Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F36A2_7
(456 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17508693|ref|NP_492384.1| ribosomal Protein, Small subunit (1... 236 9e-62
gi|39589745|emb|CAE66980.1| Hypothetical protein CBG12376 [Caeno... 232 1e-60
gi|22758892|gb|AAN05605.1| ribosomal protein S15 [Argopecten irr... 182 2e-45
gi|4506687|ref|NP_001009.1| ribosomal protein S15; 40S ribosomal... 178 2e-44
gi|49227325|ref|NP_001001819.1| ribosomal protein S15 [Danio rer... 177 3e-44
gi|15294041|gb|AAK95197.1| 40S ribosomal protein S15 [Ictalurus ... 177 4e-44
gi|4324413|gb|AAD16877.1| ribosomal protein S15 [Salmo salar] 176 7e-44
gi|2500481|sp|P70066|RS15_XIPMA 40S RIBOSOMAL PROTEIN S15 (RIG P... 176 9e-44
gi|133802|sp|P20342|RS15_XENLA 40S RIBOSOMAL PROTEIN S15 (RIG PR... 175 1e-43
gi|50370322|gb|AAH76221.1| Unknown (protein for MGC:92743) [Dani... 175 1e-43
gi|19115269|ref|NP_594357.1| 40s ribosomal protein s15 [Schizosa... 174 3e-43
gi|19075461|ref|NP_587961.1| 40s ribosomal protein s15 [Schizosa... 173 6e-43
gi|47935069|gb|AAT39881.1| ribosomal protein S15 [Branchiostoma ... 173 7e-43
gi|15213818|gb|AAK92184.1| ribosomal protein S15 [Spodoptera fru... 172 1e-42
gi|31242893|ref|XP_321877.1| ENSANGP00000013957 [Anopheles gambi... 171 4e-42
gi|46105805|ref|XP_380571.1| RS15_PODAN 40S RIBOSOMAL PROTEIN S1... 170 5e-42
gi|42656532|ref|XP_376154.1| similar to ribosomal protein S15; r... 169 8e-42
gi|464706|sp|P34737|RS15_PODAN 40S RIBOSOMAL PROTEIN S15 (S12) >... 169 8e-42
gi|262391|gb|AAB24655.1| Rig homolog [human, brain, Peptide Part... 169 1e-41
gi|19922390|ref|NP_611136.1| CG8332-PA [Drosophila melanogaster]... 168 2e-41
gi|27923849|sp|Q945U1|RS15_ELAOL 40S ribosomal protein S15 >gnl|... 167 3e-41
gi|49097348|ref|XP_410134.1| RS15_PODAN 40S RIBOSOMAL PROTEIN S1... 167 4e-41
gi|24654191|ref|NP_725591.1| CG8332-PB [Drosophila melanogaster]... 167 4e-41
gi|32409341|ref|XP_325151.1| hypothetical protein [Neurospora cr... 167 5e-41
gi|15239927|ref|NP_199177.1| 40S ribosomal protein S15 (RPS15E) ... 166 1e-40
gi|27923848|sp|O65059|RS15_PICMA 40S ribosomal protein S15 >gnl|... 166 1e-40
gi|15242434|ref|NP_196512.1| 40S ribosomal protein S15 (RPS15C) ... 164 3e-40
gi|2129721|pir||S71259 ribosomal protein S15, cytosolic - Arabid... 164 3e-40
gi|16930761|gb|AAL32040.1| ribosomal S15 protein [Retama raetam] 164 3e-40
gi|15242436|ref|NP_196513.1| 40S ribosomal protein S15 (RPS15D) ... 164 3e-40
gi|34897190|ref|NP_909941.1| putative ribosomal protein S15 [Ory... 163 6e-40
gi|34852400|ref|XP_212720.2| similar to ribosomal protein S15 [R... 163 6e-40
gi|15219697|ref|NP_171923.1| 40S ribosomal protein S15 (RPS15A) ... 163 6e-40
gi|15242432|ref|NP_196511.1| 40S ribosomal protein S15 (RPS15B) ... 157 3e-38
gi|22655533|gb|AAN04095.1| S15 ribosomal protein [Dunaliella ter... 157 5e-38
gi|38087115|ref|XP_141850.2| similar to ribosomal protein S15 [M... 155 2e-37
gi|49532846|dbj|BAD26658.1| Ribosomal protein S15 [Plutella xylo... 154 5e-37
gi|19424453|gb|AAL88736.1| Tcc2i18.5 [Trypanosoma cruzi] >gnl|BL... 150 5e-36
gi|38085125|ref|XP_357667.1| similar to ribosomal protein S15 [M... 147 4e-35
gi|23619124|ref|NP_705086.1| 40S ribosomal protein S15, putative... 145 2e-34
gi|49076576|ref|XP_402248.1| hypothetical protein UM04633.1 [Ust... 143 8e-34
gi|23488371|gb|EAA21292.1| ribosomal protein S19 [Plasmodium yoe... 143 8e-34
gi|401043|sp|P31674|RS15_ORYSA 40S RIBOSOMAL PROTEIN S15 >gnl|BL... 142 1e-33
gi|32398895|emb|CAD98360.1| ribosomal protein S19 [Cryptosporidi... 141 2e-33
gi|46229299|gb|EAK90148.1| 40S ribosomal protein S15 [Cryptospor... 141 2e-33
gi|50555281|ref|XP_505049.1| hypothetical protein [Yarrowia lipo... 139 2e-32
gi|20069100|gb|AAM09679.1| 40S ribosomal protein S15 [Aplysia ca... 139 2e-32
gi|45190263|ref|NP_984517.1| AEL343Cp [Eremothecium gossypii] >g... 138 2e-32
gi|38090775|ref|XP_356500.1| similar to ribosomal protein S15 [M... 138 3e-32
gi|50427041|ref|XP_462125.1| unnamed protein product [Debaryomyc... 138 3e-32
gi|47216406|emb|CAG01957.1| unnamed protein product [Tetraodon n... 137 6e-32
gi|50287179|ref|XP_446019.1| unnamed protein product [Candida gl... 134 3e-31
gi|50310825|ref|XP_455435.1| unnamed protein product [Kluyveromy... 134 3e-31
gi|6324533|ref|NP_014602.1| Protein component of the small (40S)... 134 5e-31
gi|6624737|emb|CAB63846.1| ribosomal protein S15 [Pisum sativum] 133 6e-31
gi|38104962|gb|EAA51453.1| hypothetical protein MG10370.4 [Magna... 133 6e-31
gi|32400989|gb|AAP80700.1| 40S ribosome protein S15 [Griffithsia... 133 6e-31
gi|50257582|gb|EAL20287.1| hypothetical protein CNBF0990 [Crypto... 132 1e-30
gi|34852115|ref|XP_227941.2| similar to MHC class Ib M4 precurso... 127 5e-29
gi|40287237|gb|AAR83748.1| S15 ribosomal protein [Rattus norvegi... 126 1e-28
gi|13812231|ref|NP_113362.1| 40S ribosomal protein S15 [Guillard... 122 1e-27
gi|34875063|ref|XP_224191.2| similar to ribosomal protein S15 [R... 122 2e-27
gi|38084213|ref|XP_355769.1| similar to ribosomal protein S15 [M... 121 3e-27
gi|509599|gb|AAB47433.1| surface antigen 121 3e-27
gi|38076673|ref|XP_139220.2| similar to ribosomal protein S15 [M... 120 6e-27
gi|50508112|dbj|BAD30388.1| 40S ribosomal protein S15 [Oryza sat... 116 1e-25
gi|18599225|ref|XP_086257.1| similar to ribosomal protein S15; r... 114 4e-25
gi|46445004|gb|EAL04275.1| hypothetical protein CaO19.13348 [Can... 110 6e-24
gi|34866679|ref|XP_227850.2| similar to ribosomal protein S15 [R... 108 2e-23
gi|1710742|sp|P51429|RS15_NAEGR 40S RIBOSOMAL PROTEIN S15 >gnl|B... 107 5e-23
gi|15668352|ref|NP_247148.1| SSU ribosomal protein S19P (rpsS) [... 105 1e-22
gi|15242622|ref|NP_201112.1| 40S ribosomal protein S15, putative... 105 1e-22
gi|14520554|ref|NP_126029.1| SSU ribosomal protein S19P [Pyrococ... 104 4e-22
gi|18978193|ref|NP_579550.1| SSU ribosomal protein S19P [Pyrococ... 103 5e-22
gi|14591530|ref|NP_143612.1| 30S ribosomal protein S19 [Pyrococc... 103 7e-22
gi|15920637|ref|NP_376306.1| 140aa long hypothetical 30S ribosom... 103 9e-22
gi|20094426|ref|NP_614273.1| Ribosomal protein S19 [Methanopyrus... 102 1e-21
gi|13541159|ref|NP_110847.1| 30S ribosomal protein S19 [Thermopl... 102 2e-21
gi|11499505|ref|NP_070746.1| SSU ribosomal protein S19P (rps19P)... 100 6e-21
gi|50405269|ref|YP_054361.1| 40s ribosomal protein S15, putative... 100 8e-21
gi|19173361|ref|NP_597164.1| RIBOSOMAL PROTEIN S15 [Encephalitoz... 100 1e-20
gi|15678037|ref|NP_275151.1| ribosomal protein S15 (E.coli S19) ... 99 2e-20
gi|34861959|ref|XP_345007.1| similar to ribosomal protein S15 [R... 99 2e-20
gi|16082266|ref|NP_394724.1| probable 30S ribosomal protein S19 ... 97 5e-20
gi|48477716|ref|YP_023422.1| small subunit ribosomal protein S19... 97 5e-20
gi|15790636|ref|NP_280460.1| 30S ribosomal protein S19P; Rps19p ... 97 7e-20
gi|15897619|ref|NP_342224.1| SSU ribosomal protein S19AB (rps19A... 96 1e-19
gi|34851670|ref|XP_226360.2| similar to ribosomal protein S15 [R... 96 2e-19
gi|20141816|sp|Q9YF74|RS19_AERPE 30S ribosomal protein S19P 95 3e-19
gi|29246855|gb|EAA38436.1| GLP_191_11250_10813 [Giardia lamblia ... 95 3e-19
gi|14600664|ref|NP_147183.1| 30S ribosomal protein S19 [Aeropyru... 95 3e-19
gi|48852522|ref|ZP_00306708.1| COG0185: Ribosomal protein S19 [F... 95 3e-19
gi|38073704|ref|XP_357146.1| similar to ribosomal protein S15 [M... 93 1e-18
gi|49258836|pdb|1S1H|S Chain S, Structure Of The Ribosomal 80s-E... 92 2e-18
gi|43550|emb|CAA33091.1| unnamed protein product [Halobacterium ... 91 6e-18
gi|133851|sp|P20284|RS19_HALMA 30S ribosomal protein S19P (HmaS1... 88 3e-17
gi|21228230|ref|NP_634152.1| SSU ribosomal protein S19P [Methano... 86 1e-16
gi|20089946|ref|NP_616021.1| ribosomal protein S19p [Methanosarc... 86 2e-16
gi|18312838|ref|NP_559505.1| ribosomal protein S19 [Pyrobaculum ... 86 2e-16
gi|48838687|ref|ZP_00295627.1| COG0185: Ribosomal protein S19 [M... 85 3e-16
gi|45359110|ref|NP_988667.1| SSU ribosomal protein S19P [Methano... 82 2e-15
gi|41615264|ref|NP_963762.1| NEQ480 [Nanoarchaeum equitans Kin4-... 82 2e-15
gi|42661880|ref|XP_377500.1| similar to ribosomal protein S15; r... 73 1e-12
gi|41188111|ref|XP_372805.1| similar to dJ612B18.1 (similar to 4... 71 5e-12
gi|4034365|emb|CAA21321.1| dJ612B18.1 (similar to 40S ribosomal ... 71 5e-12
gi|34869933|ref|XP_344046.1| similar to ribosomal protein S15 [R... 64 8e-10
gi|1710740|sp|P52820|RS15_HELLU 40S RIBOSOMAL PROTEIN S15 >gnl|B... 53 1e-06
gi|13310857|gb|AAK18648.1| ribosomal protein S19 [Candidatus Car... 51 4e-06
gi|34875376|ref|XP_344440.1| similar to ribosomal protein S15 - ... 48 4e-05
gi|11497459|ref|NP_042249.1| ribosomal protein S19 [Prototheca w... 48 4e-05
gi|38107683|gb|EAA53823.1| hypothetical protein MG09573.4 [Magna... 47 6e-05
gi|13272302|gb|AAK17085.1| ribosomal protein S19 [Candidatus Car... 47 1e-04
gi|50364942|ref|YP_053367.1| 30S ribosomal protein S19 [Mesoplas... 47 1e-04
gi|133854|sp|P10132|RS19_MYCCA 30S ribosomal protein S19 >gnl|BL... 46 1e-04
gi|42561266|ref|NP_975717.1| 30S RIBOSOMAL PROTEIN S19 [Mycoplas... 46 1e-04
gi|15594827|ref|NP_212616.1| ribosomal protein S19 (rpsS) [Borre... 46 1e-04
gi|50657693|gb|AAT79678.1| 30S ribosomal protein S19 [Gracilaria... 45 2e-04
gi|11466511|ref|NP_044760.1| ribosomal protein S19 [Reclinomonas... 45 2e-04
gi|13310848|gb|AAK18640.1| ribosomal protein S19 [Candidatus Car... 45 2e-04
gi|28198357|ref|NP_778671.1| 30S ribosomal protein S19 [Xylella ... 45 2e-04
gi|15837758|ref|NP_298446.1| 30S ribosomal protein S19 [Xylella ... 45 3e-04
gi|46109480|ref|XP_381798.1| hypothetical protein FG01622.1 [Gib... 45 3e-04
gi|15605620|ref|NP_212993.1| ribosomal protein S19 [Aquifex aeol... 45 4e-04
gi|29839865|ref|NP_828971.1| ribosomal protein S19 [Chlamydophil... 45 4e-04
gi|22550358|ref|NP_689362.1| ribosomal protein S19 [Chaetosphaer... 45 4e-04
gi|11465426|ref|NP_045183.1| ribosomal protein S19 [Cyanidium ca... 45 4e-04
gi|7404458|sp|O66435|RS19_AQUAE 30S ribosomal protein S19 45 4e-04
gi|7388163|sp|Q9ZI46|RS19_AQUPY 30S ribosomal protein S19 >gnl|B... 45 4e-04
gi|11467721|ref|NP_050773.1| ribosomal protein S19 [Guillardia t... 44 5e-04
gi|3290053|gb|AAC39492.1| ribosomal protein [Phytophthora cinnam... 44 5e-04
gi|50422431|ref|XP_459781.1| unnamed protein product [Debaryomyc... 44 7e-04
gi|42526283|ref|NP_971381.1| ribosomal protein S19 [Treponema de... 44 7e-04
gi|1685375|gb|AAB36826.1| ribosomal protein S19 [Borrelia burgdo... 44 7e-04
gi|13507908|ref|NP_109857.1| ribosomal protein S19 [Mycoplasma p... 44 7e-04
gi|45917165|ref|ZP_00196313.2| COG0185: Ribosomal protein S19 [M... 44 9e-04
gi|19113824|ref|NP_592912.1| putative 30s ribosomal protein s19 ... 44 9e-04
gi|21230368|ref|NP_636285.1| 30S ribosomal protein S19 [Xanthomo... 43 0.001
gi|46199626|ref|YP_005293.1| SSU ribosomal protein S19P [Thermus... 43 0.001
gi|5822309|pdb|1QKF|A Chain A, Solution Structure Of The Ribosom... 43 0.001
gi|21241741|ref|NP_641323.1| 30S ribosomal protein S19 [Xanthomo... 43 0.001
gi|15217697|ref|NP_174647.1| 40S ribosomal protein S15, putative... 43 0.001
gi|6324365|ref|NP_014435.1| Mitochondrial ribosomal protein of t... 43 0.001
gi|41179015|ref|NP_958370.1| ribosomal protein S19 [Chlamydomona... 43 0.001
gi|9695402|ref|NP_037624.1| ribosomal protein S19 [Phytophthora ... 43 0.001
gi|15605253|ref|NP_220039.1| S19 Ribosomal Protein [Chlamydia tr... 43 0.001
gi|15836175|ref|NP_300699.1| S19 ribosomal protein [Chlamydophil... 42 0.002
gi|15618553|ref|NP_224839.1| S19 Ribosomal Protein [Chlamydophil... 42 0.002
gi|50288557|ref|XP_446708.1| unnamed protein product [Candida gl... 42 0.002
gi|48849968|ref|ZP_00304211.1| COG0185: Ribosomal protein S19 [N... 42 0.003
gi|12045008|ref|NP_072818.1| ribosomal protein S19 (rpS19) [Myco... 42 0.003
gi|34811547|pdb|1PNS|S Chain S, Crystal Structure Of A Streptomy... 42 0.003
gi|34849397|gb|AAP58896.1| ribosomal protein S19 [Spiroplasma ku... 42 0.003
gi|45200873|ref|NP_986443.1| AGL224Wp [Eremothecium gossypii] >g... 42 0.003
gi|46579718|ref|YP_010526.1| ribosomal protein S19 [Desulfovibri... 42 0.003
gi|15805344|ref|NP_294038.1| ribosomal protein S19 [Deinococcus ... 42 0.003
gi|19704962|ref|NP_602457.1| SSU ribosomal protein S19P [Fusobac... 42 0.003
gi|49071424|ref|XP_400001.1| hypothetical protein UM02386.1 [Ust... 42 0.003
gi|50547517|ref|XP_501228.1| hypothetical protein [Yarrowia lipo... 42 0.003
gi|29653594|ref|NP_819286.1| ribosomal protein S19 [Coxiella bur... 41 0.004
gi|15644244|ref|NP_229296.1| ribosomal protein S19 [Thermotoga m... 41 0.004
gi|15645928|ref|NP_208107.1| ribosomal protein S19 (rps19) [Heli... 41 0.004
gi|15612300|ref|NP_223953.1| 30S RIBOSOMAL PROTEIN S19 [Helicoba... 41 0.004
gi|11465776|ref|NP_053920.1| ribosomal protein S19 [Porphyra pur... 41 0.006
gi|50310749|ref|XP_455396.1| unnamed protein product [Kluyveromy... 41 0.006
gi|33862110|ref|NP_893671.1| 30S Ribosomal protein S19 [Prochlor... 41 0.006
gi|49084136|ref|XP_404292.1| hypothetical protein AN0155.2 [Aspe... 41 0.006
gi|31544259|ref|NP_852837.1| RpsS [Mycoplasma gallisepticum R] >... 40 0.007
gi|48860645|ref|ZP_00314556.1| COG0185: Ribosomal protein S19 [M... 40 0.007
gi|22297629|ref|NP_680876.1| 30S ribosomal protein S19 [Thermosy... 40 0.007
gi|29374855|ref|NP_814008.1| ribosomal protein S19 [Enterococcus... 40 0.010
gi|46911965|emb|CAG18763.1| putative ribosomal protein S19 [Phot... 40 0.010
gi|21450004|ref|NP_659266.1| ribosomal protein S19 [Laminaria di... 40 0.010
gi|6066170|gb|AAF03188.1| ribosomal protein S19 [Nephroselmis ol... 40 0.010
gi|10121729|gb|AAG13344.1| ribosomal protein S15 [Gillichthys mi... 40 0.010
gi|23104443|ref|ZP_00090907.1| COG0185: Ribosomal protein S19 [A... 40 0.010
gi|48893989|ref|ZP_00327187.1| COG0185: Ribosomal protein S19 [T... 40 0.010
gi|34541537|ref|NP_906016.1| ribosomal protein S19 [Porphyromona... 40 0.010
gi|1710797|sp|P50893|RT19_PLASU MITOCHONDRIAL RIBOSOMAL PROTEIN ... 40 0.010
gi|48824726|ref|ZP_00286065.1| COG0185: Ribosomal protein S19 [E... 40 0.010
gi|29348132|ref|NP_811635.1| 30S ribosomal protein S19 [Bacteroi... 40 0.010
gi|16801838|ref|NP_472106.1| ribosomal protein S19 [Listeria inn... 40 0.013
gi|20808656|ref|NP_623827.1| Ribosomal protein S19 [Thermoanaero... 40 0.013
gi|33241157|ref|NP_876099.1| Ribosomal protein S19 [Prochlorococ... 40 0.013
gi|28867858|ref|NP_790477.1| ribosomal protein S19 [Pseudomonas ... 40 0.013
gi|32420803|ref|XP_330845.1| hypothetical protein [Neurospora cr... 40 0.013
gi|11467007|ref|NP_041914.1| ribosomal protein S19 [Euglena grac... 40 0.013
gi|15674291|ref|NP_268464.1| 30S ribosomal protein S19 [Streptoc... 40 0.013
gi|46141794|ref|ZP_00204043.1| COG0185: Ribosomal protein S19 [P... 40 0.013
gi|47574122|ref|ZP_00244158.1| COG0185: Ribosomal protein S19 [R... 40 0.013
gi|26987199|ref|NP_742624.1| ribosomal protein S19 [Pseudomonas ... 40 0.013
gi|46188031|ref|ZP_00205553.1| COG0185: Ribosomal protein S19 [P... 40 0.013
gi|16329937|ref|NP_440665.1| 30S ribosomal protein S19 [Synechoc... 40 0.013
gi|15900149|ref|NP_344753.1| ribosomal protein S19 [Streptococcu... 40 0.013
gi|18422781|ref|NP_568681.1| 30S ribosomal protein S19, mitochon... 39 0.016
gi|2129722|pir||S71114 ribosomal protein S19 precursor, mitochon... 39 0.016
gi|8809615|dbj|BAA97166.1| 40S ribosomal protein S19 [Arabidopsi... 39 0.016
gi|16077188|ref|NP_388001.1| ribosomal protein S19 (BS19) [Bacil... 39 0.016
gi|42630390|ref|ZP_00155934.1| COG0185: Ribosomal protein S19 [H... 39 0.016
gi|46308735|ref|ZP_00210927.1| COG0185: Ribosomal protein S19 [E... 39 0.016
gi|15639186|ref|NP_218632.1| ribosomal protein S19 (rpsS) [Trepo... 39 0.016
gi|11467118|ref|NP_054419.1| rps19 [Marchantia polymorpha] >gnl|... 39 0.016
gi|15603276|ref|NP_246350.1| RpS19 [Pasteurella multocida Pm70] ... 39 0.016
gi|24213443|ref|NP_710924.1| ribosomal protein S19 [Leptospira i... 39 0.016
gi|45658699|ref|YP_002785.1| 30S ribosomal protein S19 [Leptospi... 39 0.016
gi|15965113|ref|NP_385466.1| PROBABLE 30S RIBOSOMAL PROTEIN S19 ... 39 0.016
gi|15612701|ref|NP_241004.1| 30S ribosomal protein S19; ribosoma... 39 0.016
gi|42524371|ref|NP_969751.1| 30S ribosomal protein S19 [Bdellovi... 39 0.016
gi|33594755|ref|NP_882398.1| 30S ribosomal protein S19 [Bordetel... 39 0.016
gi|46130386|ref|ZP_00165221.2| COG0185: Ribosomal protein S19 [S... 39 0.022
gi|17231703|ref|NP_488251.1| 30S ribosomal protein S19 [Nostoc s... 39 0.022
gi|45507564|ref|ZP_00159907.1| COG0185: Ribosomal protein S19 [A... 39 0.022
gi|33866603|ref|NP_898162.1| 30S ribosomal protein S19 [Synechoc... 39 0.022
gi|21674994|ref|NP_663059.1| ribosomal protein S19 [Chlorobium t... 39 0.022
gi|15674077|ref|NP_268252.1| 30S ribosomal protein S19 [Lactococ... 39 0.022
gi|15896379|ref|NP_349728.1| Ribosomal protein S19 [Clostridium ... 39 0.022
gi|15892925|ref|NP_360639.1| 30S ribosomal protein S19 [Ricketts... 39 0.022
gi|47459074|ref|YP_015936.1| 30S ribosomal protein s19 [Mycoplas... 39 0.022
gi|30468186|ref|NP_849073.1| ribosomal protein S19 [Cyanidioschy... 39 0.022
gi|30018384|ref|NP_830015.1| SSU ribosomal protein S19P [Bacillu... 39 0.022
gi|33594483|ref|NP_882127.1| 30S ribosomal protein S19 [Bordetel... 39 0.022
gi|13357795|ref|NP_078069.1| ribosomal protein S19 [Ureaplasma p... 39 0.022
gi|11467341|ref|NP_043198.1| ribosomal protein S19 [Cyanophora p... 39 0.022
gi|26554461|ref|NP_758395.1| ribosomal protein S19 [Mycoplasma p... 39 0.022
gi|13470555|ref|NP_102124.1| 30S ribosomal protein S19 [Mesorhiz... 39 0.022
gi|46318192|ref|ZP_00218678.1| COG0185: Ribosomal protein S19 [B... 39 0.028
gi|41723112|ref|ZP_00150055.1| COG0185: Ribosomal protein S19 [D... 39 0.028
gi|23024323|ref|ZP_00063539.1| COG0185: Ribosomal protein S19 [L... 39 0.028
gi|46164753|ref|ZP_00137744.2| COG0185: Ribosomal protein S19 [P... 39 0.028
gi|15604501|ref|NP_221019.1| 30S RIBOSOMAL PROTEIN S19 (rpsS) [R... 39 0.028
gi|48767844|ref|ZP_00272197.1| COG0185: Ribosomal protein S19 [R... 39 0.028
gi|15599455|ref|NP_252949.1| 30S ribosomal protein S19 [Pseudomo... 39 0.028
gi|48831550|ref|ZP_00288610.1| COG0185: Ribosomal protein S19 [M... 39 0.028
gi|32266881|ref|NP_860913.1| ribosomal protein S19 [Helicobacter... 39 0.028
gi|38638297|ref|NP_943675.1| ribosomal protein S19 [Chara vulgar... 39 0.028
gi|30260305|ref|NP_842682.1| ribosomal protein S19 [Bacillus ant... 39 0.028
gi|28897035|ref|NP_796640.1| ribosomal protein S19 [Vibrio parah... 38 0.037
gi|15642587|ref|NP_232220.1| ribosomal protein S19 [Vibrio chole... 38 0.037
gi|32480883|ref|NP_862794.1| ribosomal protein S19 [Calycanthus ... 38 0.037
gi|17547734|ref|NP_521136.1| PROBABLE 30S RIBOSOMAL SUBUNIT PROT... 38 0.048
gi|23003721|ref|ZP_00047373.1| COG0185: Ribosomal protein S19 [L... 38 0.048
gi|28377836|ref|NP_784728.1| ribosomal protein S19 [Lactobacillu... 38 0.048
gi|34499637|ref|NP_903852.1| 30S ribosomal protein S19 [Chromoba... 38 0.048
gi|22956509|ref|ZP_00004272.1| COG0185: Ribosomal protein S19 [R... 38 0.048
gi|48857576|ref|ZP_00311570.1| COG0185: Ribosomal protein S19 [C... 38 0.048
gi|33519662|ref|NP_878494.1| 30S ribosomal subunit protein S19 [... 38 0.048
gi|15676073|ref|NP_273204.1| 30S ribosomal protein S19 [Neisseri... 38 0.048
gi|45531564|ref|ZP_00182604.1| COG0185: Ribosomal protein S19 [E... 38 0.048
gi|401042|sp|P31162|RR19_PEA Chloroplast 30S ribosomal protein S... 38 0.048
gi|23097578|ref|NP_691044.1| 30S ribosomal protein S19 [Oceanoba... 38 0.048
gi|33864003|ref|NP_895563.1| 30S Ribosomal protein S19 [Prochlor... 38 0.048
gi|34558023|ref|NP_907838.1| 30S RIBOSOMAL SUBUNIT PROTEIN S19 [... 38 0.048
gi|50255403|gb|EAL18138.1| hypothetical protein CNBK1590 [Crypto... 38 0.048
gi|27364211|ref|NP_759739.1| Ribosomal protein S19 [Vibrio vulni... 37 0.063
gi|39936309|ref|NP_948585.1| 30S ribosomal protein S19 [Rhodopse... 37 0.063
gi|15617114|ref|NP_240327.1| 30S ribosomal protein S19 [Buchnera... 37 0.063
gi|49235629|ref|ZP_00329696.1| COG0185: Ribosomal protein S19 [M... 37 0.063
gi|15925236|ref|NP_372770.1| 30S ribosomal protein S19 [Staphylo... 37 0.063
gi|50086211|ref|YP_047721.1| 30S ribosomal protein S19 [Acinetob... 37 0.063
gi|24371833|ref|NP_715875.1| ribosomal protein S19 [Shewanella o... 37 0.063
gi|49475790|ref|YP_033831.1| 30S ribosomal protein s19 [Bartonel... 37 0.063
gi|27468738|ref|NP_765375.1| 30S ribosomal protein S19 [Staphylo... 37 0.063
gi|15793006|ref|NP_282829.1| 30S ribosomal protein S19 [Campylob... 37 0.063
gi|49474400|ref|YP_032442.1| 30s ribosomal protein s19 [Bartonel... 37 0.063
gi|11467775|ref|NP_050826.1| ribosomal protein S19 [Nephroselmis... 37 0.082
gi|133845|sp|P12731|RS19_BACST 30S ribosomal protein S19 (BS19) ... 37 0.082
gi|437927|emb|CAA79781.1| ribosomal protein S19 [Thermotoga mari... 37 0.082
gi|27380507|ref|NP_772036.1| 30S ribosomal protein S19 [Bradyrhi... 37 0.082
gi|45525162|ref|ZP_00176408.1| COG0185: Ribosomal protein S19 [C... 37 0.082
gi|37528539|ref|NP_931884.1| 30S ribosomal protein S19 [Photorha... 37 0.082
gi|14017612|ref|NP_114298.1| ribosomal protein S19 [Triticum aes... 37 0.082
gi|50876017|emb|CAG35857.1| probable 30S ribosomal protein S19 [... 37 0.082
gi|15889238|ref|NP_354919.1| AGR_C_3549p [Agrobacterium tumefaci... 37 0.082
gi|48871252|ref|ZP_00323968.1| COG0185: Ribosomal protein S19 [P... 37 0.082
gi|22417465|ref|NP_039466.2| ribosomal protein S19 [Oryza sativa... 37 0.082
gi|46202026|ref|ZP_00053921.2| COG0185: Ribosomal protein S19 [M... 37 0.082
gi|1334371|emb|CAA31702.1| rps 19 [Secale cereale] 37 0.082
gi|1213601|emb|CAA33927.1| ribosomal protein S19 [Oryza sativa (... 37 0.082
gi|11465873|ref|NP_066422.1| ribosomal protein S19 [Ochromonas d... 37 0.11
gi|48855317|ref|ZP_00309476.1| COG0185: Ribosomal protein S19 [C... 37 0.11
gi|37520473|ref|NP_923850.1| 30S ribosomal protein S19 [Gloeobac... 37 0.11
gi|50843314|ref|YP_056541.1| 30S ribosomal protein S19 [Propioni... 37 0.11
gi|31340407|sp|Q8D208|RS19_WIGBR 30S ribosomal protein S19 37 0.11
gi|34500954|ref|NP_904139.1| ribosomal protein S19 [Amborella tr... 37 0.11
gi|7524929|ref|NP_045931.1| ribosomal protein S19 [Chlorella vul... 37 0.11
gi|48835051|ref|ZP_00292053.1| COG0185: Ribosomal protein S19 [T... 37 0.11
gi|39997945|ref|NP_953896.1| ribosomal protein S19 [Geobacter su... 37 0.11
gi|29831473|ref|NP_826107.1| putative ribosomal protein S19 [Str... 37 0.11
gi|32491296|ref|NP_871550.1| rpsS [Wigglesworthia glossinidia en... 37 0.11
gi|28493517|ref|NP_787678.1| 30S ribosomal protein S19 [Trophery... 36 0.14
gi|11466314|ref|NP_051142.1| ribosomal protein S19 [Cafeteria ro... 36 0.14
gi|11467467|ref|NP_043613.1| ribosomal protein S19 [Odontella si... 36 0.14
gi|225916|prf||1403295A ribosomal protein S19 36 0.14
gi|28572371|ref|NP_789151.1| 30s ribosomal protein s19 [Trophery... 36 0.14
gi|21223086|ref|NP_628865.1| 30S ribosomal protein S19 [Streptom... 36 0.14
gi|417739|sp|P27527|RT19_PETHY Mitochondrial ribosomal protein S... 36 0.14
gi|32475062|ref|NP_868056.1| ribosomal protein S19 [Pirellula sp... 36 0.14
gi|23306477|gb|AAM08939.1| 50S ribosomal protein S19 [Mycoplasma... 36 0.14
gi|42520526|ref|NP_966441.1| ribosomal protein S19 [Wolbachia en... 36 0.14
gi|15150732|ref|NP_150398.1| ribosomal protein S19 [Pylaiella li... 36 0.18
gi|18311383|ref|NP_563317.1| 30S ribosomal protein S19 [Clostrid... 36 0.18
gi|28202213|ref|NP_777454.1| ribosomal protein S19 [Anthoceros f... 36 0.18
gi|21672766|ref|NP_660833.1| 30S ribosomal protein S19 [Buchnera... 35 0.24
gi|23112031|ref|ZP_00097576.1| COG0185: Ribosomal protein S19 [D... 35 0.24
gi|16120551|ref|NP_403864.1| 30S ribosomal protein S19 [Yersinia... 35 0.24
gi|16125501|ref|NP_420065.1| ribosomal protein S19 [Caulobacter ... 35 0.24
gi|30248422|ref|NP_840492.1| Ribosomal protein S19 [Nitrosomonas... 35 0.31
gi|48728507|ref|ZP_00262265.1| COG0185: Ribosomal protein S19 [P... 35 0.31
gi|7440504|pir||S72466 ribosomal protein S19 - potato chloroplas... 35 0.31
gi|11465997|ref|NP_054539.1| ribosomal protein S19 [Nicotiana ta... 35 0.31
gi|225237|prf||1211235BV ribosomal protein S19 35 0.31
gi|11466659|ref|NP_066342.1| ribosomal protein S19 [Malawimonas ... 35 0.31
gi|14133979|gb|AAK54197.1| ribosomal protein S19 [Populus deltoi... 35 0.31
gi|15829055|ref|NP_326415.1| 30S RIBOSOMAL PROTEIN S19 [Mycoplas... 35 0.31
gi|49147179|ref|YP_025772.1| ribosomal protein S19 [Pseudendoclo... 35 0.31
gi|50122947|ref|YP_052114.1| 30S ribosomal subunit protein S19 [... 35 0.31
gi|16762847|ref|NP_458464.1| 30S ribosomal subunit protein S19 [... 35 0.31
gi|15803843|ref|NP_289877.1| 30S ribosomal subunit protein S19 [... 35 0.41
gi|34501445|ref|NP_904232.1| ribosomal protein S19 [Physcomitrel... 35 0.41
gi|22995911|ref|ZP_00040198.1| COG0185: Ribosomal protein S19 [X... 35 0.41
gi|11467232|ref|NP_043064.1| ribosomal protein S19 [Zea mays] >g... 35 0.41
gi|50261291|ref|YP_052899.1| ribosomal protein S19 [Saprolegnia ... 35 0.41
gi|48765740|ref|ZP_00270290.1| COG0185: Ribosomal protein S19 [R... 35 0.41
gi|39938690|ref|NP_950456.1| ribosomal protein S19 [Onion yellow... 35 0.41
gi|33357896|pdb|1P6G|S Chain S, Real Space Refined Coordinates O... 35 0.41
gi|11466367|ref|NP_038370.1| ribosomal protein S19 [Mesostigma v... 34 0.53
gi|13518374|ref|NP_084733.1| ribosomal protein S19 [Oenothera el... 34 0.53
gi|11466970|ref|NP_054391.1| ribosomal protein S19 [Epifagus vir... 34 0.53
gi|18860352|ref|NP_569669.1| ribosomal protein S19 [Psilotum nud... 34 0.53
gi|13518297|ref|NP_077750.1| ribosomal protein S19 [Spinacia ole... 34 0.69
gi|29336767|sp|Q8LUX2|RR19_PHAAN Chloroplast 30S ribosomal prote... 34 0.69
gi|23010685|ref|ZP_00051290.1| COG0185: Ribosomal protein S19 [M... 34 0.69
gi|34764034|ref|ZP_00144920.1| SSU ribosomal protein S19P [Fusob... 34 0.69
gi|133865|sp|P11256|RS19_YERPS 30S ribosomal protein S19 >gnl|BL... 34 0.69
gi|9758064|dbj|BAB08643.1| unnamed protein product [Arabidopsis ... 34 0.69
gi|13518477|ref|NP_084836.1| ribosomal protein S19 [Lotus cornic... 33 0.91
gi|7524994|ref|NP_050092.1| ribosomal protein S19 [Dictyostelium... 33 0.91
gi|20140027|sp|Q36570|RR19_NICBI Chloroplast 30S ribosomal prote... 33 0.91
gi|38233089|ref|NP_938856.1| 30S ribosomal protein S19 [Coryneba... 33 0.91
gi|133860|sp|P07816|RR19_SOYBN Chloroplast 30S ribosomal protein... 33 0.91
gi|46446050|ref|YP_007415.1| probable 30S ribosomal protein S19 ... 33 0.91
gi|6094135|sp|O62953|RR19_PICAB Chloroplast 30S ribosomal protei... 33 1.2
gi|7524695|ref|NP_042449.1| ribosomal protein S19 [Pinus thunber... 33 1.2
gi|19551750|ref|NP_599752.1| ribosomal protein S19 [Corynebacter... 33 1.2
gi|12545436|ref|NP_074986.1| ribosomal protein S19 [Euglena long... 33 1.2
gi|27904938|ref|NP_778064.1| S19 ribosomal protein [Buchnera aph... 33 1.5
gi|31442367|ref|NP_852624.1| ribosomal protein S19 [Eimeria tene... 33 1.5
gi|15607845|ref|NP_215219.1| rpsS [Mycobacterium tuberculosis H3... 33 1.5
gi|486979|pir||S36895 ribosomal protein S19 - Mycobacterium bovi... 33 1.5
gi|17222569|gb|AAL36742.1| ribosomal protein S19 [Mesostigma vir... 33 1.5
gi|50346824|ref|YP_053195.1| ribosomal protein S19 [Nymphaea alb... 32 2.0
gi|15827998|ref|NP_302261.1| 30S ribosomal protein S19 [Mycobact... 32 2.0
gi|41410263|ref|NP_963099.1| RpsS [Mycobacterium avium subsp. pa... 32 2.0
gi|20139987|sp|O98453|RR19_SPIMX Chloroplast 30S ribosomal prote... 32 2.0
gi|11466744|ref|NP_039340.1| ribosomal protein S19 [Marchantia p... 32 2.0
gi|46364488|ref|ZP_00227103.1| COG0185: Ribosomal protein S19 [K... 32 2.6
gi|23336505|ref|ZP_00121719.1| COG0185: Ribosomal protein S19 [B... 32 2.6
gi|49574621|ref|NP_848100.2| ribosomal protein S19 [Adiantum cap... 32 2.6
gi|46126817|ref|XP_387962.1| hypothetical protein FG07786.1 [Gib... 32 2.6
gi|34911296|ref|NP_916995.1| P0519D04.17 [Oryza sativa (japonica... 32 3.4
gi|50546040|ref|XP_500551.1| hypothetical protein [Yarrowia lipo... 32 3.4
gi|45685355|gb|AAS75435.1| major plasma protein 30K [Bombyx mori] 32 3.4
gi|46139169|ref|XP_391275.1| hypothetical protein FG11099.1 [Gib... 32 3.4
gi|34875035|ref|XP_344408.1| similar to Zinc finger protein 409 ... 32 3.4
gi|29565654|ref|NP_817234.1| ribosomal protein S19 [Pinus koraie... 32 3.4
gi|50553832|ref|XP_504327.1| hypothetical protein [Yarrowia lipo... 32 3.4
gi|39998396|ref|NP_954347.1| histidyl-tRNA synthetase, putative ... 31 4.5
gi|48832958|ref|ZP_00289984.1| COG0841: Cation/multidrug efflux ... 31 4.5
gi|22997784|ref|ZP_00042011.1| COG0520: Selenocysteine lyase [Xy... 31 5.9
gi|47524173|ref|NP_002002.3| fibroblast growth factor receptor 4... 31 5.9
gi|476558|pir||TVHUF4 fibroblast growth factor receptor 4 precur... 31 5.9
gi|7525073|ref|NP_051098.1| ribosomal protein S19 [Arabidopsis t... 31 5.9
gi|47524177|ref|NP_075252.2| fibroblast growth factor receptor 4... 31 5.9
gi|49072314|ref|XP_400446.1| hypothetical protein UM02831.1 [Ust... 31 5.9
gi|50760898|ref|XP_418173.1| PREDICTED: similar to Fibrillin 2 p... 30 7.7
gi|15237953|ref|NP_197239.1| WD-40 repeat family protein [Arabid... 30 7.7
gi|50802441|ref|XP_428606.1| PREDICTED: similar to Williams-Beur... 30 7.7
>gi|17508693|ref|NP_492384.1| ribosomal Protein, Small subunit (17.2
kD) (rps-15) [Caenorhabditis elegans]
gi|7500585|pir||T21828 hypothetical protein F36A2.6 -
Caenorhabditis elegans
gi|3876773|emb|CAB03065.1| C. elegans RPS-15 protein (corresponding
sequence F36A2.6) [Caenorhabditis elegans]
Length = 151
Score = 236 bits (601), Expect = 9e-62
Identities = 124/151 (82%), Positives = 124/151 (82%)
Frame = -1
Query: 456 MATQDDAHLAELKKKRTFRKFMYRGVDLDQLLDMSREQFTKXXXXXXXXXXXXXXXXXXL 277
MATQDDAHLAELKKKRTFRKFMYRGVDLDQLLDMSREQFTK L
Sbjct: 1 MATQDDAHLAELKKKRTFRKFMYRGVDLDQLLDMSREQFTKLLPCRMRRRLDRGLKRKHL 60
Query: 276 ALIXXXXXXXXXAGVLEKPATVKTHLRDMIILPELVGGVIGIYNGKVFNQTEIKPEMIGF 97
ALI AGVLEKPATVKTHLRDMIILPELVGGVIGIYNGKVFNQTEIKPEMIGF
Sbjct: 61 ALIAKVQKAKKAAGVLEKPATVKTHLRDMIILPELVGGVIGIYNGKVFNQTEIKPEMIGF 120
Query: 96 YLGEFAISYKPVKHGRPGIGATHSSRFIPLK 4
YLGEFAISYKPVKHGRPGIGATHSSRFIPLK
Sbjct: 121 YLGEFAISYKPVKHGRPGIGATHSSRFIPLK 151