 7e-04
gi|50749308|ref|XP_421581.1| PREDICTED: similar to type XIII col... 47 7e-04
gi|37498975|gb|AAQ91578.1| collagen-like protein 3 [Streptococcu... 47 7e-04
gi|29179577|gb|AAH49287.1| Col1a2-prov protein [Xenopus laevis] 47 7e-04
gi|19855162|sp|P08123|CA21_HUMAN Collagen alpha 2(I) chain precu... 47 7e-04
gi|49117309|gb|AAH72650.1| Col4a1 protein [Mus musculus] 47 7e-04
gi|47219514|emb|CAG09868.1| unnamed protein product [Tetraodon n... 47 7e-04
gi|14017957|dbj|BAB47499.1| KIAA1870 protein [Homo sapiens] 47 7e-04
gi|30023|emb|CAA68709.1| unnamed protein product [Homo sapiens] 47 7e-04
gi|24581820|ref|NP_723044.1| CG4145-PA [Drosophila melanogaster]... 47 7e-04
gi|23482074|gb|EAA18164.1| hypothetical protein [Plasmodium yoel... 47 7e-04
gi|5777391|emb|CAA23486.2| collagen [Drosophila melanogaster] 47 7e-04
gi|17539040|ref|NP_501123.1| COLlagen structural gene (35.6 kD) ... 47 7e-04
gi|28703797|gb|AAH47305.1| COL4A1 protein [Homo sapiens] 47 7e-04
gi|32140760|ref|NP_116277.2| collagen, type XXVII, alpha 1 [Homo... 47 7e-04
gi|47551005|ref|NP_999676.1| alpha2(IV)-like collagen [Strongylo... 47 7e-04
gi|13358439|ref|NP_078660.1| Collagen-like protein [Lymphocystis... 47 7e-04
gi|3513512|gb|AAC33847.1| nongradient byssal precursor [Mytilus ... 47 7e-04
gi|39597193|emb|CAE59420.1| Hypothetical protein CBG02789 [Caeno... 47 7e-04
gi|7428704|pir||CGHU2A collagen alpha 2(VI) chain precursor, lon... 47 7e-04
gi|17540822|ref|NP_500071.1| COLlagen structural gene (col-105) ... 47 7e-04
gi|225874|prf||1402236A collagen alpha1(IV) 47 7e-04
gi|17539786|ref|NP_502175.1| COLlagen structural gene (45.3 kD) ... 47 7e-04
gi|87169|pir||S09646 collagen alpha 2(VI) chain precursor, mediu... 47 7e-04
gi|211499|gb|AAA48675.1| HMW/LMW collagen subunit precursor 47 7e-04
gi|627310|pir||B34493 collagen alpha 1(IX) chain long form precu... 47 7e-04
gi|12314281|emb|CAC13153.1| bA472K17.2 (collagen type IV alpha 1... 47 7e-04
gi|47087124|ref|NP_997693.1| procollagen, type XI, alpha 2; coll... 47 7e-04
gi|32566596|ref|NP_872268.1| COLlagen structural gene (col-171) ... 47 7e-04
gi|42783914|ref|NP_981161.1| collagen triple helix repeat domain... 47 7e-04
gi|17535253|ref|NP_495759.1| COLlagen structural gene (29.4 kD) ... 47 7e-04
gi|39589674|emb|CAE66909.1| Hypothetical protein CBG12293 [Caeno... 47 7e-04
gi|39592028|emb|CAE75248.1| Hypothetical protein CBG23205 [Caeno... 47 7e-04
gi|180715|gb|AAA52034.1| alpha-2 type XI collagen 46 9e-04
gi|21410158|gb|AAH30913.1| Col2a1 protein [Mus musculus] 46 9e-04
gi|16758080|ref|NP_445808.1| procollagen, type I, alpha 2 [Rattu... 46 9e-04
gi|39585824|emb|CAE61237.1| Hypothetical protein CBG05037 [Caeno... 46 9e-04
gi|211616|gb|AAA48705.1| type VI collagen, alpha-2 subunit 46 9e-04
gi|25148392|ref|NP_741318.1| COLlagen structural gene (28.5 kD) ... 46 9e-04
gi|34866787|ref|XP_243609.2| similar to alpha 1 type XXII collag... 46 9e-04
gi|39585827|emb|CAE61240.1| Hypothetical protein CBG05040 [Caeno... 46 9e-04
gi|7494557|pir||T37286 collagen 40 - Caenorhabditis elegans >gnl... 46 9e-04
gi|17551258|ref|NP_510522.1| COLlagen structural gene (col-41) [... 46 9e-04
gi|2119161|pir||I50696 collagen alpha 1(III) chain - chicken (fr... 46 9e-04
gi|45384382|ref|NP_990679.1| type VI collagen alpha-2 subunit [G... 46 9e-04
gi|5354049|gb|AAD42346.1| type II collagen cyanogen bromide frag... 46 9e-04
gi|5174770|gb|AAC35289.2| fibrillar collagen chain FAp1 alpha [A... 46 9e-04
gi|47229450|emb|CAF99438.1| unnamed protein product [Tetraodon n... 46 9e-04
gi|1360671|pir||CGHU2E collagen alpha 2(XI) chain precursor - hu... 46 9e-04
gi|1070605|pir||CGHU2S collagen alpha 2(I) chain precursor - human 46 9e-04
gi|1418930|emb|CAA98969.1| prepro-alpha2(I) collagen [Homo sapiens] 46 9e-04
gi|32451581|gb|AAH54498.1| Alpha 2 type I collagen [Homo sapiens... 46 9e-04
gi|2735715|gb|AAB93981.1| pro-alpha 2(I) collagen [Homo sapiens] 46 9e-04
gi|179596|gb|AAB59374.1| pre-pro-alpha-2 type I collagen [Homo s... 46 9e-04
gi|8134352|sp|O46392|CA21_CANFA Collagen alpha 2(I) chain precur... 46 9e-04
gi|18028926|gb|AAL56219.1| alpha-3 type IX collagen [Mus musculus] 46 9e-04
gi|50731940|ref|XP_418425.1| PREDICTED: similar to collagen, typ... 46 9e-04
gi|39582632|emb|CAE73736.1| Hypothetical protein CBG21262 [Caeno... 46 9e-04
>gi|17507107|ref|NP_491694.1| COLlagen structural gene (col-54)
[Caenorhabditis elegans]
gi|7500390|pir||T32765 hypothetical protein F33D11.3 -
Caenorhabditis elegans
gi|2773177|gb|AAB96697.1| Collagen protein 54 [Caenorhabditis
elegans]
Length = 281
Score = 313 bits (802), Expect = 3e-84
Identities = 174/281 (61%), Positives = 174/281 (61%)
Frame = +1
Query: 1 MSTTSTVLLFITSVCGVAIISSLLVAGSLFFEAQGFLETSLDEIESFKHYSDVAWKDMIS 180
MSTTSTVLLFITSVCGVAIISSLLVAGSLFFEAQGFLETSLDEIESFKHYSDVAWKDMIS
Sbjct: 1 MSTTSTVLLFITSVCGVAIISSLLVAGSLFFEAQGFLETSLDEIESFKHYSDVAWKDMIS 60
Query: 181 SNTFDRKKRDDEDKSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNPGKDGAAGSSL 360
SNTFDRKKRDDEDKS NPGKDGAAGSSL
Sbjct: 61 SNTFDRKKRDDEDKSCGCPCANGPNNCPPGEAGPPGAPGTPGADGEAGNPGKDGAAGSSL 120
Query: 361 VFEDEKLPCIKCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQGSEGEPGDAG 540
VFEDEKLPCIKC EQGSEGEPGDAG
Sbjct: 121 VFEDEKLPCIKCPAGEPGPQGPDGAPGAPGPDGQPGAPGSNGNPGSAGEQGSEGEPGDAG 180
Query: 541 ATGEIGVAGAPGKNGNRXXXXXXXXXXXXXXXXXXKDGQQGPHGDVGGDGTEGIQGAPGK 720
ATGEIGVAGAPGKNGNR KDGQQGPHGDVGGDGTEGIQGAPGK
Sbjct: 181 ATGEIGVAGAPGKNGNRGSGAPGAPGPEGPIGEPGKDGQQGPHGDVGGDGTEGIQGAPGK 240
Query: 721 DGENXXXXXXXXXXXXXXXXXXXXYCSCPARTKLVFSSESP 843
DGEN YCSCPARTKLVFSSESP
Sbjct: 241 DGENGSDGVAGSDGAPGAPGPDAAYCSCPARTKLVFSSESP 281