Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F37C12_5
(459 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17554776|ref|NP_498572.1| ribosomal Protein, Small subunit (1... 243 6e-64
gi|39583701|emb|CAE63805.1| Hypothetical protein CBG08351 [Caeno... 243 6e-64
gi|730633|sp|Q08699|RS14_PODCA 40S RIBOSOMAL PROTEIN S14 >gnl|BL... 208 2e-53
gi|50755035|ref|XP_414593.1| PREDICTED: similar to ribosomal pro... 206 8e-53
gi|15294039|gb|AAK95196.1| 40S ribosomal protein S14 [Ictalurus ... 206 8e-53
gi|5032051|ref|NP_005608.1| ribosomal protein S14; 40S ribosomal... 206 8e-53
gi|12083607|ref|NP_073163.1| ribosomal protein S14 [Rattus norve... 206 1e-52
gi|3097244|emb|CAA69615.1| ribosomal protein S14 [Mus musculus] 205 2e-52
gi|41152464|ref|NP_956320.1| ribosomal protein S14; wu:fa92e08 [... 205 2e-52
gi|28189929|dbj|BAC56579.1| similar to ribosomal protein S14 [Bo... 204 2e-52
gi|50344488|emb|CAH04330.1| S14e ribosomal protein [Dascillus ce... 204 4e-52
gi|7440317|pir||JE0129 ribosomal protein S14 - mouse 203 5e-52
gi|34871013|ref|XP_342914.1| similar to RIKEN cDNA 1810007P19 [R... 202 9e-52
gi|31207303|ref|XP_312618.1| ENSANGP00000015417 [Anopheles gambi... 202 1e-51
gi|31204465|ref|XP_311181.1| ENSANGP00000019074 [Anopheles gambi... 202 1e-51
gi|47935073|gb|AAT39883.1| ribosomal protein S14 [Branchiostoma ... 201 3e-51
gi|4588920|gb|AAD26263.1| ribosomal protein S14 [Stomoxys calcit... 201 3e-51
gi|17975579|ref|NP_524884.1| CG1524-PB [Drosophila melanogaster]... 198 2e-50
gi|17221659|dbj|BAB78484.1| ribosome like protein [Marsupenaeus ... 198 2e-50
gi|1173201|sp|P46295|RS14_CHLRE 40S RIBOSOMAL PROTEIN S14 >gnl|B... 197 4e-50
gi|1350937|sp|P48855|RS14_PROCL 40S RIBOSOMAL PROTEIN S14 >gnl|B... 196 8e-50
gi|46111319|ref|XP_382717.1| RS14_NEUCR 40S ribosomal protein S1... 196 1e-49
gi|15213816|gb|AAK92183.1| ribosomal protein S14 [Spodoptera fru... 194 2e-49
gi|49532930|dbj|BAD26700.1| ribosomal protein S14 [Plutella xylo... 194 4e-49
gi|25070170|ref|XP_128127.3| similar to 40S ribosomal protein S1... 193 5e-49
gi|49116149|gb|AAH72682.1| Unknown (protein for MGC:87895) [Homo... 193 5e-49
gi|32416116|ref|XP_328536.1| 40S RIBOSOMAL PROTEIN S14 (CRP2) [N... 193 7e-49
gi|15227588|ref|NP_181158.1| 40S ribosomal protein S14 (RPS14A) ... 192 9e-49
gi|38346327|emb|CAE02065.2| OJ000126_13.9 [Oryza sativa (japonic... 192 2e-48
gi|38106209|gb|EAA52546.1| hypothetical protein MG05238.4 [Magna... 192 2e-48
gi|49389256|dbj|BAD25218.1| putative ribosomal protein S14 [Oryz... 192 2e-48
gi|49097274|ref|XP_410097.1| RS14_NEUCR 40S ribosomal protein S1... 191 2e-48
gi|131772|sp|P19950|R141_MAIZE 40S RIBOSOMAL PROTEIN S14 (CLONE ... 191 2e-48
gi|15229775|ref|NP_187758.1| 40S ribosomal protein S14 (RPS14B) ... 191 3e-48
gi|23613184|ref|NP_703506.1| 40S ribosomal subunit protein S14, ... 190 6e-48
gi|15231260|ref|NP_190826.1| 40S ribosomal protein S14 (RPS14C) ... 189 8e-48
gi|131773|sp|P19951|R142_MAIZE 40S RIBOSOMAL PROTEIN S14 (CLONE ... 189 1e-47
gi|28436071|gb|AAO41731.1| cytoplasmic ribosomal protein S14 [Br... 189 1e-47
gi|50257365|gb|EAL20074.1| hypothetical protein CNBF4000 [Crypto... 189 1e-47
gi|3122785|sp|O22584|RS14_LUPLU 40S RIBOSOMAL PROTEIN S14 >gnl|B... 188 2e-47
gi|44888985|sp|P19115|RS14_NEUCR 40S ribosomal protein S14 (CRP2... 186 6e-47
gi|14326099|gb|AAK60138.1| ribosomal protein S14 [Schizosaccharo... 183 7e-46
gi|19112529|ref|NP_595737.1| 40s ribosomal protein s14 [Schizosa... 183 7e-46
gi|50549969|ref|XP_502457.1| hypothetical protein [Yarrowia lipo... 182 1e-45
gi|46229846|gb|EAK90664.1| 40S ribosomal protein S14 [Cryptospor... 173 7e-43
gi|133789|sp|P19800|RS14_TRYBB 40S RIBOSOMAL PROTEIN S14 >gnl|BL... 172 1e-42
gi|50303845|ref|XP_451869.1| unnamed protein product [Kluyveromy... 171 2e-42
gi|50427205|ref|XP_462215.1| unnamed protein product [Debaryomyc... 169 1e-41
gi|10383793|ref|NP_009960.2| Ribosomal protein 59 (rp59) of the ... 167 3e-41
gi|45190455|ref|NP_984709.1| AEL152Wp [Eremothecium gossypii] >g... 167 3e-41
gi|547604|emb|CAA54769.1| ribosomal protein rp59 [Saccharomyces ... 167 3e-41
gi|6322270|ref|NP_012344.1| Ribosomal protein 59 (rp59) of the s... 167 3e-41
gi|14326104|gb|AAK60142.1| ribosomal protein S14 [Candida albicans] 167 5e-41
gi|49258830|pdb|1S1H|K Chain K, Structure Of The Ribosomal 80s-E... 166 7e-41
gi|50293435|ref|XP_449129.1| unnamed protein product [Candida gl... 166 9e-41
gi|70946|pir||R5BY59 ribosomal protein S14.e.A, cytosolic - yeas... 164 3e-40
gi|2350992|dbj|BAA22022.1| ribosomal protein S14 [Entamoeba hist... 164 3e-40
gi|50291641|ref|XP_448253.1| unnamed protein product [Candida gl... 164 3e-40
gi|13812056|ref|NP_113191.1| 40S ribosomal protein S14 [Guillard... 164 4e-40
gi|42655932|ref|XP_375696.1| similar to ribosomal protein S14 [H... 162 1e-39
gi|50344490|emb|CAH04331.1| S14e ribosomal protein [Curculio gla... 161 3e-39
gi|17369862|sp|Q9XEK6|RS14_TORRU 40S ribosomal protein S14 >gnl|... 158 2e-38
gi|42491229|dbj|BAD10931.1| ribosomal protein S14 [Trichomonas v... 155 2e-37
gi|23487184|gb|EAA20993.1| ribosomal protein S11, putative [Plas... 152 2e-36
gi|34858662|ref|XP_238285.2| similar to RIKEN cDNA A730011O11 [R... 134 5e-31
gi|14601596|ref|NP_148136.1| 30S ribosomal protein S11 [Aeropyru... 130 4e-30
gi|27363138|gb|AAO11522.1| ribosomal protein S14 [Chlamys farreri] 130 5e-30
gi|18978020|ref|NP_579377.1| SSU ribosomal protein S11P [Pyrococ... 128 2e-29
gi|14520745|ref|NP_126220.1| SSU ribosomal protein S11P [Pyrococ... 127 5e-29
gi|20094909|ref|NP_614756.1| Ribosomal protein S11 [Methanopyrus... 124 4e-28
gi|19173025|ref|NP_597576.1| 40S RIBOSOMAL PROTEIN S14 [Encephal... 124 4e-28
gi|17944494|gb|AAL48136.1| RH04612p [Drosophila melanogaster] 121 3e-27
gi|11499864|ref|NP_071108.1| SSU ribosomal protein S11P (rps11P)... 121 3e-27
gi|45358884|ref|NP_988441.1| SSU ribosomal protein S11 [Methanoc... 119 1e-26
gi|29246338|gb|EAA37938.1| GLP_426_5632_5195 [Giardia lamblia AT... 119 1e-26
gi|2500442|sp|Q29303|RS14_PIG 40S RIBOSOMAL PROTEIN S14 117 4e-26
gi|20089979|ref|NP_616054.1| ribosomal protein S11p [Methanosarc... 117 6e-26
gi|15668363|ref|NP_247159.1| SSU ribosomal protein S11P (rpsK) [... 116 1e-25
gi|15678066|ref|NP_275180.1| ribosomal protein S14 (E.coli S11) ... 116 1e-25
gi|21228259|ref|NP_634181.1| SSU ribosomal protein S11P [Methano... 115 1e-25
gi|15897039|ref|NP_341644.1| SSU ribosomal protein S11AB (rps11A... 115 1e-25
gi|41718748|ref|ZP_00147712.1| COG0100: Ribosomal protein S11 [M... 114 3e-25
gi|48837925|ref|ZP_00294879.1| COG0100: Ribosomal protein S11 [M... 114 5e-25
gi|15922389|ref|NP_378058.1| 135aa long hypothetical 30S ribosom... 113 7e-25
gi|48474601|sp|Q96YV9|RS11_SULTO 30S ribosomal protein S11P 113 7e-25
gi|49072694|ref|XP_400636.1| hypothetical protein UM03021.1 [Ust... 109 1e-23
gi|16082065|ref|NP_394491.1| probable 30S ribosomal protein S11 ... 109 1e-23
gi|730624|sp|P39469|RS11_SULAC 30S RIBOSOMAL PROTEIN S11P >gnl|B... 109 1e-23
gi|14324778|dbj|BAB59705.1| ribosomal protein small subunit S14 ... 108 2e-23
gi|13541395|ref|NP_111083.1| 30S ribosomal protein S11 [Thermopl... 108 2e-23
gi|47117775|sp|Q9HQJ5|RS11_HALN1 30S ribosomal protein S11P >gnl... 108 3e-23
gi|266963|sp|P10788|RS11_HALMA 30S ribosomal protein S11P (HmaS1... 107 4e-23
gi|18313881|ref|NP_560548.1| ribosomal protein S11 [Pyrobaculum ... 107 6e-23
gi|48478293|ref|YP_023999.1| small subunit ribosomal protein S11... 104 4e-22
gi|48851908|ref|ZP_00306102.1| COG0100: Ribosomal protein S11 [F... 100 6e-21
gi|226203|prf||1501255B ribosomal protein S19 100 6e-21
gi|41614865|ref|NP_963363.1| NEQ069 [Nanoarchaeum equitans Kin4-... 99 2e-20
gi|5441523|emb|CAB46816.1| Ribosomal protein S14 [Canis familiaris] 91 6e-18
gi|15790215|ref|NP_280039.1| 30S ribosomal protein S11P; Rps11p ... 89 1e-17
gi|48138016|ref|XP_396845.1| similar to ENSANGP00000019074 [Apis... 77 5e-14
gi|16125520|ref|NP_420084.1| ribosomal protein S11 [Caulobacter ... 72 2e-12
gi|48765721|ref|ZP_00270271.1| COG0100: Ribosomal protein S11 [R... 70 1e-11
gi|2500443|sp|P93377|RS14_TOBAC 40S RIBOSOMAL PROTEIN S14 >gnl|B... 69 1e-11
gi|13470574|ref|NP_102143.1| 30S ribosomal protein S11 [Mesorhiz... 69 2e-11
gi|15674312|ref|NP_268485.1| 30S ribosomal protein S11 [Streptoc... 69 3e-11
gi|39936290|ref|NP_948566.1| 30S ribosomal protein S11 [Rhodopse... 69 3e-11
gi|21909601|ref|NP_663869.1| 30S ribosomal protein S11 [Streptoc... 69 3e-11
gi|19745266|ref|NP_606402.1| 30S ribosomal protein S11 [Streptoc... 69 3e-11
gi|48831568|ref|ZP_00288628.1| COG0100: Ribosomal protein S11 [M... 68 3e-11
gi|23012205|ref|ZP_00052349.1| COG0100: Ribosomal protein S11 [M... 68 3e-11
gi|16762866|ref|NP_458483.1| 30S ribosomal subunit protein S11 [... 68 3e-11
gi|33357888|pdb|1P6G|K Chain K, Real Space Refined Coordinates O... 68 3e-11
gi|16766706|ref|NP_462321.1| 30S ribosomal subunit protein S11 [... 68 3e-11
gi|15965132|ref|NP_385485.1| PROBABLE 30S RIBOSOMAL PROTEIN S11 ... 68 3e-11
gi|15803824|ref|NP_289858.1| 30S ribosomal subunit protein S11 [... 68 3e-11
gi|24380344|ref|NP_722299.1| 30S ribosomal protein S11 [Streptoc... 68 3e-11
gi|48847726|ref|ZP_00301975.1| COG0100: Ribosomal protein S11 [N... 68 4e-11
gi|27380488|ref|NP_772017.1| 30S ribosomal protein S11 [Bradyrhi... 68 4e-11
gi|15603257|ref|NP_246331.1| RpS11 [Pasteurella multocida Pm70] ... 68 4e-11
gi|42630372|ref|ZP_00155916.1| COG0100: Ribosomal protein S11 [H... 68 4e-11
gi|22956570|ref|ZP_00004325.1| COG0100: Ribosomal protein S11 [R... 67 6e-11
gi|33152931|ref|NP_874284.1| 30S ribosomal protein S11 [Haemophi... 67 6e-11
gi|15900171|ref|NP_344775.1| ribosomal protein S11 [Streptococcu... 67 6e-11
gi|32491315|ref|NP_871569.1| rpsK [Wigglesworthia glossinidia en... 67 7e-11
gi|15889219|ref|NP_354900.1| AGR_C_3519p [Agrobacterium tumefaci... 67 7e-11
gi|17987063|ref|NP_539697.1| SSU ribosomal protein S11P [Brucell... 67 7e-11
gi|45684864|ref|ZP_00196294.1| COG0100: Ribosomal protein S11 [M... 67 7e-11
gi|48767825|ref|ZP_00272178.1| COG0100: Ribosomal protein S11 [R... 67 7e-11
gi|16120570|ref|NP_403883.1| 30S ribosomal protein S11 [Yersinia... 67 1e-10
gi|37528521|ref|NP_931866.1| 30S ribosomal protein S11 [Photorha... 67 1e-10
gi|17547714|ref|NP_521116.1| PROBABLE 30S RIBOSOMAL SUBUNIT PROT... 67 1e-10
gi|15617095|ref|NP_240308.1| 30S ribosomal protein S11 [Buchnera... 66 1e-10
gi|49474381|ref|YP_032423.1| 30s ribosomal protein s11 [Bartonel... 66 1e-10
gi|16272742|ref|NP_438960.1| ribosomal protein S11 [Haemophilus ... 66 2e-10
gi|21672747|ref|NP_660814.1| 30S ribosomal protein S11 [Buchnera... 65 2e-10
gi|30918396|sp|P10789|RS11_BACST 30S ribosomal protein S11 (BS11) 65 3e-10
gi|70939|pir||R3BS11 ribosomal protein S11 [validated] - Bacillu... 65 3e-10
gi|15642568|ref|NP_232201.1| ribosomal protein S11 [Vibrio chole... 65 3e-10
gi|23024304|ref|ZP_00063520.1| COG0100: Ribosomal protein S11 [L... 65 4e-10
gi|30248441|ref|NP_840511.1| Ribosomal protein S11 [Nitrosomonas... 64 5e-10
gi|41723131|ref|ZP_00150074.1| COG0100: Ribosomal protein S11 [D... 64 5e-10
gi|33594505|ref|NP_882149.1| 30S ribosomal protein S11 [Bordetel... 64 5e-10
gi|46311187|ref|ZP_00211797.1| COG0100: Ribosomal protein S11 [B... 64 5e-10
gi|48860663|ref|ZP_00314574.1| COG0100: Ribosomal protein S11 [M... 64 6e-10
gi|15594846|ref|NP_212635.1| ribosomal protein S11 (rpsK) [Borre... 64 6e-10
gi|48781569|ref|ZP_00278160.1| COG0100: Ribosomal protein S11 [B... 64 6e-10
gi|46911984|emb|CAG18782.1| putative ribosomal protein S11 [Phot... 64 6e-10
gi|16801817|ref|NP_472085.1| ribosomal protein S11 [Listeria inn... 64 6e-10
gi|47574142|ref|ZP_00244178.1| COG0100: Ribosomal protein S11 [R... 64 6e-10
gi|23474542|ref|ZP_00129835.1| COG0100: Ribosomal protein S11 [D... 64 6e-10
gi|26987218|ref|NP_742643.1| ribosomal protein S11 [Pseudomonas ... 64 6e-10
gi|46164739|ref|ZP_00137730.2| COG0100: Ribosomal protein S11 [P... 64 6e-10
gi|34499617|ref|NP_903832.1| 30S ribosomal protein S11 [Chromoba... 64 8e-10
gi|41690683|ref|ZP_00147215.1| COG0100: Ribosomal protein S11 [P... 64 8e-10
gi|15599436|ref|NP_252930.1| 30S ribosomal protein S11 [Pseudomo... 64 8e-10
gi|46188037|ref|ZP_00205557.1| COG0100: Ribosomal protein S11 [P... 64 8e-10
gi|23003450|ref|ZP_00047112.1| COG0100: Ribosomal protein S11 [L... 64 8e-10
gi|28867877|ref|NP_790496.1| ribosomal protein S11 [Pseudomonas ... 63 1e-09
gi|49475771|ref|YP_033812.1| 30S ribosomal protein s11 [Bartonel... 63 1e-09
gi|21230386|ref|NP_636303.1| 30S ribosomal protein S11 [Xanthomo... 63 1e-09
gi|46446066|ref|YP_007431.1| probable 30S ribosomal protein S11 ... 63 1e-09
gi|15610595|ref|NP_217976.1| rpsK [Mycobacterium tuberculosis H3... 63 1e-09
gi|31794635|ref|NP_857128.1| PROBABLE 30S RIBOSOMAL PROTEIN S11 ... 63 1e-09
gi|50086192|ref|YP_047702.1| 30S ribosomal protein S11 [Acinetob... 63 1e-09
gi|16329918|ref|NP_440646.1| 30S ribosomal protein S11 [Synechoc... 63 1e-09
gi|41410329|ref|NP_963165.1| RpsK [Mycobacterium avium subsp. pa... 62 2e-09
gi|39997925|ref|NP_953876.1| ribosomal protein S11 [Geobacter su... 62 2e-09
gi|22297648|ref|NP_680895.1| 30S ribosomal protein S11 [Thermosy... 62 2e-09
gi|15674051|ref|NP_268226.1| 30S ribosomal protein S11 [Lactococ... 62 2e-09
gi|15605670|ref|NP_213045.1| ribosomal protein S11 [Aquifex aeol... 62 2e-09
gi|4098575|gb|AAD00323.1| ribosomal protein S11 [Xanthomonas cam... 62 2e-09
gi|28377857|ref|NP_784749.1| ribosomal protein S11 [Lactobacillu... 62 3e-09
gi|15644223|ref|NP_229274.1| ribosomal protein S11 [Thermotoga m... 62 3e-09
gi|15828061|ref|NP_302324.1| 30S ribosomal protein S11 [Mycobact... 61 4e-09
gi|15676093|ref|NP_273224.1| 30S ribosomal protein S11 [Neisseri... 61 4e-09
gi|32477617|ref|NP_870611.1| 30S ribosomal protein S11 [Pirellul... 61 4e-09
gi|24371852|ref|NP_715894.1| ribosomal protein S11 [Shewanella o... 61 4e-09
gi|32423694|gb|AAP81237.1| ribosomal protein S11 [Candidatus Por... 61 4e-09
gi|46364467|ref|ZP_00227082.1| COG0100: Ribosomal protein S11 [K... 61 4e-09
gi|48864997|ref|ZP_00318865.1| COG0100: Ribosomal protein S11 [O... 61 5e-09
gi|15896357|ref|NP_349706.1| Ribosomal protein S11 [Clostridium ... 61 5e-09
gi|13161389|dbj|BAB32980.1| ribosomal protein S14 [Xenopus laevis] 61 5e-09
gi|33519681|ref|NP_878513.1| 30S ribosomal subunit protein S11 [... 61 5e-09
gi|48474681|sp|Q9S0R0|RS11_SHEVI 30S ribosomal protein S11 >gnl|... 61 5e-09
gi|48835029|ref|ZP_00292031.1| COG0100: Ribosomal protein S11 [T... 60 7e-09
gi|30260327|ref|NP_842704.1| ribosomal protein S11 [Bacillus ant... 60 7e-09
gi|27904919|ref|NP_778045.1| 30S ribosomal protein S11 [Buchnera... 60 7e-09
gi|20808634|ref|NP_623805.1| Ribosomal protein S11 [Thermoanaero... 60 7e-09
gi|16077210|ref|NP_388023.1| ribosomal protein S11 (BS11) [Bacil... 60 9e-09
gi|48858224|ref|ZP_00312185.1| COG0100: Ribosomal protein S11 [C... 60 9e-09
gi|19704620|ref|NP_604182.1| SSU ribosomal protein S11P [Fusobac... 60 9e-09
gi|30018405|ref|NP_830036.1| SSU ribosomal protein S11P [Bacillu... 60 9e-09
gi|21398093|ref|NP_654078.1| Ribosomal_S11, Ribosomal protein S1... 60 9e-09
gi|42658113|ref|XP_376672.1| similar to ribosomal protein S14 [H... 60 9e-09
gi|46130372|ref|ZP_00165205.2| COG0100: Ribosomal protein S11 [S... 60 9e-09
gi|18311360|ref|NP_563294.1| 30S ribosomal protein S11 [Clostrid... 60 1e-08
gi|46113293|ref|ZP_00182624.2| COG0100: Ribosomal protein S11 [E... 60 1e-08
gi|29831495|ref|NP_826129.1| putative ribosomal protein S11 [Str... 60 1e-08
gi|42526302|ref|NP_971400.1| ribosomal protein S11 [Treponema de... 60 1e-08
gi|15612724|ref|NP_241027.1| 30S ribosomal protein S11; ribosoma... 60 1e-08
gi|28198375|ref|NP_778689.1| 30S ribosomal protein S11 [Xylella ... 60 1e-08
gi|15837776|ref|NP_298464.1| 30S ribosomal protein S11 [Xylella ... 60 1e-08
gi|33866621|ref|NP_898180.1| 30S ribosomal protein S11 [Synechoc... 60 1e-08
gi|50843285|ref|YP_056512.1| 30S ribosomal protein S11 [Propioni... 60 1e-08
gi|48893971|ref|ZP_00327169.1| COG0100: Ribosomal protein S11 [T... 59 2e-08
gi|23112481|ref|ZP_00097957.1| COG0100: Ribosomal protein S11 [D... 59 2e-08
gi|28493496|ref|NP_787657.1| 30S ribosomal protein S11 [Trophery... 59 2e-08
gi|48871232|ref|ZP_00323948.1| COG0100: Ribosomal protein S11 [P... 59 2e-08
gi|21223107|ref|NP_628886.1| 30S ribosomal protein S11 [Streptom... 59 3e-08
gi|46579738|ref|YP_010546.1| ribosomal protein S11 [Desulfovibri... 59 3e-08
gi|28212156|ref|NP_783100.1| SSU ribosomal protein S11P [Clostri... 58 3e-08
gi|22973982|ref|ZP_00020397.1| hypothetical protein [Chloroflexu... 58 3e-08
gi|39938712|ref|NP_950478.1| ribosomal protein S11 [Onion yellow... 58 3e-08
gi|26554441|ref|NP_758375.1| ribosomal protein S11 [Mycoplasma p... 58 4e-08
gi|29839881|ref|NP_828987.1| ribosomal protein S11 [Chlamydophil... 57 6e-08
gi|31544833|ref|NP_853411.1| RpsK [Mycoplasma gallisepticum R] >... 57 6e-08
gi|49235651|ref|ZP_00329718.1| COG0100: Ribosomal protein S11 [M... 57 6e-08
gi|24213463|ref|NP_710944.1| ribosomal protein S11 [Leptospira i... 57 8e-08
gi|23097599|ref|NP_691065.1| 30S ribosomal protein S11 [Oceanoba... 57 8e-08
gi|15925215|ref|NP_372749.1| 30S ribosomal protein S11 [Staphylo... 57 8e-08
gi|27468716|ref|NP_765353.1| 30S ribosomal protein S11 [Staphylo... 57 8e-08
gi|45525103|ref|ZP_00176351.1| COG0100: Ribosomal protein S11 [C... 57 1e-07
gi|23336306|ref|ZP_00121529.1| COG0100: Ribosomal protein S11 [B... 56 1e-07
gi|6601579|gb|AAF19040.1| 30S ribosomal protein S11 [Mycoplasma ... 56 1e-07
gi|50876039|emb|CAG35879.1| probable 30S ribosomal protein S11 [... 56 1e-07
gi|48824746|ref|ZP_00286085.1| COG0100: Ribosomal protein S11 [E... 56 1e-07
gi|15618537|ref|NP_224823.1| S11 Ribosomal Protein [Chlamydophil... 56 1e-07
gi|33862092|ref|NP_893653.1| 30S ribosomal protein S11 [Prochlor... 56 2e-07
gi|15835409|ref|NP_297168.1| ribosomal protein S11 [Chlamydia mu... 55 2e-07
gi|29374876|ref|NP_814029.1| ribosomal protein S11 [Enterococcus... 55 2e-07
gi|30352065|ref|NP_848092.1| ribosomal protein S11 [Adiantum cap... 55 2e-07
gi|33864021|ref|NP_895581.1| 30S ribosomal protein S11 [Prochlor... 55 2e-07
gi|7524920|ref|NP_045922.1| ribosomal protein S11 [Chlorella vul... 55 2e-07
gi|15605237|ref|NP_220023.1| S11 Ribosomal Protein [Chlamydia tr... 55 4e-07
gi|19551797|ref|NP_599799.1| ribosomal protein S11 [Corynebacter... 55 4e-07
gi|42561247|ref|NP_975698.1| 30S RIBOSOMAL PROTEIN S11 [Mycoplas... 55 4e-07
gi|50657677|gb|AAT79662.1| 30S ribosomal protein S11 [Gracilaria... 55 4e-07
gi|15639204|ref|NP_218651.1| ribosomal protein S11 (rpsK) [Trepo... 55 4e-07
gi|33241139|ref|NP_876081.1| Ribosomal protein S11 [Prochlorococ... 55 4e-07
gi|2119081|pir||I40745 ribosomal protein S11 - Chlamydia trachom... 54 5e-07
gi|14017604|ref|NP_114290.1| ribosomal protein S11 [Triticum aes... 54 5e-07
gi|48478802|ref|YP_024409.1| ribosomal protein S11 [Saccharum hy... 54 5e-07
gi|11466822|ref|NP_039418.1| ribosomal protein S11 [Oryza sativa... 54 5e-07
gi|11465760|ref|NP_053904.1| ribosomal protein S11 [Porphyra pur... 54 5e-07
gi|34849416|gb|AAP58915.1| ribosomal protein S11 [Spiroplasma ku... 54 6e-07
gi|11467224|ref|NP_043056.1| ribosomal protein S11 [Zea mays] >g... 54 6e-07
gi|13518367|ref|NP_084726.1| ribosomal protein S11 [Oenothera el... 54 6e-07
gi|29565641|ref|NP_817220.1| ribosomal protein S11 [Pinus koraie... 54 6e-07
gi|34558006|ref|NP_907821.1| 30S RIBOSOMAL PROTEIN S11 [Wolinell... 54 8e-07
gi|12659011|gb|AAK01151.1| PRS11 [Marsilea quadrifolia] 54 8e-07
gi|32363478|sp|Q9BBN1|RR11_MARQU Chloroplast 30S ribosomal prote... 54 8e-07
gi|14278540|pdb|1I94|K Chain K, Crystal Structures Of The Small ... 53 1e-06
gi|46199604|ref|YP_005271.1| SSU ribosomal protein S11P [Thermus... 53 1e-06
gi|34811539|pdb|1PNS|K Chain K, Crystal Structure Of A Streptomy... 53 1e-06
gi|48474870|sp|Q8MCA0|RR11_PHAAN Chloroplast 30S ribosomal prote... 53 1e-06
gi|38233156|ref|NP_938923.1| 30S ribosomal protein S11 [Coryneba... 53 1e-06
gi|23119455|ref|ZP_00102534.1| COG0100: Ribosomal protein S11 [D... 53 1e-06
gi|15604482|ref|NP_221000.1| 30S RIBOSOMAL PROTEIN S11 (rpsK) [R... 53 1e-06
gi|42454055|ref|ZP_00153962.1| hypothetical protein Rick093701 [... 53 1e-06
gi|15892906|ref|NP_360620.1| 30S ribosomal protein S11 [Ricketts... 53 1e-06
gi|50364964|ref|YP_053389.1| 30S ribosomal protein S11 [Mesoplas... 53 1e-06
gi|42524354|ref|NP_969734.1| 30S ribosomal protein S11 [Bdellovi... 53 1e-06
gi|7524685|ref|NP_042439.1| ribosomal protein S11 [Pinus thunber... 53 1e-06
gi|15792898|ref|NP_282721.1| 30S ribosomal protein S11 [Campylob... 53 1e-06
gi|11466358|ref|NP_038361.1| ribosomal protein S11 [Mesostigma v... 53 1e-06
gi|28202205|ref|NP_777446.1| ribosomal protein S11 [Anthoceros f... 53 1e-06
gi|15645908|ref|NP_208087.1| ribosomal protein S11 (rps11) [Heli... 52 2e-06
gi|15612280|ref|NP_223933.1| 30S RIBOSOMAL PROTEIN S11 [Helicoba... 52 2e-06
gi|29653613|ref|NP_819305.1| ribosomal protein S11 [Coxiella bur... 52 2e-06
gi|11467400|ref|NP_043257.1| ribosomal protein S11 [Cyanophora p... 52 2e-06
gi|13357816|ref|NP_078090.1| ribosomal protein S11 [Ureaplasma p... 52 3e-06
gi|23124106|ref|ZP_00106117.1| COG0100: Ribosomal protein S11 [N... 52 3e-06
gi|34501437|ref|NP_904224.1| ribosomal protein S11 [Physcomitrel... 52 3e-06
gi|11467450|ref|NP_043596.1| ribosomal protein S11 [Odontella si... 52 3e-06
gi|48855297|ref|ZP_00309456.1| COG0100: Ribosomal protein S11 [C... 51 4e-06
gi|25027126|ref|NP_737180.1| putative 30S ribosomal protein S11 ... 51 4e-06
gi|133727|sp|P06587|RR11_PEA CHLOROPLAST 30S RIBOSOMAL PROTEIN S... 51 4e-06
gi|17231684|ref|NP_488232.1| 30S ribosomal protein S11 [Nostoc s... 51 4e-06
gi|15807120|ref|NP_295849.1| ribosomal protein S11 [Deinococcus ... 51 4e-06
gi|11466736|ref|NP_039332.1| ribosomal protein S11 [Marchantia p... 51 4e-06
gi|32266900|ref|NP_860932.1| ribosomal protein S11 [Helicobacter... 51 5e-06
gi|11467767|ref|NP_050818.1| ribosomal protein S11 [Nephroselmis... 51 5e-06
gi|42520508|ref|NP_966423.1| ribosomal protein S11 [Wolbachia en... 50 7e-06
gi|13518471|ref|NP_084830.1| ribosomal protein S11 [Lotus cornic... 50 7e-06
gi|34541516|ref|NP_905995.1| ribosomal protein S11 [Porphyromona... 50 9e-06
gi|22550354|ref|NP_689355.1| ribosomal protein S11 [Chaetosphaer... 50 9e-06
gi|7525066|ref|NP_051091.1| ribosomal protein S11 [Arabidopsis t... 50 9e-06
gi|32480875|ref|NP_862786.1| ribosomal protein S11 [Calycanthus ... 50 9e-06
gi|11465991|ref|NP_054533.1| ribosomal protein S11 [Nicotiana ta... 50 9e-06
gi|37523142|ref|NP_926519.1| 30S ribosomal protein S11 [Gloeobac... 50 9e-06
gi|27808056|dbj|BAC55479.1| ribosomal protein S11 [Anthoceros fo... 50 9e-06
gi|22711965|ref|NP_683833.1| ribosomal protein S11 [Chaetosphaer... 49 2e-05
gi|13507929|ref|NP_109878.1| ribosomal protein S11 [Mycoplasma p... 49 2e-05
gi|11497559|ref|NP_054967.1| ribosomal protein S11 [Spinacia ole... 49 2e-05
gi|34500946|ref|NP_904131.1| ribosomal protein S11 [Amborella tr... 49 2e-05
gi|6066161|gb|AAF03179.1| ribosomal protein S11 [Nephroselmis ol... 49 3e-05
gi|50346816|ref|YP_053187.1| ribosomal protein S11 [Nymphaea alb... 49 3e-05
gi|38638294|ref|NP_943668.1| ribosomal protein S11 [Chara vulgar... 49 3e-05
gi|11467737|ref|NP_050789.1| ribosomal protein S11 [Guillardia t... 49 3e-05
gi|47459095|ref|YP_015957.1| 30S ribosomal protein s11 [Mycoplas... 48 4e-05
gi|11466522|ref|NP_044771.1| ribosomal protein S11 [Reclinomonas... 48 5e-05
gi|21674973|ref|NP_663038.1| ribosomal protein S11 [Chlorobium t... 48 5e-05
gi|30468202|ref|NP_849089.1| ribosomal protein S11 [Cyanidioschy... 47 6e-05
gi|29348112|ref|NP_811615.1| 30S ribosomal protein S11 [Bacteroi... 47 6e-05
gi|81525|pir||B23525 ribosomal protein S11 - spinach chloroplast... 47 6e-05
gi|3914896|sp|Q46451|RS11_MYCSP 30S RIBOSOMAL PROTEIN S11 >gnl|B... 47 1e-04
gi|48474762|sp|O98461|RR11_SPIMX Chloroplast 30S ribosomal prote... 47 1e-04
gi|11467126|ref|NP_054427.1| rps11 [Marchantia polymorpha] >gnl|... 46 2e-04
gi|23487183|gb|EAA20992.1| 40s ribosomal protein s14 (fragment).... 46 2e-04
gi|563204|gb|AAB17599.1| ribosomal protein S11 >gnl|BL_ORD_ID|13... 46 2e-04
gi|15829033|ref|NP_326393.1| 30S RIBOSOMAL PROTEIN S11 [Mycoplas... 45 3e-04
gi|11497467|ref|NP_042257.1| ribosomal protein S11 [Prototheca w... 45 3e-04
gi|47220891|emb|CAG03098.1| unnamed protein product [Tetraodon n... 45 4e-04
gi|46202867|ref|ZP_00052475.2| COG0100: Ribosomal protein S11 [M... 45 4e-04
gi|18860344|ref|NP_569661.1| ribosomal protein S11 [Psilotum nud... 43 0.001
gi|11466964|ref|NP_054385.1| ribosomal protein S11 [Epifagus vir... 42 0.003
gi|11465442|ref|NP_045167.1| ribosomal protein S11 [Cyanidium ca... 40 0.010
gi|7489554|pir||T03690 probable ribosomal protein S11, mitochond... 38 0.048
gi|50881465|gb|AAT85310.1| small subunit ribosomal protein, puta... 38 0.048
gi|11467041|ref|NP_041948.1| ribosomal protein S11 [Euglena grac... 37 0.062
gi|32348718|gb|AAP76333.1| small subunit ribosomal protein [Clem... 37 0.11
gi|32348750|gb|AAP76349.1| small subunit ribosomal protein [Sang... 37 0.11
gi|31208889|ref|XP_313411.1| ENSANGP00000011326 [Anopheles gambi... 36 0.14
gi|15214711|gb|AAH12489.1| Mitochondrial ribosomal protein S11, ... 36 0.18
gi|32348800|gb|AAP76373.1| small subunit ribosomal protein [Dend... 36 0.18
gi|17222588|gb|AAL36761.1| ribosomal protein S11 [Mesostigma vir... 36 0.18
gi|10438928|dbj|BAB15381.1| unnamed protein product [Homo sapiens] 36 0.18
gi|16554609|ref|NP_073750.2| mitochondrial ribosomal protein S11... 36 0.18
gi|7440323|pir||S77868 ribosomal protein S11 - Mycoplasma capric... 35 0.24
gi|32348784|gb|AAP76365.1| small subunit ribosomal protein [Pand... 35 0.24
gi|32348794|gb|AAP76370.1| small subunit ribosomal protein [Coco... 35 0.24
gi|7458919|pir||A72557 hypothetical protein APE1741 - Aeropyrum ... 35 0.31
gi|34912590|ref|NP_917642.1| putative ribosomal protein S11 [Ory... 35 0.40
gi|32348786|gb|AAP76366.1| small subunit ribosomal protein [Host... 34 0.53
gi|32348798|gb|AAP76372.1| small subunit ribosomal protein [Junc... 34 0.53
gi|208318|gb|AAA72517.1| ribosomal protein S11 (rpsK) 34 0.69
gi|32348790|gb|AAP76368.1| small subunit ribosomal protein [Drac... 34 0.69
gi|50591288|ref|ZP_00332605.1| COG0100: Ribosomal protein S11 [S... 34 0.69
gi|32348740|gb|AAP76344.1| small subunit ribosomal protein [Berb... 34 0.69
gi|32348720|gb|AAP76334.1| small subunit ribosomal protein [Anem... 33 0.90
gi|12545455|ref|NP_075005.1| ribosomal protein S11 [Euglena long... 33 0.90
gi|32348792|gb|AAP76369.1| small subunit ribosomal protein [Typh... 33 0.90
gi|45514303|ref|ZP_00165862.1| COG0100: Ribosomal protein S11 [R... 33 0.90
gi|18398140|ref|NP_564385.1| chloroplast 30S ribosomal protein S... 33 1.2
gi|50753103|ref|XP_413871.1| PREDICTED: similar to mitochondrial... 33 1.2
gi|32348738|gb|AAP76343.1| small subunit ribosomal protein [Ranz... 33 1.2
gi|32348788|gb|AAP76367.1| small subunit ribosomal protein [Disp... 33 1.2
gi|25361111|pir||B86442 probable 30S ribosomal protein S11 [impo... 33 1.2
gi|50420719|ref|XP_458896.1| unnamed protein product [Debaryomyc... 33 1.5
gi|32348762|gb|AAP76355.1| small subunit ribosomal protein [Anno... 32 2.0
gi|32348766|gb|AAP76357.1| small subunit ribosomal protein [Hydr... 32 2.0
gi|829328|emb|CAA30669.1| rps11 protein (1 is 2nd base in codon)... 32 2.0
gi|11466591|ref|NP_066481.1| ribosomal protein S11 [Rhodomonas s... 32 2.6
gi|530485|emb|CAA83834.1| 30S ribosomal protein [Mycoplasma capr... 32 2.6
gi|32348746|gb|AAP76347.1| small subunit ribosomal protein [Esch... 32 2.6
gi|34862202|ref|XP_343140.1| similar to RIKEN cDNA G431002C21 [R... 32 3.4
gi|28828585|gb|AAO51188.1| similar to Dictyostelium discoideum (... 31 4.5
gi|45521323|ref|ZP_00172843.1| COG0100: Ribosomal protein S11 [M... 31 4.5
gi|32348768|gb|AAP76358.1| small subunit ribosomal protein [Betu... 31 4.5
gi|32348756|gb|AAP76352.1| small subunit ribosomal protein [Pepe... 31 4.5
gi|50294828|ref|XP_449825.1| unnamed protein product [Candida gl... 31 4.5
gi|32348760|gb|AAP76354.1| small subunit ribosomal protein [Cabo... 31 4.5
gi|6678944|ref|NP_032658.1| microtubule-associated protein 2 [Mu... 31 5.8
gi|6225469|sp|O08368|GPWA_PSEWI GLUTATHIONE PEROXIDASE PRECURSOR... 31 5.8
gi|32348724|gb|AAP76336.1| small subunit ribosomal protein [Achl... 31 5.8
gi|32348742|gb|AAP76345.1| small subunit ribosomal protein [Akeb... 31 5.8
gi|22995859|ref|ZP_00040159.1| COG0100: Ribosomal protein S11 [X... 31 5.8
gi|45508858|ref|ZP_00161195.1| COG0100: Ribosomal protein S11 [A... 31 5.8
gi|5852340|gb|AAD54014.1| cytochrome P450 [Fundulus heteroclitus] 31 5.8
gi|39936410|ref|NP_948686.1| putative glycosyltransferase [Rhodo... 30 7.6
gi|40789062|dbj|BAA06225.2| KIAA0055 [Homo sapiens] 30 7.6
gi|41281376|ref|NP_005145.2| ubiquitin specific protease 8 [Homo... 30 7.6
gi|731046|sp|P40818|UBP8_HUMAN Ubiquitin carboxyl-terminal hydro... 30 7.6
gi|49070508|ref|XP_399543.1| hypothetical protein UM01928.1 [Ust... 30 7.6
gi|47577593|ref|NP_001000674.1| olfactory receptor Olr529 [Rattu... 30 7.6
gi|48860262|ref|ZP_00314188.1| COG2002: Regulators of stationary... 30 7.6
gi|32348752|gb|AAP76350.1| small subunit ribosomal protein [Ciss... 30 7.6
gi|32348778|gb|AAP76362.1| small subunit ribosomal protein [Troc... 30 7.6
gi|32348776|gb|AAP76361.1| small subunit ribosomal protein [Plat... 30 7.6
gi|32348774|gb|AAP76360.1| small subunit ribosomal protein [Grev... 30 7.6
gi|32348748|gb|AAP76348.1| small subunit ribosomal protein [Bocc... 30 7.6
gi|32348772|gb|AAP76359.1| small subunit ribosomal protein [Nelu... 30 7.6
gi|32348754|gb|AAP76351.1| small subunit ribosomal protein [Cocc... 30 7.6
gi|32348722|gb|AAP76335.1| small subunit ribosomal protein [Caul... 30 7.6
gi|32348734|gb|AAP76341.1| small subunit ribosomal protein [Weig... 30 7.6
gi|32348744|gb|AAP76346.1| small subunit ribosomal protein [Styl... 30 7.6
gi|15900360|ref|NP_344964.1| conserved hypothetical protein [Str... 30 7.6
gi|23126566|ref|ZP_00108457.1| COG2203: FOG: GAF domain [Nostoc ... 30 10.0
gi|2497353|sp|P56160|YHEB_CHLVI HYPOTHETICAL 28.2 KD PROTEIN IN ... 30 10.0
gi|32348782|gb|AAP76364.1| small subunit ribosomal protein [Poly... 30 10.0
gi|15790841|ref|NP_280665.1| glycerol kinase; GlpK [Halobacteriu... 30 10.0
gi|27803071|emb|CAD60774.1| unnamed protein product [Podospora a... 30 10.0
gi|49096324|ref|XP_409622.1| hypothetical protein AN5485.2 [Aspe... 30 10.0
gi|46436261|gb|EAK95626.1| hypothetical protein CaO19.6967 [Cand... 30 10.0
>gi|17554776|ref|NP_498572.1| ribosomal Protein, Small subunit (16.2
kD) (rps-14) [Caenorhabditis elegans]
gi|1350935|sp|P48150|RS14_CAEEL 40S ribosomal protein S14
gi|7500719|pir||T28833 hypothetical protein F37C12.9 -
Caenorhabditis elegans
gi|458981|gb|AAC48301.1| Ribosomal protein, small subunit protein
14 [Caenorhabditis elegans]
Length = 152
Score = 243 bits (620), Expect = 6e-64
Identities = 127/141 (90%), Positives = 127/141 (90%)
Frame = -1
Query: 459 MAPARKGKAKEEQAVVSLGPQAKEGELIFGVAHIFASFNDTFVHITDISGRETIVRVTGG 280
MAPARKGKAKEEQAVVSLGPQAKEGELIFGVAHIFASFNDTFVHITDISGRETIVRVTGG
Sbjct: 1 MAPARKGKAKEEQAVVSLGPQAKEGELIFGVAHIFASFNDTFVHITDISGRETIVRVTGG 60
Query: 279 MKVKADRDESSPYAAMLAAQDVADRCKQLGINALHIKLXXXXXXXXXXXXXXAQSALRAL 100
MKVKADRDESSPYAAMLAAQDVADRCKQLGINALHIKL AQSALRAL
Sbjct: 61 MKVKADRDESSPYAAMLAAQDVADRCKQLGINALHIKLRATGGTRTKTPGPGAQSALRAL 120
Query: 99 ARAGMKIGRIEDVTPIPSDCT 37
ARAGMKIGRIEDVTPIPSDCT
Sbjct: 121 ARAGMKIGRIEDVTPIPSDCT 141
>gi|39583701|emb|CAE63805.1| Hypothetical protein CBG08351
[Caenorhabditis briggsae]
Length = 152
Score = 243 bits (620), Expect = 6e-64
Identities = 127/141 (90%), Positives = 127/141 (90%)
Frame = -1
Query: 459 MAPARKGKAKEEQAVVSLGPQAKEGELIFGVAHIFASFNDTFVHITDISGRETIVRVTGG 280
MAPARKGKAKEEQAVVSLGPQAKEGELIFGVAHIFASFNDTFVHITDISGRETIVRVTGG
Sbjct: 1 MAPARKGKAKEEQAVVSLGPQAKEGELIFGVAHIFASFNDTFVHITDISGRETIVRVTGG 60
Query: 279 MKVKADRDESSPYAAMLAAQDVADRCKQLGINALHIKLXXXXXXXXXXXXXXAQSALRAL 100
MKVKADRDESSPYAAMLAAQDVADRCKQLGINALHIKL AQSALRAL
Sbjct: 61 MKVKADRDESSPYAAMLAAQDVADRCKQLGINALHIKLRATGGTRSKTPGPGAQSALRAL 120
Query: 99 ARAGMKIGRIEDVTPIPSDCT 37
ARAGMKIGRIEDVTPIPSDCT
Sbjct: 121 ARAGMKIGRIEDVTPIPSDCT 141