Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F36F12_5
(672 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17560636|ref|NP_503568.1| c-type lectin precursor family memb... 392 e-108
gi|17560638|ref|NP_503569.1| c-type lectin precursor family memb... 357 9e-98
gi|17511045|ref|NP_492872.1| c-type lectin family member (24.1 k... 158 1e-37
gi|17536965|ref|NP_494446.1| predicted CDS, c-type lectin precur... 157 1e-37
gi|39592416|emb|CAE63493.1| Hypothetical protein CBG07963 [Caeno... 156 3e-37
gi|17536963|ref|NP_494447.1| c-type lectin precursor family memb... 155 7e-37
gi|17511037|ref|NP_492866.1| c-type lectin precursor family memb... 155 9e-37
gi|39580389|emb|CAE70948.1| Hypothetical protein CBG17758 [Caeno... 150 2e-35
gi|17511033|ref|NP_492868.1| c-type lectin precursor family memb... 150 2e-35
gi|17536853|ref|NP_494581.1| predicted CDS, c-type lectin family... 149 5e-35
gi|17511035|ref|NP_492867.1| c-type lectin precursor family memb... 141 1e-32
gi|17536863|ref|NP_494583.1| c-type lectin family member (2D865)... 140 2e-32
gi|17536851|ref|NP_494580.1| predicted CDS, c-type lectin family... 140 2e-32
gi|7506183|pir||T31795 hypothetical protein R02F11.2 - Caenorhab... 139 4e-32
gi|49035134|gb|AAB65898.3| Hypothetical protein R02F11.2 [Caenor... 139 4e-32
gi|32567037|ref|NP_504286.2| protein of unknown function CX and ... 139 4e-32
gi|17509255|ref|NP_493210.1| c-type lectin family member (1N275)... 135 7e-31
gi|17536865|ref|NP_494582.1| c-type lectin family member (2D863)... 133 3e-30
gi|17536855|ref|NP_494584.1| predicted CDS, c-type lectin family... 133 4e-30
gi|17536819|ref|NP_494566.1| c-type lectin family member (2D809)... 132 8e-30
gi|17536861|ref|NP_494585.1| c-type lectin family member (2D867)... 130 2e-29
gi|7511124|pir||T27838 hypothetical protein ZK39.6 - Caenorhabdi... 129 5e-29
gi|17566390|ref|NP_507286.1| predicted CDS, c-type lectin family... 127 2e-28
gi|17566372|ref|NP_507279.1| predicted CDS, c-type lectin precur... 127 3e-28
gi|39592415|emb|CAE63492.1| Hypothetical protein CBG07961 [Caeno... 126 3e-28
gi|17511043|ref|NP_492871.1| chondroitin sulfate proteoglycan 3 ... 125 6e-28
gi|17511039|ref|NP_492869.1| c-type lectin precursor family memb... 125 8e-28
gi|17536859|ref|NP_494586.1| predicted CDS, c-type lectin precur... 125 1e-27
gi|17561202|ref|NP_507305.1| predicted CDS, low affinity IgE Fc ... 123 3e-27
gi|17536817|ref|NP_494567.1| c-type lectin family member (18.2 k... 123 3e-27
gi|38422741|emb|CAA20959.2| Hypothetical protein Y102A5C.16 [Cae... 122 5e-27
gi|39581940|emb|CAE73802.1| Hypothetical protein CBG21352 [Caeno... 122 8e-27
gi|17561204|ref|NP_507306.1| predicted CDS, low affinity IgE Fc ... 120 3e-26
gi|17558364|ref|NP_507555.1| predicted CDS, c-type lectin family... 117 2e-25
gi|39580385|emb|CAE70944.1| Hypothetical protein CBG17752 [Caeno... 117 2e-25
gi|17560214|ref|NP_507154.1| predicted CDS, c-type lectin precur... 114 1e-24
gi|17536551|ref|NP_496528.1| c-type lectin precursor family memb... 113 4e-24
gi|17566388|ref|NP_507288.1| c-type lectin precursor family memb... 113 4e-24
gi|39581941|emb|CAE73803.1| Hypothetical protein CBG21353 [Caeno... 110 2e-23
gi|39580386|emb|CAE70945.1| Hypothetical protein CBG17754 [Caeno... 110 3e-23
gi|17565940|ref|NP_507577.1| predicted CDS, putative protein fam... 107 2e-22
gi|17560612|ref|NP_507185.1| predicted CDS, putative secreted or... 107 3e-22
gi|39580387|emb|CAE70946.1| Hypothetical protein CBG17755 [Caeno... 106 5e-22
gi|17559778|ref|NP_507556.1| killer cell like family member (5S6... 104 1e-21
gi|39595684|emb|CAE67187.1| Hypothetical protein CBG12623 [Caeno... 101 2e-20
gi|17566178|ref|NP_507369.1| predicted CDS, c-type lectin family... 100 3e-20
gi|39580388|emb|CAE70947.1| Hypothetical protein CBG17757 [Caeno... 100 4e-20
gi|39592429|emb|CAE63506.1| Hypothetical protein CBG07983 [Caeno... 99 6e-20
gi|17510251|ref|NP_492880.1| predicted CDS, c-type lectin precur... 98 2e-19
gi|39592448|emb|CAE63525.1| Hypothetical protein CBG08004 [Caeno... 98 2e-19
gi|17536719|ref|NP_493771.1| c-type lectin family member (2A900)... 97 2e-19
gi|17566176|ref|NP_507370.1| predicted CDS, c-type lectin family... 96 6e-19
gi|17510207|ref|NP_492857.1| c-type lectin family member (1L607)... 94 2e-18
gi|39592447|emb|CAE63524.1| Hypothetical protein CBG08003 [Caeno... 94 3e-18
gi|17509827|ref|NP_493289.1| c-type lectin precursor family memb... 92 7e-18
gi|25395485|pir||C88102 protein W09G10.6 [imported] - Caenorhabd... 91 2e-17
gi|39590393|emb|CAE66132.1| Hypothetical protein CBG11356 [Caeno... 90 4e-17
gi|17539324|ref|NP_503089.1| putative protein family member, wit... 87 2e-16
gi|39590141|emb|CAE61139.1| Hypothetical protein CBG04901 [Caeno... 87 3e-16
gi|39580384|emb|CAE70943.1| Hypothetical protein CBG17751 [Caeno... 87 3e-16
gi|39592405|emb|CAE63482.1| Hypothetical protein CBG07950 [Caeno... 87 4e-16
gi|39592428|emb|CAE63505.1| Hypothetical protein CBG07982 [Caeno... 86 5e-16
gi|17544386|ref|NP_502991.1| c-type lectin precursor family memb... 85 1e-15
gi|17509731|ref|NP_493248.1| c-type lectin precursor family memb... 85 1e-15
gi|39590136|emb|CAE61134.1| Hypothetical protein CBG04895 [Caeno... 84 2e-15
gi|17565896|ref|NP_503376.1| predicted CDS, c-type lectin family... 84 3e-15
gi|17509735|ref|NP_493250.1| c-type lectin precursor family memb... 83 4e-15
gi|39590134|emb|CAE61132.1| Hypothetical protein CBG04893 [Caeno... 83 6e-15
gi|39580588|emb|CAE70484.1| Hypothetical protein CBG17079 [Caeno... 82 7e-15
gi|33300606|emb|CAE17978.1| Hypothetical protein Y18D10A.24 [Cae... 81 2e-14
gi|17560038|ref|NP_507097.1| c-type lectin family member (5Q715)... 80 4e-14
gi|17506689|ref|NP_493310.1| putative protein family member (1N7... 78 2e-13
gi|39590137|emb|CAE61135.1| Hypothetical protein CBG04896 [Caeno... 77 4e-13
gi|17506687|ref|NP_493309.1| predicted CDS, acyltransferase 3 fa... 77 4e-13
gi|17566540|ref|NP_507917.1| predicted CDS, putative protein fam... 76 5e-13
gi|39580257|emb|CAE69649.1| Hypothetical protein CBG15894 [Caeno... 76 5e-13
gi|39585190|emb|CAE57433.1| Hypothetical protein CBG00394 [Caeno... 75 9e-13
gi|39590135|emb|CAE61133.1| Hypothetical protein CBG04894 [Caeno... 75 9e-13
gi|39585189|emb|CAE57432.1| Hypothetical protein CBG00393 [Caeno... 75 9e-13
gi|17553182|ref|NP_498002.1| c-type lectin family member (3F932)... 74 2e-12
gi|39590099|emb|CAE61097.1| Hypothetical protein CBG04852 [Caeno... 74 3e-12
gi|17559102|ref|NP_505754.1| predicted CDS, c-type lectin family... 74 3e-12
gi|39591539|emb|CAE71115.1| Hypothetical protein CBG17968 [Caeno... 73 6e-12
gi|39591538|emb|CAE71114.1| Hypothetical protein CBG17967 [Caeno... 73 6e-12
gi|39592446|emb|CAE63523.1| Hypothetical protein CBG08002 [Caeno... 72 8e-12
gi|39590138|emb|CAE61136.1| Hypothetical protein CBG04897 [Caeno... 72 1e-11
gi|17510429|ref|NP_493430.1| predicted CDS, c-type lectin family... 72 1e-11
gi|17566546|ref|NP_507913.1| c-type lectin precursor family memb... 72 1e-11
gi|17539326|ref|NP_503090.1| versican family member, possibly N-... 71 2e-11
gi|17560662|ref|NP_507006.1| c-type lectin family member (5Q453)... 71 2e-11
gi|39579666|emb|CAE56464.1| Hypothetical protein CBG24174 [Caeno... 68 1e-10
gi|39591537|emb|CAE71113.1| Hypothetical protein CBG17966 [Caeno... 66 5e-10
gi|17566100|ref|NP_507868.1| c-type lectin family member (5U452)... 65 1e-09
gi|39590447|emb|CAE66187.1| Hypothetical protein CBG11425 [Caeno... 63 5e-09
gi|17544382|ref|NP_502990.1| predicted CDS, c-type lectin family... 62 8e-09
gi|7497627|pir||T20046 hypothetical protein C49A1.9 - Caenorhabd... 62 1e-08
gi|17506151|ref|NP_493484.1| predicted CDS, putative protein fam... 62 1e-08
gi|17562684|ref|NP_507837.1| putative protein family member (5U2... 62 1e-08
gi|39590140|emb|CAE61138.1| Hypothetical protein CBG04899 [Caeno... 61 2e-08
gi|17565952|ref|NP_507583.1| c-type lectin precursor family memb... 60 3e-08
gi|17531917|ref|NP_494490.1| putative protein family member (2D5... 59 9e-08
gi|17553180|ref|NP_498001.1| predicted CDS, c-type lectin family... 59 1e-07
gi|39590143|emb|CAE61141.1| Hypothetical protein CBG04903 [Caeno... 58 1e-07
gi|39589078|emb|CAE57810.1| Hypothetical protein CBG00834 [Caeno... 58 1e-07
gi|17511041|ref|NP_492870.1| putative secreted or extracellular ... 58 1e-07
gi|17542442|ref|NP_501639.1| putative protein (4K93) [Caenorhabd... 58 2e-07
gi|17559100|ref|NP_505753.1| putative protein family member (5L2... 58 2e-07
gi|17510431|ref|NP_493431.1| putative endoplasmic reticulum prot... 57 3e-07
gi|39591912|emb|CAE75132.1| Hypothetical protein CBG23060 [Caeno... 56 6e-07
gi|17508069|ref|NP_493489.1| c-type lectin family member (1O843)... 56 6e-07
gi|17544394|ref|NP_502996.1| c-type lectin family member (4R777)... 56 6e-07
gi|17540278|ref|NP_502932.1| predicted CDS, c-type lectin family... 54 2e-06
gi|17539148|ref|NP_501134.1| c-type lectin family member (4H948)... 54 3e-06
gi|39583006|emb|CAE71785.1| Hypothetical protein CBG18789 [Caeno... 54 4e-06
gi|17553034|ref|NP_497946.1| c-type lectin precursor family memb... 53 5e-06
gi|17553030|ref|NP_497945.1| c-type lectin family member (3F723)... 53 6e-06
gi|39579641|emb|CAE56640.1| Hypothetical protein CBG24401 [Caeno... 53 6e-06
gi|33300499|emb|CAE18002.1| Hypothetical protein Y51A2A.11 [Caen... 50 4e-05
gi|39579554|emb|CAE56072.1| Hypothetical protein CBG23650 [Caeno... 50 4e-05
gi|17507421|ref|NP_493450.1| putative protein family member (1O6... 50 5e-05
gi|39583395|emb|CAE66370.1| Hypothetical protein CBG11629 [Caeno... 49 1e-04
gi|17544442|ref|NP_503021.1| predicted CDS, putative protein fam... 48 2e-04
gi|17559816|ref|NP_505795.1| c-type lectin precursor family memb... 48 2e-04
gi|39583394|emb|CAE66369.1| Hypothetical protein CBG11628 [Caeno... 48 2e-04
gi|17554888|ref|NP_497956.1| predicted CDS, c-type lectin family... 47 3e-04
gi|17506693|ref|NP_493312.1| putative protein family member (1N7... 47 3e-04
gi|39587016|emb|CAE62951.1| Hypothetical protein CBG07164 [Caeno... 45 0.001
gi|17557544|ref|NP_505863.1| putative protein family member (5L7... 45 0.002
gi|17538258|ref|NP_501369.1| mannose receptor C type family memb... 44 0.002
gi|32697984|emb|CAB02800.2| Hypothetical protein C29F3.4 [Caenor... 44 0.002
gi|17563062|ref|NP_506460.1| predicted CDS, putative protein fam... 44 0.003
gi|17543488|ref|NP_500445.1| c-type lectin family member (65.9 k... 44 0.003
gi|17541614|ref|NP_502826.1| putative secreted or extracellular ... 44 0.004
gi|17540466|ref|NP_500450.1| c-type lectin family member (65.9 k... 43 0.005
gi|17562694|ref|NP_507835.1| putative protein (5U249) [Caenorhab... 43 0.005
gi|17561852|ref|NP_506804.1| predicted CDS, c-type lectin family... 42 0.008
gi|17558760|ref|NP_504967.1| predicted CDS, putative cytoplasmic... 42 0.011
gi|39591989|emb|CAE75209.1| Hypothetical protein CBG23156 [Caeno... 42 0.011
gi|17565266|ref|NP_507666.1| predicted CDS, c-type lectin family... 42 0.014
gi|17553032|ref|NP_497944.1| predicted CDS, c-type lectin family... 42 0.014
gi|33300312|emb|CAE17891.1| Hypothetical protein M199.6 [Caenorh... 42 0.014
gi|39582517|emb|CAE65604.1| Hypothetical protein CBG10625 [Caeno... 41 0.019
gi|39580256|emb|CAE69648.1| Hypothetical protein CBG15893 [Caeno... 41 0.019
gi|47225069|emb|CAF97484.1| unnamed protein product [Tetraodon n... 40 0.032
gi|39580171|emb|CAE56379.1| Hypothetical protein CBG24059 [Caeno... 40 0.042
gi|39587015|emb|CAE62950.1| Hypothetical protein CBG07163 [Caeno... 40 0.042
gi|17506147|ref|NP_493487.1| predicted CDS, putative protein fam... 40 0.054
gi|17565950|ref|NP_507582.1| predicted CDS, putative protein fam... 39 0.071
gi|17558310|ref|NP_506808.1| c-type lectin precursor family memb... 39 0.093
gi|39580589|emb|CAE70485.1| Hypothetical protein CBG17082 [Caeno... 39 0.093
gi|47216660|emb|CAG04858.1| unnamed protein product [Tetraodon n... 39 0.12
gi|39584131|emb|CAE61506.1| Hypothetical protein CBG05405 [Caeno... 39 0.12
gi|39590706|emb|CAE65076.1| Hypothetical protein CBG09931 [Caeno... 39 0.12
gi|17539582|ref|NP_500691.1| predicted CDS, putative protein fam... 38 0.16
gi|33243074|gb|AAQ01207.1| C-type lectin CTL-2 [Bitis arietans] 38 0.16
gi|39581281|emb|CAE60027.1| Hypothetical protein CBG03533 [Caeno... 38 0.21
gi|47214539|emb|CAG04559.1| unnamed protein product [Tetraodon n... 38 0.21
gi|34864835|ref|XP_217657.2| similar to bA338L11.1 (novel CUB do... 37 0.27
gi|47219432|emb|CAG10796.1| unnamed protein product [Tetraodon n... 37 0.27
gi|39579884|emb|CAE56620.1| Hypothetical protein CBG24376 [Caeno... 37 0.27
gi|39582793|emb|CAE74256.1| Hypothetical protein CBG21945 [Caeno... 37 0.46
gi|17531337|ref|NP_493698.1| c-type lectin precursor family memb... 36 0.60
gi|39588191|emb|CAE68116.1| Hypothetical protein CBG13759 [Caeno... 36 0.79
gi|17539578|ref|NP_500693.1| predicted CDS, putative nuclear pro... 35 1.0
gi|17565058|ref|NP_507829.1| versican precursor family member (3... 35 1.3
gi|17508839|ref|NP_491247.1| mannose receptor C type family memb... 35 1.3
gi|17543706|ref|NP_499975.1| c-type lectin family member (4B469)... 35 1.3
gi|20977545|ref|NP_624360.1| chondrolectin [Mus musculus] >gnl|B... 35 1.3
gi|42526246|ref|NP_971344.1| hypothetical protein TDE0732 [Trepo... 35 1.8
gi|4505245|ref|NP_002429.1| mannose receptor C type 1 precursor;... 35 1.8
gi|17559330|ref|NP_504977.1| c-type lectin precursor family memb... 35 1.8
gi|17544698|ref|NP_502451.1| phospholipase A2 receptor precursor... 35 1.8
gi|17558312|ref|NP_506807.1| c-type lectin family member (5P828)... 34 2.3
gi|17540122|ref|NP_501229.1| c-type lectin superfamily like (4I3... 34 2.3
gi|48844058|ref|ZP_00298400.1| COG1804: Predicted acyl-CoA trans... 34 2.3
gi|33243092|gb|AAQ01216.1| C-type lectin CTL-27 [Echis ocellatus] 34 2.3
gi|25396647|pir||H88733 protein F32E10.3 [imported] - Caenorhabd... 34 2.3
gi|26326981|dbj|BAC27234.1| unnamed protein product [Mus musculus] 34 3.0
gi|26345454|dbj|BAC36378.1| unnamed protein product [Mus musculus] 34 3.0
gi|1083928|pir||JP0075 lectin CEL-IV, C-type - Cucumaria echinat... 34 3.0
gi|27670608|ref|XP_221686.1| similar to c-type lectin protein MT... 34 3.0
gi|12851982|dbj|BAB29226.1| unnamed protein product [Mus musculus] 34 3.0
gi|17557916|ref|NP_507547.1| versican precursor family member (5... 33 3.9
gi|47219898|emb|CAF97168.1| unnamed protein product [Tetraodon n... 33 3.9
gi|17539972|ref|NP_502157.1| predicted CDS, putative protein fam... 33 3.9
gi|37182231|gb|AAQ88918.1| RPGT208 [Homo sapiens] 33 3.9
gi|39581146|emb|CAE71003.1| Hypothetical protein CBG17839 [Caeno... 33 3.9
gi|17559882|ref|NP_504948.1| predicted CDS, putative protein (5I... 33 3.9
gi|19263589|gb|AAH25407.1| Layilin [Homo sapiens] 33 3.9
gi|16550435|dbj|BAB70978.1| unnamed protein product [Homo sapiens] 33 3.9
gi|30520331|ref|NP_849156.1| layilin [Homo sapiens] >gnl|BL_ORD_... 33 3.9
gi|39579486|emb|CAE56876.1| Hypothetical protein CBG24712 [Caeno... 33 3.9
gi|37993395|gb|AAR06853.1| C-type lectin-3 [Bitis gabonica] 33 3.9
gi|47216228|emb|CAG01262.1| unnamed protein product [Tetraodon n... 33 3.9
gi|50729858|ref|XP_416682.1| PREDICTED: similar to Chondrolectin... 33 5.1
gi|45382743|ref|NP_990815.1| hepatic lectin [Gallus gallus] >gnl... 33 5.1
gi|24583858|ref|NP_723732.1| CG31860-PA [Drosophila melanogaster... 33 5.1
gi|39588702|emb|CAE58226.1| Hypothetical protein CBG01323 [Caeno... 33 5.1
gi|39587019|emb|CAE62954.1| Hypothetical protein CBG07168 [Caeno... 33 5.1
gi|6678934|ref|NP_032652.1| mannose receptor, C type 2; novel le... 33 5.1
gi|1839442|gb|AAB47093.1| platelet glycoprotein Ib-binding prote... 33 5.1
gi|50750535|ref|XP_422038.1| PREDICTED: similar to Lymphocyte an... 33 5.1
gi|17539580|ref|NP_500692.1| predicted CDS, putative protein fam... 33 5.1
gi|17532969|ref|NP_494362.1| putative mitochondrial protein (2D6... 33 5.1
gi|17531799|ref|NP_494750.1| putative protein family member (2E5... 33 5.1
gi|17565062|ref|NP_507830.1| proteoglycan precursor family membe... 33 6.7
gi|39587765|emb|CAE67783.1| Hypothetical protein CBG13359 [Caeno... 33 6.7
gi|27734229|sp|P81509|CHBB_CROHO CHH-B beta subunit 33 6.7
gi|10434231|dbj|BAB14181.1| unnamed protein product [Homo sapien... 32 8.7
gi|17557350|ref|NP_506271.1| c-type lectin and CUB domain contai... 32 8.7
gi|32450776|gb|AAP41219.2| echicetin B-chain [Echis carinatus] 32 8.7
gi|40889261|pdb|1OZ7|B Chain B, Crystal Structure Of Echicetin F... 32 8.7
gi|34498980|ref|NP_903195.1| acid phosphatase [Chromobacterium v... 32 8.7
gi|20127636|ref|NP_079220.2| chondrolectin precursor; transmembr... 32 8.7
gi|31075306|gb|AAP43902.1| chondrolectin variant CHODLdeltaE [Ho... 32 8.7
gi|17535979|ref|NP_494826.1| phospholipase a2 receptor precursor... 32 8.7
gi|31075310|gb|AAP43904.1| chondrolectin variant CHODLFdeltaE [H... 32 8.7
gi|46136765|ref|XP_390074.1| hypothetical protein FG09898.1 [Gib... 32 8.7
>gi|17560636|ref|NP_503568.1| c-type lectin precursor family member
(5C575) [Caenorhabditis elegans]
gi|7500629|pir||T33193 hypothetical protein F36F12.5 -
Caenorhabditis elegans
gi|3193173|gb|AAC19204.1| Hypothetical protein F36F12.5
[Caenorhabditis elegans]
Length = 223
Score = 392 bits (1008), Expect = e-108
Identities = 191/213 (89%), Positives = 191/213 (89%)
Frame = +1
Query: 31 STTYGIDFSDSSESCEDXXXXXXXXXXXXXXXXXXXXXXVCDAGWKFFSRPSGGWCIRVF 210
STTYGIDFSDSSESCED VCDAGWKFFSRPSGGWCIRVF
Sbjct: 11 STTYGIDFSDSSESCEDGGRGGHNHGRPPRPPGNGGGGRVCDAGWKFFSRPSGGWCIRVF 70
Query: 211 AGRLGRDSANQACATQGGVLSGMQNVEEINYIVSQSLSVISPARSGGVWVGARRRPACIS 390
AGRLGRDSANQACATQGGVLSGMQNVEEINYIVSQSLSVISPARSGGVWVGARRRPACIS
Sbjct: 71 AGRLGRDSANQACATQGGVLSGMQNVEEINYIVSQSLSVISPARSGGVWVGARRRPACIS 130
Query: 391 SGITATCTKTNSFYWTDNSATGINGMLFTNGEPNNGGVKLDQDCALLTVASTPVVFNKFR 570
SGITATCTKTNSFYWTDNSATGINGMLFTNGEPNNGGVKLDQDCALLTVASTPVVFNKFR
Sbjct: 131 SGITATCTKTNSFYWTDNSATGINGMLFTNGEPNNGGVKLDQDCALLTVASTPVVFNKFR 190
Query: 571 TGQMDDVPCTWQDPTPTADKANKGYVCGKKARR 669
TGQMDDVPCTWQDPTPTADKANKGYVCGKKARR
Sbjct: 191 TGQMDDVPCTWQDPTPTADKANKGYVCGKKARR 223