Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F36F12_6
(672 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17560638|ref|NP_503569.1| c-type lectin precursor family memb... 391 e-108
gi|17560636|ref|NP_503568.1| c-type lectin precursor family memb... 357 9e-98
gi|39592416|emb|CAE63493.1| Hypothetical protein CBG07963 [Caeno... 155 5e-37
gi|17511045|ref|NP_492872.1| c-type lectin family member (24.1 k... 153 3e-36
gi|17536965|ref|NP_494446.1| predicted CDS, c-type lectin precur... 153 3e-36
gi|17536963|ref|NP_494447.1| c-type lectin precursor family memb... 149 6e-35
gi|17511037|ref|NP_492866.1| c-type lectin precursor family memb... 149 6e-35
gi|39580389|emb|CAE70948.1| Hypothetical protein CBG17758 [Caeno... 146 4e-34
gi|17511033|ref|NP_492868.1| c-type lectin precursor family memb... 144 2e-33
gi|17536853|ref|NP_494581.1| predicted CDS, c-type lectin family... 138 1e-31
gi|17511035|ref|NP_492867.1| c-type lectin precursor family memb... 136 3e-31
gi|17536863|ref|NP_494583.1| c-type lectin family member (2D865)... 136 4e-31
gi|7506183|pir||T31795 hypothetical protein R02F11.2 - Caenorhab... 130 2e-29
gi|49035134|gb|AAB65898.3| Hypothetical protein R02F11.2 [Caenor... 130 2e-29
gi|32567037|ref|NP_504286.2| protein of unknown function CX and ... 130 2e-29
gi|17536851|ref|NP_494580.1| predicted CDS, c-type lectin family... 130 2e-29
gi|39581940|emb|CAE73802.1| Hypothetical protein CBG21352 [Caeno... 129 4e-29
gi|17536819|ref|NP_494566.1| c-type lectin family member (2D809)... 129 5e-29
gi|17536861|ref|NP_494585.1| c-type lectin family member (2D867)... 127 2e-28
gi|17536865|ref|NP_494582.1| c-type lectin family member (2D863)... 127 3e-28
gi|17509255|ref|NP_493210.1| c-type lectin family member (1N275)... 125 8e-28
gi|7511124|pir||T27838 hypothetical protein ZK39.6 - Caenorhabdi... 124 2e-27
gi|39592415|emb|CAE63492.1| Hypothetical protein CBG07961 [Caeno... 123 3e-27
gi|17536859|ref|NP_494586.1| predicted CDS, c-type lectin precur... 123 3e-27
gi|17536817|ref|NP_494567.1| c-type lectin family member (18.2 k... 123 4e-27
gi|17536855|ref|NP_494584.1| predicted CDS, c-type lectin family... 122 8e-27
gi|17511043|ref|NP_492871.1| chondroitin sulfate proteoglycan 3 ... 122 8e-27
gi|17561204|ref|NP_507306.1| predicted CDS, low affinity IgE Fc ... 121 1e-26
gi|17566390|ref|NP_507286.1| predicted CDS, c-type lectin family... 119 4e-26
gi|17511039|ref|NP_492869.1| c-type lectin precursor family memb... 119 4e-26
gi|38422741|emb|CAA20959.2| Hypothetical protein Y102A5C.16 [Cae... 119 4e-26
gi|17566372|ref|NP_507279.1| predicted CDS, c-type lectin precur... 119 4e-26
gi|17561202|ref|NP_507305.1| predicted CDS, low affinity IgE Fc ... 119 7e-26
gi|39580385|emb|CAE70944.1| Hypothetical protein CBG17752 [Caeno... 115 8e-25
gi|39581941|emb|CAE73803.1| Hypothetical protein CBG21353 [Caeno... 112 9e-24
gi|17566388|ref|NP_507288.1| c-type lectin precursor family memb... 110 2e-23
gi|17560214|ref|NP_507154.1| predicted CDS, c-type lectin precur... 110 3e-23
gi|17558364|ref|NP_507555.1| predicted CDS, c-type lectin family... 110 3e-23
gi|17565940|ref|NP_507577.1| predicted CDS, putative protein fam... 109 4e-23
gi|17536551|ref|NP_496528.1| c-type lectin precursor family memb... 108 1e-22
gi|17559778|ref|NP_507556.1| killer cell like family member (5S6... 108 1e-22
gi|39580386|emb|CAE70945.1| Hypothetical protein CBG17754 [Caeno... 105 8e-22
gi|39580387|emb|CAE70946.1| Hypothetical protein CBG17755 [Caeno... 103 3e-21
gi|17560612|ref|NP_507185.1| predicted CDS, putative secreted or... 102 7e-21
gi|39595684|emb|CAE67187.1| Hypothetical protein CBG12623 [Caeno... 98 2e-19
gi|17566178|ref|NP_507369.1| predicted CDS, c-type lectin family... 97 4e-19
gi|39592429|emb|CAE63506.1| Hypothetical protein CBG07983 [Caeno... 97 4e-19
gi|39580388|emb|CAE70947.1| Hypothetical protein CBG17757 [Caeno... 96 8e-19
gi|17510251|ref|NP_492880.1| predicted CDS, c-type lectin precur... 96 8e-19
gi|39592448|emb|CAE63525.1| Hypothetical protein CBG08004 [Caeno... 95 1e-18
gi|17510207|ref|NP_492857.1| c-type lectin family member (1L607)... 92 7e-18
gi|17509827|ref|NP_493289.1| c-type lectin precursor family memb... 91 2e-17
gi|17566176|ref|NP_507370.1| predicted CDS, c-type lectin family... 91 2e-17
gi|39592447|emb|CAE63524.1| Hypothetical protein CBG08003 [Caeno... 90 4e-17
gi|17536719|ref|NP_493771.1| c-type lectin family member (2A900)... 89 6e-17
gi|25395485|pir||C88102 protein W09G10.6 [imported] - Caenorhabd... 88 1e-16
gi|39580384|emb|CAE70943.1| Hypothetical protein CBG17751 [Caeno... 87 4e-16
gi|17539324|ref|NP_503089.1| putative protein family member, wit... 85 1e-15
gi|39590393|emb|CAE66132.1| Hypothetical protein CBG11356 [Caeno... 84 2e-15
gi|39590136|emb|CAE61134.1| Hypothetical protein CBG04895 [Caeno... 84 3e-15
gi|39592428|emb|CAE63505.1| Hypothetical protein CBG07982 [Caeno... 84 3e-15
gi|17509735|ref|NP_493250.1| c-type lectin precursor family memb... 84 3e-15
gi|39590141|emb|CAE61139.1| Hypothetical protein CBG04901 [Caeno... 83 4e-15
gi|39590134|emb|CAE61132.1| Hypothetical protein CBG04893 [Caeno... 82 7e-15
gi|17509731|ref|NP_493248.1| c-type lectin precursor family memb... 82 7e-15
gi|39592405|emb|CAE63482.1| Hypothetical protein CBG07950 [Caeno... 82 1e-14
gi|17544386|ref|NP_502991.1| c-type lectin precursor family memb... 81 2e-14
gi|33300606|emb|CAE17978.1| Hypothetical protein Y18D10A.24 [Cae... 81 2e-14
gi|17565896|ref|NP_503376.1| predicted CDS, c-type lectin family... 78 1e-13
gi|17566540|ref|NP_507917.1| predicted CDS, putative protein fam... 78 1e-13
gi|39592446|emb|CAE63523.1| Hypothetical protein CBG08002 [Caeno... 77 2e-13
gi|17506687|ref|NP_493309.1| predicted CDS, acyltransferase 3 fa... 76 5e-13
gi|39580257|emb|CAE69649.1| Hypothetical protein CBG15894 [Caeno... 76 5e-13
gi|39585189|emb|CAE57432.1| Hypothetical protein CBG00393 [Caeno... 75 1e-12
gi|39591539|emb|CAE71115.1| Hypothetical protein CBG17968 [Caeno... 75 2e-12
gi|39591538|emb|CAE71114.1| Hypothetical protein CBG17967 [Caeno... 74 3e-12
gi|17560662|ref|NP_507006.1| c-type lectin family member (5Q453)... 74 3e-12
gi|17566546|ref|NP_507913.1| c-type lectin precursor family memb... 73 4e-12
gi|39590135|emb|CAE61133.1| Hypothetical protein CBG04894 [Caeno... 73 6e-12
gi|39590137|emb|CAE61135.1| Hypothetical protein CBG04896 [Caeno... 72 8e-12
gi|39580588|emb|CAE70484.1| Hypothetical protein CBG17079 [Caeno... 72 8e-12
gi|17560038|ref|NP_507097.1| c-type lectin family member (5Q715)... 72 1e-11
gi|17510429|ref|NP_493430.1| predicted CDS, c-type lectin family... 72 1e-11
gi|17559102|ref|NP_505754.1| predicted CDS, c-type lectin family... 71 2e-11
gi|39590099|emb|CAE61097.1| Hypothetical protein CBG04852 [Caeno... 71 2e-11
gi|39585190|emb|CAE57433.1| Hypothetical protein CBG00394 [Caeno... 70 4e-11
gi|39590138|emb|CAE61136.1| Hypothetical protein CBG04897 [Caeno... 70 5e-11
gi|17506689|ref|NP_493310.1| putative protein family member (1N7... 70 5e-11
gi|39579666|emb|CAE56464.1| Hypothetical protein CBG24174 [Caeno... 67 4e-10
gi|7497627|pir||T20046 hypothetical protein C49A1.9 - Caenorhabd... 65 1e-09
gi|17506151|ref|NP_493484.1| predicted CDS, putative protein fam... 65 1e-09
gi|17539326|ref|NP_503090.1| versican family member, possibly N-... 65 2e-09
gi|39591537|emb|CAE71113.1| Hypothetical protein CBG17966 [Caeno... 64 2e-09
gi|17553182|ref|NP_498002.1| c-type lectin family member (3F932)... 64 3e-09
gi|39590447|emb|CAE66187.1| Hypothetical protein CBG11425 [Caeno... 63 5e-09
gi|17562684|ref|NP_507837.1| putative protein family member (5U2... 63 5e-09
gi|17508069|ref|NP_493489.1| c-type lectin family member (1O843)... 60 3e-08
gi|17565952|ref|NP_507583.1| c-type lectin precursor family memb... 60 3e-08
gi|39589078|emb|CAE57810.1| Hypothetical protein CBG00834 [Caeno... 60 5e-08
gi|17544382|ref|NP_502990.1| predicted CDS, c-type lectin family... 59 1e-07
gi|39590140|emb|CAE61138.1| Hypothetical protein CBG04899 [Caeno... 58 1e-07
gi|39591912|emb|CAE75132.1| Hypothetical protein CBG23060 [Caeno... 57 3e-07
gi|17544394|ref|NP_502996.1| c-type lectin family member (4R777)... 57 3e-07
gi|17511041|ref|NP_492870.1| putative secreted or extracellular ... 57 3e-07
gi|17531917|ref|NP_494490.1| putative protein family member (2D5... 55 3e-07
gi|17510431|ref|NP_493431.1| putative endoplasmic reticulum prot... 57 4e-07
gi|17553180|ref|NP_498001.1| predicted CDS, c-type lectin family... 57 4e-07
gi|17566100|ref|NP_507868.1| c-type lectin family member (5U452)... 57 4e-07
gi|39590143|emb|CAE61141.1| Hypothetical protein CBG04903 [Caeno... 55 2e-06
gi|17559100|ref|NP_505753.1| putative protein family member (5L2... 54 2e-06
gi|17540278|ref|NP_502932.1| predicted CDS, c-type lectin family... 54 4e-06
gi|17558764|ref|NP_504965.1| predicted CDS, putative protein fam... 52 8e-06
gi|17539148|ref|NP_501134.1| c-type lectin family member (4H948)... 52 8e-06
gi|17507421|ref|NP_493450.1| putative protein family member (1O6... 52 8e-06
gi|39579641|emb|CAE56640.1| Hypothetical protein CBG24401 [Caeno... 52 1e-05
gi|39583395|emb|CAE66370.1| Hypothetical protein CBG11629 [Caeno... 51 2e-05
gi|39583006|emb|CAE71785.1| Hypothetical protein CBG18789 [Caeno... 51 2e-05
gi|17542442|ref|NP_501639.1| putative protein (4K93) [Caenorhabd... 51 2e-05
gi|17559816|ref|NP_505795.1| c-type lectin precursor family memb... 49 7e-05
gi|17553030|ref|NP_497945.1| c-type lectin family member (3F723)... 49 9e-05
gi|39583394|emb|CAE66369.1| Hypothetical protein CBG11628 [Caeno... 48 2e-04
gi|39579554|emb|CAE56072.1| Hypothetical protein CBG23650 [Caeno... 48 2e-04
gi|17541614|ref|NP_502826.1| putative secreted or extracellular ... 47 3e-04
gi|17563062|ref|NP_506460.1| predicted CDS, putative protein fam... 47 3e-04
gi|32697984|emb|CAB02800.2| Hypothetical protein C29F3.4 [Caenor... 47 4e-04
gi|33300499|emb|CAE18002.1| Hypothetical protein Y51A2A.11 [Caen... 46 6e-04
gi|17553034|ref|NP_497946.1| c-type lectin precursor family memb... 46 6e-04
gi|39580256|emb|CAE69648.1| Hypothetical protein CBG15893 [Caeno... 46 8e-04
gi|17506693|ref|NP_493312.1| putative protein family member (1N7... 46 8e-04
gi|47216660|emb|CAG04858.1| unnamed protein product [Tetraodon n... 45 0.001
gi|17538258|ref|NP_501369.1| mannose receptor C type family memb... 45 0.002
gi|17557544|ref|NP_505863.1| putative protein family member (5L7... 44 0.004
gi|17544442|ref|NP_503021.1| predicted CDS, putative protein fam... 44 0.004
gi|17558310|ref|NP_506808.1| c-type lectin precursor family memb... 43 0.006
gi|17565266|ref|NP_507666.1| predicted CDS, c-type lectin family... 42 0.014
gi|39581281|emb|CAE60027.1| Hypothetical protein CBG03533 [Caeno... 41 0.019
gi|17558760|ref|NP_504967.1| predicted CDS, putative cytoplasmic... 41 0.019
gi|39582517|emb|CAE65604.1| Hypothetical protein CBG10625 [Caeno... 41 0.024
gi|39591989|emb|CAE75209.1| Hypothetical protein CBG23156 [Caeno... 41 0.024
gi|33300312|emb|CAE17891.1| Hypothetical protein M199.6 [Caenorh... 41 0.024
gi|17554888|ref|NP_497956.1| predicted CDS, c-type lectin family... 40 0.032
gi|17553032|ref|NP_497944.1| predicted CDS, c-type lectin family... 40 0.042
gi|17562694|ref|NP_507835.1| putative protein (5U249) [Caenorhab... 40 0.054
gi|34864835|ref|XP_217657.2| similar to bA338L11.1 (novel CUB do... 39 0.071
gi|17565950|ref|NP_507582.1| predicted CDS, putative protein fam... 39 0.071
gi|39584131|emb|CAE61506.1| Hypothetical protein CBG05405 [Caeno... 39 0.12
gi|39587016|emb|CAE62951.1| Hypothetical protein CBG07164 [Caeno... 39 0.12
gi|29245517|gb|EAA37151.1| GLP_321_10476_7936 [Giardia lamblia A... 39 0.12
gi|39590706|emb|CAE65076.1| Hypothetical protein CBG09931 [Caeno... 38 0.16
gi|33243074|gb|AAQ01207.1| C-type lectin CTL-2 [Bitis arietans] 38 0.16
gi|17539582|ref|NP_500691.1| predicted CDS, putative protein fam... 38 0.21
gi|39580589|emb|CAE70485.1| Hypothetical protein CBG17082 [Caeno... 37 0.35
gi|47550825|ref|NP_999853.1| dermacan [Danio rerio] >gnl|BL_ORD_... 37 0.46
gi|17559882|ref|NP_504948.1| predicted CDS, putative protein (5I... 36 0.60
gi|39588191|emb|CAE68116.1| Hypothetical protein CBG13759 [Caeno... 35 1.0
gi|17506147|ref|NP_493487.1| predicted CDS, putative protein fam... 35 1.0
gi|17561852|ref|NP_506804.1| predicted CDS, c-type lectin family... 35 1.3
gi|50750535|ref|XP_422038.1| PREDICTED: similar to Lymphocyte an... 35 1.3
gi|39582793|emb|CAE74256.1| Hypothetical protein CBG21945 [Caeno... 35 1.8
gi|1083928|pir||JP0075 lectin CEL-IV, C-type - Cucumaria echinat... 35 1.8
gi|10438247|dbj|BAB15207.1| unnamed protein product [Homo sapiens] 34 2.3
gi|39587765|emb|CAE67783.1| Hypothetical protein CBG13359 [Caeno... 34 2.3
gi|34783733|gb|AAH37790.1| NEK1 protein [Homo sapiens] 34 2.3
gi|41872673|ref|NP_036356.1| NIMA (never in mitosis gene a)-rela... 34 2.3
gi|17539578|ref|NP_500693.1| predicted CDS, putative nuclear pro... 34 2.3
gi|15620861|dbj|BAB67794.1| KIAA1901 protein [Homo sapiens] 34 2.3
gi|5360121|gb|AAD42879.1| NY-REN-55 antigen [Homo sapiens] 34 2.3
gi|33243092|gb|AAQ01216.1| C-type lectin CTL-27 [Echis ocellatus] 34 2.3
gi|17565058|ref|NP_507829.1| versican precursor family member (3... 34 3.0
gi|17558312|ref|NP_506807.1| c-type lectin family member (5P828)... 34 3.0
gi|47223609|emb|CAF99218.1| unnamed protein product [Tetraodon n... 34 3.0
gi|45187724|ref|NP_983947.1| ADL149Wp [Eremothecium gossypii] >g... 33 3.9
gi|17508839|ref|NP_491247.1| mannose receptor C type family memb... 33 3.9
gi|39587015|emb|CAE62950.1| Hypothetical protein CBG07163 [Caeno... 33 3.9
gi|17539580|ref|NP_500692.1| predicted CDS, putative protein fam... 33 3.9
gi|39579884|emb|CAE56620.1| Hypothetical protein CBG24376 [Caeno... 33 3.9
gi|48852449|ref|ZP_00306635.1| COG1287: Uncharacterized membrane... 33 5.1
gi|31200327|ref|XP_309111.1| ENSANGP00000005322 [Anopheles gambi... 33 5.1
gi|17543706|ref|NP_499975.1| c-type lectin family member (4B469)... 33 5.1
gi|17565062|ref|NP_507830.1| proteoglycan precursor family membe... 33 6.7
gi|48096824|ref|XP_397537.1| hypothetical protein XP_397537 [Api... 33 6.7
gi|47219432|emb|CAG10796.1| unnamed protein product [Tetraodon n... 33 6.7
gi|17531337|ref|NP_493698.1| c-type lectin precursor family memb... 33 6.7
gi|17557916|ref|NP_507547.1| versican precursor family member (5... 32 8.7
gi|27380480|ref|NP_772009.1| blr5369 [Bradyrhizobium japonicum U... 32 8.7
gi|683778|emb|CAA88374.1| unknown [Saccharomyces cerevisiae] >gn... 32 8.7
gi|17557350|ref|NP_506271.1| c-type lectin and CUB domain contai... 32 8.7
gi|6325245|ref|NP_015313.1| Required for normal pre-rRNA Process... 32 8.7
>gi|17560638|ref|NP_503569.1| c-type lectin precursor family member
(5C577) [Caenorhabditis elegans]
gi|7500630|pir||T33194 hypothetical protein F36F12.6 -
Caenorhabditis elegans
gi|3193174|gb|AAC19205.1| Hypothetical protein F36F12.6
[Caenorhabditis elegans]
Length = 223
Score = 391 bits (1004), Expect = e-108
Identities = 191/213 (89%), Positives = 191/213 (89%)
Frame = +1
Query: 31 STTYGIDFSDSSESCEDXXXXXXXXXXXXXXXXXXXXXXVCDAGWKFFSRPSGGWCIRVF 210
STTYGIDFSDSSESCED VCDAGWKFFSRPSGGWCIRVF
Sbjct: 11 STTYGIDFSDSSESCEDGGRGGHNHGRPPRPPGNGGGGRVCDAGWKFFSRPSGGWCIRVF 70
Query: 211 AGRLGRDSANQVCATHGGVLSGMQNVEEINYIVSQSVRLISPEVSGGVWVGARRRPACIS 390
AGRLGRDSANQVCATHGGVLSGMQNVEEINYIVSQSVRLISPEVSGGVWVGARRRPACIS
Sbjct: 71 AGRLGRDSANQVCATHGGVLSGMQNVEEINYIVSQSVRLISPEVSGGVWVGARRRPACIS 130
Query: 391 SGITATCTKTNSFYWTDISATGINGMLFTDGEPNNGAAALDQDCALLTVASTPLVMNAFR 570
SGITATCTKTNSFYWTDISATGINGMLFTDGEPNNGAAALDQDCALLTVASTPLVMNAFR
Sbjct: 131 SGITATCTKTNSFYWTDISATGINGMLFTDGEPNNGAAALDQDCALLTVASTPLVMNAFR 190
Query: 571 TGQMDDVPCTWQDPRPSSDKANKGYVCGKKARR 669
TGQMDDVPCTWQDPRPSSDKANKGYVCGKKARR
Sbjct: 191 TGQMDDVPCTWQDPRPSSDKANKGYVCGKKARR 223