Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F38A3_3
(921 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17533807|ref|NP_496361.1| COLlagen structural gene (30.9 kD) ... 229 9e-59
gi|39597359|emb|CAE59587.1| Hypothetical protein CBG02988 [Caeno... 219 9e-56
gi|687634|gb|AAA62504.1| collagen 119 1e-25
gi|32563747|ref|NP_494878.2| COLlagen structural gene (col-17) [... 117 5e-25
gi|39593182|emb|CAE64651.1| Hypothetical protein CBG09422 [Caeno... 66 1e-21
gi|687636|gb|AAA62505.1| collagen [Caenorhabditis elegans] 96 9e-19
gi|39597358|emb|CAE59586.1| Hypothetical protein CBG02987 [Caeno... 91 3e-17
gi|17533809|ref|NP_496362.1| COLlagen structural gene (29.2 kD) ... 91 4e-17
gi|17532621|ref|NP_494879.1| COLlagen structural gene (col-20) [... 89 2e-16
gi|17559060|ref|NP_505677.1| COLlagen structural gene (col-13) [... 84 6e-15
gi|17559058|ref|NP_505678.1| COLlagen structural gene (30.1 kD) ... 84 6e-15
gi|17561542|ref|NP_506283.1| COLlagen structural gene (col-159) ... 84 6e-15
gi|32567317|ref|NP_506284.2| COLlagen structural gene (30.3 kD) ... 83 1e-14
gi|17541194|ref|NP_499905.1| COLlagen structural gene (col-101) ... 82 2e-14
gi|17543526|ref|NP_502966.1| predicted CDS, COLlagen structural ... 81 3e-14
gi|1814029|gb|AAB41793.1| cuticle collagen [Caenorhabditis brigg... 80 6e-14
gi|39593349|emb|CAE64819.1| Hypothetical protein CBG09613 [Caeno... 80 6e-14
gi|39581442|emb|CAE74724.1| Hypothetical protein CBG22542 [Caeno... 78 2e-13
gi|17532495|ref|NP_493660.1| COLlagen structural gene (col-68) [... 78 2e-13
gi|39587054|emb|CAE62989.1| Hypothetical protein CBG07217 [Caeno... 77 4e-13
gi|39586875|emb|CAE62810.1| Hypothetical protein CBG06986 [Caeno... 75 2e-12
gi|39596930|emb|CAE59157.1| Hypothetical protein CBG02463 [Caeno... 75 3e-12
gi|17531395|ref|NP_495104.1| BLIstered cuticle BLI-2, Nematode c... 74 4e-12
gi|23482650|gb|EAA18573.1| hypothetical protein [Plasmodium yoel... 74 6e-12
gi|17536229|ref|NP_493913.1| COLlagen structural gene (col-40) [... 73 8e-12
gi|17536359|ref|NP_496665.1| COLlagen structural gene (col-85) [... 72 1e-11
gi|39587231|emb|CAE57699.1| Hypothetical protein CBG00703 [Caeno... 72 1e-11
gi|17535253|ref|NP_495759.1| COLlagen structural gene (29.4 kD) ... 72 1e-11
gi|39585576|emb|CAE65336.1| Hypothetical protein CBG10272 [Caeno... 71 3e-11
gi|7498929|pir||T29980 hypothetical protein F11G11.10 - Caenorha... 71 4e-11
gi|39579269|emb|CAE56956.1| Hypothetical protein CBG24806 [Caeno... 69 1e-10
gi|17533115|ref|NP_494880.1| COLlagen structural gene (col-73) [... 69 1e-10
gi|18846043|ref|NP_572129.1| ORF 73; extensive acidic domains, p... 68 3e-10
gi|7504495|pir||T22827 hypothetical protein F57B1.4 - Caenorhabd... 68 3e-10
gi|7507620|pir||T16841 hypothetical protein T10E10.2 - Caenorhab... 64 2e-09
gi|5514647|emb|CAB50767.1| putative cuticular collagen protein [... 65 2e-09
gi|39593181|emb|CAE64650.1| Hypothetical protein CBG09421 [Caeno... 65 2e-09
gi|39585827|emb|CAE61240.1| Hypothetical protein CBG05040 [Caeno... 65 2e-09
gi|32566594|ref|NP_872267.1| COLlagen structural gene (col-170) ... 65 2e-09
gi|17550996|ref|NP_509960.1| COLlagen structural gene (col-180Co... 65 2e-09
gi|17569675|ref|NP_509051.1| COLlagen structural gene (col-166) ... 65 3e-09
gi|17569753|ref|NP_509060.1| COLlagen structural gene (28.5 kD) ... 65 3e-09
gi|30025105|gb|AAP13769.1| Hypothetical protein T07H6.3b [Caenor... 65 3e-09
gi|39585824|emb|CAE61237.1| Hypothetical protein CBG05037 [Caeno... 64 4e-09
gi|39585828|emb|CAE61241.1| Hypothetical protein CBG05041 [Caeno... 64 4e-09
gi|5669894|gb|AAD46501.1| latent nuclear antigen [Human herpesvi... 64 4e-09
gi|32566596|ref|NP_872268.1| COLlagen structural gene (col-171) ... 64 4e-09
gi|39585826|emb|CAE61239.1| Hypothetical protein CBG05039 [Caeno... 64 5e-09
gi|39585825|emb|CAE61238.1| Hypothetical protein CBG05038 [Caeno... 64 5e-09
gi|32566570|ref|NP_872255.1| COLlagen structural gene (28.4 kD) ... 64 5e-09
gi|9886896|gb|AAG01636.1| Orf73 [Human herpesvirus 8] 64 5e-09
gi|39585817|emb|CAE61230.1| Hypothetical protein CBG05029 [Caeno... 64 6e-09
gi|17569755|ref|NP_509059.1| COLlagen structural gene (28.5 kD) ... 64 6e-09
gi|4335794|gb|AAD17458.1| cuticular collagen [Ascaris suum] 64 6e-09
gi|563237|gb|AAC46628.1| cuticular collagen Bmcol-2 62 2e-08
gi|7378665|emb|CAB85468.1| putative cuticular collagen [Brugia p... 62 2e-08
gi|30348551|emb|CAC84343.1| hypothetical protein [Saimiriine her... 62 2e-08
gi|22096343|sp|P34804|CC40_CAEEL Cuticle collagen 40 61 3e-08
gi|13936996|gb|AAK50002.1| ORF73 [Human herpesvirus 8] 61 4e-08
gi|46195903|gb|AAB37842.2| Collagen protein 20 [Caenorhabditis e... 61 4e-08
gi|39594125|emb|CAE70235.1| Hypothetical protein CBG16724 [Caeno... 60 7e-08
gi|33591257|gb|AAL06398.2| unknown [Francisella tularensis subsp... 59 2e-07
gi|17567743|ref|NP_509276.1| COLlagen structural gene (30.0 kD) ... 59 2e-07
gi|11037008|gb|AAG27458.1| latent nuclear antigen [Human herpesv... 58 3e-07
gi|20138902|sp|O97432|MRJ5_APIME Major royal jelly protein 5 pre... 58 3e-07
gi|23619284|ref|NP_705246.1| hypothetical protein [Plasmodium fa... 58 3e-07
gi|50424619|ref|XP_460899.1| unnamed protein product [Debaryomyc... 57 6e-07
gi|23613112|ref|NP_703434.1| hypothetical protein [Plasmodium fa... 57 8e-07
gi|19112576|ref|NP_595784.1| hypothetical coiled-coil protein [S... 56 1e-06
gi|23485922|gb|EAA20646.1| hypothetical protein [Plasmodium yoel... 55 2e-06
gi|26554099|ref|NP_758033.1| DNA topoisomerase IV subunit A [Myc... 55 2e-06
gi|50419503|ref|XP_458278.1| unnamed protein product [Debaryomyc... 55 3e-06
gi|17551382|ref|NP_508395.1| DumPY : shorter than wild-type DPY-... 55 3e-06
gi|17542966|ref|NP_501617.1| COLlagen structural gene (col-120) ... 55 3e-06
gi|50405059|ref|YP_054151.1| hypothetical protein PTMB.222 [Para... 54 4e-06
gi|2246532|gb|AAB62657.1| ORF 73, contains large complex repeat ... 54 4e-06
gi|23482074|gb|EAA18164.1| hypothetical protein [Plasmodium yoel... 54 5e-06
gi|7508918|pir||T26125 hypothetical protein W03G11.1 - Caenorhab... 54 5e-06
gi|39597656|emb|CAE68347.1| Hypothetical protein CBG14077 [Caeno... 54 5e-06
gi|17570227|ref|NP_510021.1| COLlagen structural gene (col-181) ... 54 5e-06
gi|50311883|ref|XP_455973.1| unnamed protein product [Kluyveromy... 53 8e-06
gi|11493967|gb|AAG35723.1| lipase precursor [Staphylococcus warn... 53 8e-06
gi|27806661|ref|NP_776463.1| dentin matrix acidic phosphoprotein... 53 8e-06
gi|7494557|pir||T37286 collagen 40 - Caenorhabditis elegans >gnl... 53 8e-06
gi|50294848|ref|XP_449835.1| unnamed protein product [Candida gl... 53 1e-05
gi|23510031|ref|NP_702697.1| hypothetical protein [Plasmodium fa... 53 1e-05
gi|23612236|ref|NP_703816.1| hypothetical protein [Plasmodium fa... 53 1e-05
gi|17550810|ref|NP_509869.1| COLlagen structural gene (27.8 kD) ... 53 1e-05
gi|38488737|ref|NP_942112.1| starmaker [Danio rerio] >gnl|BL_ORD... 52 1e-05
gi|46227256|gb|EAK88206.1| similar to hypothetical protein [Cryp... 52 2e-05
gi|39596236|emb|CAE69873.1| Hypothetical protein CBG16210 [Caeno... 52 2e-05
gi|32413407|ref|XP_327183.1| predicted protein [Neurospora crass... 52 2e-05
gi|38603523|dbj|BAD02898.1| bacteriolytic enzyme [Bacillus clausii] 52 2e-05
gi|48832889|ref|ZP_00289916.1| hypothetical protein Mmc102001633... 51 3e-05
gi|15611374|ref|NP_223025.1| putative [Helicobacter pylori J99] ... 51 3e-05
gi|48838606|ref|ZP_00295547.1| COG0457: FOG: TPR repeat [Methano... 51 4e-05
gi|23507944|ref|NP_700614.1| hypothetical protein [Plasmodium fa... 51 4e-05
gi|31207045|ref|XP_312489.1| ENSANGP00000021340 [Anopheles gambi... 51 4e-05
gi|17550812|ref|NP_509870.1| COLlagen structural gene (col-179) ... 51 4e-05
gi|17566482|ref|NP_507901.1| plasmodium falciparum trophozoite a... 50 5e-05
gi|25145616|ref|NP_500551.2| protein conserved (4F151) [Caenorha... 50 5e-05
gi|23613490|ref|NP_703334.1| hypothetical protein [Plasmodium fa... 50 5e-05
gi|120943|sp|P13816|GARP_PLAFF Glutamic acid-rich protein precur... 50 5e-05
gi|39594818|emb|CAE70686.1| Hypothetical protein CBG17403 [Caeno... 50 5e-05
gi|39579268|emb|CAE56955.1| Hypothetical protein CBG24805 [Caeno... 50 7e-05
gi|29893526|gb|AAN16519.1| merozoite surface protein-9 [Plasmodi... 50 7e-05
gi|9837385|gb|AAG00554.1| retinitis pigmentosa GTPase regulator-... 50 7e-05
gi|33563140|dbj|BAC81713.1| serine-rich protein [Entamoeba histo... 50 7e-05
gi|33563142|dbj|BAC81714.1| serine-rich protein [Entamoeba histo... 50 7e-05
gi|39585160|emb|CAE57403.1| Hypothetical protein CBG00356 [Caeno... 50 7e-05
gi|23619548|ref|NP_705510.1| hypothetical protein [Plasmodium fa... 50 9e-05
gi|17385617|emb|CAD12628.1| involucrin [Sus scrofa] 50 9e-05
gi|47568496|ref|ZP_00239196.1| spermine/spermidine synthase fami... 50 9e-05
gi|10180804|gb|AAG14291.1| glutamic acid-rich protein [Plasmodiu... 50 9e-05
gi|50424261|ref|XP_460717.1| unnamed protein product [Debaryomyc... 49 1e-04
gi|16804923|ref|NP_472952.1| hypothetical protein [Plasmodium fa... 49 1e-04
gi|39594465|emb|CAE72043.1| Hypothetical protein CBG19125 [Caeno... 49 1e-04
gi|26000376|gb|AAN75486.1| dentin matrix protein 1 [Kerivoula ha... 49 1e-04
gi|39580220|emb|CAE72976.1| Hypothetical protein CBG20316 [Caeno... 49 1e-04
gi|17539404|ref|NP_503048.1| COLlagen structural gene (28.0 kD) ... 49 1e-04
gi|39591241|emb|CAE73294.1| Hypothetical protein CBG20714 [Caeno... 49 1e-04
gi|34878291|ref|XP_346097.1| similar to opioid growth factor rec... 49 2e-04
gi|17385615|emb|CAD12627.1| involucrin [Sus scrofa] 49 2e-04
gi|17158629|ref|NP_478050.1| wsv528 [shrimp white spot syndrome ... 49 2e-04
gi|39585964|emb|CAE68253.1| Hypothetical protein CBG13930 [Caeno... 49 2e-04
gi|39587583|emb|CAE58521.1| Hypothetical protein CBG01673 [Caeno... 48 3e-04
gi|17385613|emb|CAD12626.1| involucrin [Sus scrofa] 48 3e-04
gi|47523948|ref|NP_999613.1| involucrin [Sus scrofa] >gnl|BL_ORD... 48 3e-04
gi|23613492|ref|NP_703336.1| P. falciparum RESA-like protein wit... 48 3e-04
gi|46442819|gb|EAL02105.1| hypothetical protein CaO19.801 [Candi... 48 3e-04
gi|1841872|gb|AAB47544.1| MigA [Dictyostelium discoideum] 48 4e-04
gi|33303460|gb|AAQ02306.1| dentin matrix protein 1 [Sigmodon his... 48 4e-04
gi|24711753|gb|AAN62757.1| larval allergen [Brugia malayi] 48 4e-04
gi|1236783|emb|CAA65506.1| cuticular collagen [Teladorsagia circ... 48 4e-04
gi|1236781|emb|CAA65507.1| cuticular collagen [Teladorsagia circ... 48 4e-04
gi|32567349|ref|NP_872207.1| COLlagen structural gene (col-42) [... 48 4e-04
gi|23613218|ref|NP_703540.1| hypothetical protein [Plasmodium fa... 47 5e-04
gi|39594827|emb|CAE70695.1| Hypothetical protein CBG17418 [Caeno... 47 5e-04
gi|49481187|ref|YP_039199.1| spermidine synthase [Bacillus thuri... 47 5e-04
gi|39594817|emb|CAE70685.1| Hypothetical protein CBG17402 [Caeno... 47 5e-04
gi|11559966|ref|NP_071531.1| involucrin gene [Rattus norvegicus]... 47 6e-04
gi|23613038|ref|NP_703360.1| interspersed repeat antigen, putati... 47 6e-04
gi|6323632|ref|NP_013703.1| Protein that forms a complex with Sp... 47 6e-04
gi|39585681|emb|CAE59883.1| Hypothetical protein CBG03363 [Caeno... 47 6e-04
gi|28850409|gb|AAO53177.1| similar to Dictyostelium discoideum (... 47 8e-04
gi|33563124|dbj|BAC81705.1| serine-rich protein [Entamoeba histo... 47 8e-04
gi|26000384|gb|AAN75474.1| dentin matrix protein 1 [Pteronotus p... 47 8e-04
gi|6648932|gb|AAF21294.1| lipase [Staphylococcus haemolyticus] 47 8e-04
gi|33563128|dbj|BAC81707.1| serine-rich protein [Entamoeba histo... 47 8e-04
gi|46249455|gb|AAH68622.1| LOC414671 protein [Xenopus laevis] 47 8e-04
gi|23491066|gb|EAA22695.1| hypothetical protein [Plasmodium yoel... 47 8e-04
gi|50294870|ref|XP_449846.1| unnamed protein product [Candida gl... 46 0.001
gi|17384366|emb|CAD13202.1| involucrin [Sus scrofa] 46 0.001
gi|33563114|dbj|BAC81700.1| serine-rich protein [Entamoeba histo... 46 0.001
gi|32033879|ref|ZP_00134150.1| COG0810: Periplasmic protein TonB... 46 0.001
gi|28828396|gb|AAO51028.1| similar to Dictyostelium discoideum (... 46 0.001
gi|46091588|dbj|BAD14026.1| cag pathogenicity island protein [He... 46 0.001
gi|38085863|ref|XP_133185.3| similar to hypothetical protein FLJ... 46 0.001
gi|7022719|dbj|BAA91700.1| unnamed protein product [Homo sapiens] 46 0.001
gi|33563136|dbj|BAC81711.1| serine-rich protein [Entamoeba histo... 46 0.001
gi|23486663|gb|EAA20861.1| strong similarity to unknown protein-... 46 0.001
gi|39586363|emb|CAE74020.1| Hypothetical protein CBG21668 [Caeno... 46 0.001
gi|23484285|gb|EAA19671.1| Ran-binding protein [Plasmodium yoeli... 46 0.001
gi|29251308|gb|EAA42790.1| GLP_574_10064_7116 [Giardia lamblia A... 46 0.001
gi|46852388|ref|NP_060707.2| cell-cycle and apoptosis regulatory... 46 0.001
gi|32441867|gb|AAP82002.1| cell-cycle and apoptosis regulatory p... 46 0.001
gi|27497118|gb|AAO17319.1| death inducer with SAP domain DIS [Ho... 46 0.001
gi|1813688|gb|AAC47626.1| unknown [Brugia malayi] >gnl|BL_ORD_ID... 46 0.001
gi|23488455|gb|EAA21321.1| hypothetical protein [Plasmodium yoel... 46 0.001
gi|46442629|gb|EAL01917.1| hypothetical protein CaO19.11787 [Can... 45 0.002
gi|15212037|emb|CAC51118.1| putative bifunctional autolysin [Sta... 45 0.002
gi|50545257|ref|XP_500166.1| hypothetical protein [Yarrowia lipo... 45 0.002
gi|16805171|ref|NP_473199.1| hypothetical protein [Plasmodium fa... 45 0.002
gi|50404847|ref|YP_053939.1| DNA-binding protein, putative [Para... 45 0.002
gi|21309836|gb|AAM19760.1| glutamic acid-rich protein cNBL1700 [... 45 0.002
gi|28829276|gb|AAO51818.1| similar to Kaposi's sarcoma-associate... 45 0.002
gi|11036632|ref|NP_055023.1| dentin sialophosphoprotein prepropr... 45 0.002
gi|4104929|gb|AAD02218.1| auxin response factor 7 [Arabidopsis t... 45 0.002
gi|30687949|ref|NP_851047.1| auxin-responsive factor (ARF7) [Ara... 45 0.002
gi|19310546|gb|AAL85006.1| unknown protein [Arabidopsis thaliana] 45 0.002
gi|17510331|ref|NP_491088.1| COLlagen structural gene (col-48) [... 45 0.002
gi|7489885|pir||T14867 interaptin - slime mold (Dictyostelium di... 45 0.002
gi|9758600|dbj|BAB09233.1| unnamed protein product [Arabidopsis ... 45 0.002
gi|30687943|ref|NP_851046.1| auxin-responsive factor (ARF7) [Ara... 45 0.002
gi|4103243|gb|AAD04807.1| BIPOSTO [Arabidopsis thaliana] 45 0.002
gi|30687957|ref|NP_568400.2| auxin-responsive factor (ARF7) [Ara... 45 0.002
gi|33563122|dbj|BAC81704.1| serine-rich protein [Entamoeba histo... 45 0.003
gi|16198327|gb|AAL14009.1| SD07158p [Drosophila melanogaster] 45 0.003
gi|305072|gb|AAA29103.1| K2 45 0.003
gi|30684623|ref|NP_173046.2| expressed protein [Arabidopsis thal... 45 0.003
gi|26347067|dbj|BAC37182.1| unnamed protein product [Mus musculus] 45 0.003
gi|12018306|ref|NP_072143.1| nucleolin-related protein [Rattus n... 45 0.003
gi|50286471|ref|XP_445664.1| unnamed protein product [Candida gl... 45 0.003
gi|31616158|gb|AAK38834.2| biofilm-associated surface protein [S... 45 0.003
gi|17554100|ref|NP_499837.1| predicted CDS, major sperm protein ... 45 0.003
gi|20129887|ref|NP_610708.1| CG13185-PA [Drosophila melanogaster... 45 0.003
gi|50307341|ref|XP_453649.1| unnamed protein product [Kluyveromy... 45 0.003
gi|39595524|emb|CAE60562.1| Hypothetical protein CBG04191 [Caeno... 45 0.003
gi|786136|gb|AAA99499.1| polymorphic immunodominant molecule 45 0.003
gi|305074|gb|AAA29104.1| K2 45 0.003
gi|28975395|gb|AAO61783.1| chromo-helicase DNA-binding protein [... 45 0.003
gi|33563120|dbj|BAC81703.1| serine-rich protein [Entamoeba histo... 45 0.003
gi|1706291|sp|P54682|D7_DICDI cAMP-inducible prespore protein D7... 45 0.003
gi|23482054|gb|EAA18150.1| mature-parasite-infected erythrocyte ... 44 0.004
gi|33563132|dbj|BAC81709.1| serine-rich protein [Entamoeba histo... 44 0.004
gi|33563126|dbj|BAC81706.1| serine-rich protein [Entamoeba histo... 44 0.004
gi|38110729|gb|EAA56408.1| hypothetical protein MG06379.4 [Magna... 44 0.004
gi|46434336|gb|EAK93748.1| hypothetical protein CaO19.4488 [Cand... 44 0.004
gi|23509871|ref|NP_702538.1| hypothetical protein [Plasmodium fa... 44 0.004
gi|50260382|gb|EAL23041.1| hypothetical protein CNBA8080 [Crypto... 44 0.004
gi|6746588|gb|AAF27637.1| ecdysone-inducible gene E1 [Drosophila... 44 0.004
gi|24660872|ref|NP_524849.2| CG32356-PA [Drosophila melanogaster... 44 0.004
gi|32411685|ref|XP_326323.1| hypothetical protein [Neurospora cr... 44 0.004
gi|28828775|gb|AAO51370.1| similar to Dictyostelium discoideum (... 44 0.004
gi|15792502|ref|NP_282325.1| highly acidic protein [Campylobacte... 44 0.004
gi|15223313|ref|NP_174560.1| hypothetical protein [Arabidopsis t... 44 0.004
gi|23957728|ref|NP_473185.2| hypothetical protein, conserved [Pl... 44 0.004
gi|22859162|emb|CAD30679.1| DEK protein [Drosophila melanogaster] 44 0.005
gi|45552673|ref|NP_995861.1| CG5935-PD [Drosophila melanogaster]... 44 0.005
gi|4322670|gb|AAD16120.1| dentin phosphoryn [Homo sapiens] 44 0.005
gi|26000358|gb|AAN75475.1| dentin matrix protein 1 [Myzopoda aur... 44 0.005
gi|24654265|ref|NP_725621.1| CG5935-PC [Drosophila melanogaster]... 44 0.005
gi|26000368|gb|AAN75480.1| dentin matrix protein 1 [Centurio senex] 44 0.005
gi|32417560|ref|XP_329258.1| predicted protein [Neurospora crass... 44 0.005
gi|21356855|ref|NP_652058.1| CG5935-PB [Drosophila melanogaster]... 44 0.005
gi|6752399|gb|AAF27710.1| PspA [Streptococcus pneumoniae] 44 0.005
gi|25154053|ref|NP_741059.1| predicted CDS, putative protein fam... 44 0.005
gi|33329250|gb|AAQ10025.1| putative esophageal gland cell secret... 44 0.005
gi|50411911|ref|XP_457088.1| unnamed protein product [Debaryomyc... 44 0.005
gi|50258309|gb|EAL21000.1| hypothetical protein CNBD6010 [Crypto... 44 0.005
gi|28573493|ref|NP_725622.2| CG5935-PA [Drosophila melanogaster]... 44 0.005
gi|23508707|ref|NP_701375.1| hypothetical protein [Plasmodium fa... 44 0.007
gi|39585963|emb|CAE68252.1| Hypothetical protein CBG13929 [Caeno... 44 0.007
gi|39586591|emb|CAE73718.1| Hypothetical protein CBG21232 [Caeno... 44 0.007
gi|19551977|ref|NP_599979.1| hypothetical protein NCgl0717 [Cory... 44 0.007
gi|18447408|gb|AAL68268.1| RE13191p [Drosophila melanogaster] 44 0.007
gi|25403160|pir||A86453 CDS protein F9L11.3 [imported] - Arabido... 44 0.007
gi|1711421|sp|P54705|SNWA_DICDI Protein snwA >gnl|BL_ORD_ID|9602... 44 0.007
gi|24665928|ref|NP_730271.1| CG32176-PA [Drosophila melanogaster... 44 0.007
gi|45201034|ref|NP_986604.1| AGL062Cp [Eremothecium gossypii] >g... 44 0.007
gi|39583527|emb|CAE73985.1| Hypothetical protein CBG21616 [Caeno... 44 0.007
gi|23508027|ref|NP_700697.1| dynein heavy chain, putative [Plasm... 44 0.007
gi|39586987|emb|CAE62922.1| Hypothetical protein CBG07120 [Caeno... 44 0.007
gi|23613480|ref|NP_703324.1| glutamic acid-rich protein (garp) [... 44 0.007
gi|28301672|emb|CAD36957.1| retinitis pigmentosa 1-like protein ... 44 0.007
gi|24374614|ref|NP_718657.1| TPR domain protein [Shewanella onei... 44 0.007
gi|33303430|gb|AAQ02291.1| dentin matrix protein 1 [Ochrotomys n... 44 0.007
gi|33563130|dbj|BAC81708.1| serine-rich protein [Entamoeba histo... 43 0.009
gi|27368076|gb|AAN86959.1| retinitis pigmentosa 1-like 1 protein... 43 0.009
gi|39589597|emb|CAE66832.1| Hypothetical protein CBG12202 [Caeno... 43 0.009
gi|42559826|sp|Q8IWN7|RPL1_HUMAN Retinitis pigmentosa 1-like 1 p... 43 0.009
gi|40255278|ref|NP_849188.3| retinitis pigmentosa 1-like 1 [Homo... 43 0.009
gi|46109630|ref|XP_381873.1| hypothetical protein FG01697.1 [Gib... 43 0.009
gi|28829970|gb|AAO52460.1| similar to Dictyostelium discoideum (... 43 0.009
gi|26345990|dbj|BAC36646.1| unnamed protein product [Mus musculus] 43 0.009
gi|23612220|ref|NP_703800.1| myosin-like protein, putative [Plas... 43 0.009
gi|112674|sp|P13813|110K_PLAKN 110 kDa antigen (PK110) >gnl|BL_O... 43 0.009
gi|26347237|dbj|BAC37267.1| unnamed protein product [Mus musculus] 43 0.009
gi|33563144|dbj|BAC81715.1| serine-rich protein [Entamoeba histo... 43 0.009
gi|39590065|emb|CAE61063.1| Hypothetical protein CBG04812 [Caeno... 43 0.009
gi|48839595|ref|ZP_00296526.1| COG0711: F0F1-type ATP synthase, ... 43 0.009
gi|33563138|dbj|BAC81712.1| serine-rich protein [Entamoeba histo... 43 0.009
gi|27368078|gb|AAN86960.1| retinitis pigmentosa 1-like 1 protein... 43 0.009
gi|33563288|ref|NP_080477.1| cell division cycle and apoptosis r... 43 0.009
gi|11761746|gb|AAG40164.1| nucleoprotein NP [Zaire Ebola virus] 43 0.009
gi|28850332|gb|AAM08494.2| similar to Mus musculus (Mouse). GABA... 43 0.009
gi|39586364|emb|CAE74021.1| Hypothetical protein CBG21669 [Caeno... 43 0.009
gi|27368080|gb|AAN86961.1| retinitis pigmentosa 1-like 1 protein... 43 0.009
gi|27368082|gb|AAN86962.1| retinitis pigmentosa 1-like 1 protein... 43 0.009
gi|6325066|ref|NP_015134.1| May be required for packaging pre-mR... 43 0.009
gi|1235750|dbj|BAA07154.1| RNA binding protein [Saccharomyces ce... 43 0.009
gi|27368084|gb|AAN86963.1| retinitis pigmentosa 1-like 1 protein... 43 0.009
gi|33391186|gb|AAQ17208.1| CASK interacting nucleosome assembly ... 43 0.009
gi|39590156|emb|CAE61154.1| Hypothetical protein CBG04920 [Caeno... 43 0.009
gi|26000356|gb|AAN75470.1| dentin matrix protein 1 [Pteropus hyp... 43 0.011
gi|23619067|ref|NP_705029.1| hypothetical protein [Plasmodium fa... 43 0.011
gi|50727981|ref|XP_415936.1| PREDICTED: similar to kinesin famil... 43 0.011
gi|45185072|ref|NP_982789.1| ABL158Cp [Eremothecium gossypii] >g... 43 0.011
gi|49092454|ref|XP_407688.1| hypothetical protein AN3551.2 [Aspe... 43 0.011
gi|46440327|gb|EAK99634.1| hypothetical protein CaO19.9985 [Cand... 43 0.011
gi|10314000|ref|NP_066243.1| nucleoprotein; NP [Zaire Ebola viru... 43 0.011
gi|21702648|gb|AAM76031.1| nucleoprotein NP [Zaire Ebola virus] 43 0.011
gi|74895|pir||VHIWEB nucleocapsid protein - Ebola virus (subtype... 43 0.011
gi|24654027|ref|NP_725526.1| CG8421-PD [Drosophila melanogaster]... 43 0.011
gi|46228572|gb|EAK89442.1| sushi-domain containing secreted prot... 43 0.011
gi|23488856|gb|EAA21422.1| immediate early protein homolog-relat... 43 0.011
gi|50546519|ref|XP_500729.1| hypothetical protein [Yarrowia lipo... 43 0.011
gi|46440238|gb|EAK99546.1| hypothetical protein CaO19.2449 [Cand... 43 0.011
gi|17532623|ref|NP_495487.1| COLlagen structural gene (col-36) [... 43 0.011
gi|7496625|pir||T15670 hypothetical protein C27H5.5 - Caenorhabd... 43 0.011
gi|11345238|gb|AAG34657.1| involucrin [Mus musculus] 42 0.015
gi|46442495|gb|EAL01784.1| hypothetical protein CaO19.4312 [Cand... 42 0.015
gi|28850410|gb|AAL92314.2| hypothetical protein [Dictyostelium d... 42 0.015
gi|33563148|dbj|BAC81717.1| serine-rich protein [Entamoeba histo... 42 0.015
gi|20177105|gb|AAM12255.1| LD41783p [Drosophila melanogaster] 42 0.015
gi|50546232|ref|XP_500637.1| hypothetical protein [Yarrowia lipo... 42 0.015
gi|23957777|ref|NP_473326.2| hypothetical protein [Plasmodium fa... 42 0.015
gi|7512088|pir||T30282 calcium-binding protein - sea urchin (Str... 42 0.015
gi|34874497|ref|XP_224295.2| similar to KIAA0853 protein [Rattus... 42 0.015
gi|21309834|gb|AAM19759.1| glutamic acid-rich protein cNBL1500 [... 42 0.015
gi|33303450|gb|AAQ02301.1| dentin matrix protein 1 [Scotinomys t... 42 0.015
gi|23397399|ref|NP_610101.2| CG8677-PA [Drosophila melanogaster]... 42 0.015
gi|24649873|ref|NP_651318.1| CG13648-PA [Drosophila melanogaster... 42 0.019
gi|28828998|gb|AAO51573.1| similar to Dictyostelium discoideum (... 42 0.019
gi|23508541|ref|NP_701210.1| hypothetical protein [Plasmodium fa... 42 0.019
gi|23509702|ref|NP_702369.1| hypothetical protein [Plasmodium fa... 42 0.019
gi|46125761|ref|XP_387434.1| hypothetical protein FG07258.1 [Gib... 42 0.019
gi|28829620|gb|AAO52137.1| similar to Homo sapiens (Human). Dent... 42 0.019
gi|25027859|ref|NP_737913.1| putative transcription termination ... 42 0.019
gi|25410974|pir||B84434 hypothetical protein At2g02200 [imported... 42 0.019
gi|34865500|ref|XP_345960.1| similar to hypothetical protein [Ra... 42 0.019
gi|30022804|ref|NP_834435.1| Spore germination protein IA [Bacil... 42 0.019
gi|23508069|ref|NP_700739.1| hypothetical protein [Plasmodium fa... 42 0.019
gi|17558378|ref|NP_504775.1| putative protein, with 4 coiled coi... 42 0.019
gi|8479541|sp|Q9QCE9|VNUC_EBOG4 NUCLEOPROTEIN (NUCLEOCAPSID PROT... 42 0.019
gi|29346315|ref|NP_809818.1| BatC, conserved hypothetical protei... 42 0.019
gi|5453419|gb|AAD43567.1| ras interacting protein RIPA [Dictyost... 42 0.019
gi|41054766|ref|NP_956894.1| hypothetical protein MGC63522 [Dani... 42 0.019
gi|18766204|gb|AAL78899.1| merozoite surface protein-9 precursor... 42 0.019
gi|21750187|dbj|BAC03738.1| unnamed protein product [Homo sapiens] 42 0.025
gi|30681829|ref|NP_850032.1| expressed protein [Arabidopsis thal... 42 0.025
gi|134435|sp|P21138|SERA_ENTHI Serine-rich 25 kDa antigen protei... 42 0.025
gi|40253668|dbj|BAD05611.1| glutamic acid-rich protein precursor... 42 0.025
gi|6746586|gb|AAF27636.1| Sec12 [Pichia pastoris] 42 0.025
gi|120184|sp|P06916|FIRA_PLAFF 300 KD ANTIGEN AG231 >gnl|BL_ORD_... 42 0.025
gi|23509979|ref|NP_702646.1| hypothetical protein [Plasmodium fa... 42 0.025
gi|28631387|gb|AAL92355.2| similar to Dictyostelium discoideum (... 42 0.025
gi|34857875|ref|XP_346628.1| hypothetical protein XP_346627 [Rat... 42 0.025
gi|26000378|gb|AAN75488.1| dentin matrix protein 1 [Myotis velifer] 42 0.025
gi|31212789|ref|XP_315379.1| ENSANGP00000020890 [Anopheles gambi... 42 0.025
gi|8479522|sp|O72142|VNUC_EBOZ5 NUCLEOPROTEIN (NUCLEOCAPSID PROT... 42 0.025
gi|11345242|gb|AAG34659.1| involucrin [Mus musculus] 42 0.025
gi|1223914|gb|AAB47214.1| endo16 [Strongylocentrotus purpuratus] 42 0.025
gi|23619248|ref|NP_705210.1| hypothetical protein, conserved [Pl... 42 0.025
gi|48771947|ref|ZP_00276289.1| hypothetical protein Reut02000697... 42 0.025
gi|46434301|gb|EAK93714.1| hypothetical protein CaO19.11964 [Can... 42 0.025
gi|28850391|gb|AAO53165.1| similar to midasin, a large protein w... 42 0.025
gi|46442904|gb|EAL02190.1| hypothetical protein CaO19.886 [Candi... 42 0.025
gi|627056|pir||A54641 interspersed repeat antigen precursor - ma... 42 0.025
gi|23509159|ref|NP_701827.1| hypothetical protein [Plasmodium fa... 42 0.025
gi|11345240|gb|AAG34658.1| involucrin [Mus musculus] 42 0.025
gi|13508497|gb|AAF15293.3| erythrocyte membrane-associated giant... 42 0.025
gi|5737842|gb|AAD50121.1| adenylyl cyclase [Dictyostelium discoi... 42 0.025
gi|33859738|ref|NP_084112.1| DNA segment, Chr X, Brigham & Women... 42 0.025
gi|4885511|ref|NP_005372.1| nucleolin [Homo sapiens] >gnl|BL_ORD... 42 0.025
gi|17569481|ref|NP_509645.1| DumPY : shorter than wild-type DPY-... 41 0.033
gi|23612500|ref|NP_704061.1| erythrocyte membrane protein 1 (PfE... 41 0.033
gi|31212791|ref|XP_315380.1| ENSANGP00000024735 [Anopheles gambi... 41 0.033
gi|9755859|emb|CAC01697.1| WOC protein [Drosophila melanogaster] 41 0.033
gi|24650584|ref|NP_524886.2| CG5965-PA [Drosophila melanogaster]... 41 0.033
gi|23481717|gb|EAA17910.1| dentin sialoprotein-phosphophoryn [Pl... 41 0.033
gi|46125937|ref|XP_387522.1| hypothetical protein FG07346.1 [Gib... 41 0.033
gi|128099|sp|P17691|NEUM_CARAU Neuromodulin (Axonal membrane pro... 41 0.033
gi|33469121|ref|NP_058059.1| dentin matrix protein 1; serine ric... 41 0.033
gi|26000386|gb|AAN75482.1| dentin matrix protein 1 [Thyroptera d... 41 0.033
gi|6137020|emb|CAB59629.1| dentin matrix protein-1 [Mus musculus] 41 0.033
gi|17540204|ref|NP_500767.1| MSP-domain protein like family memb... 41 0.033
gi|24649733|ref|NP_733022.1| CG5794-PB [Drosophila melanogaster]... 41 0.033
gi|47222189|emb|CAG11615.1| unnamed protein product [Tetraodon n... 41 0.033
gi|23508651|ref|NP_701320.1| hypothetical protein [Plasmodium fa... 41 0.033
gi|46442947|gb|EAL02232.1| hypothetical protein CaO19.8420 [Cand... 41 0.033
gi|45553501|ref|NP_996287.1| CG5794-PE [Drosophila melanogaster]... 41 0.033
gi|38106657|gb|EAA52938.1| hypothetical protein MG06066.4 [Magna... 41 0.033
gi|46436702|gb|EAK96060.1| hypothetical protein CaO19.11847 [Can... 41 0.033
gi|15425663|dbj|BAB64310.1| mblk-1 [Apis mellifera] 41 0.033
gi|6752411|gb|AAF27716.1| PspA [Streptococcus pneumoniae] 41 0.033
gi|32421655|ref|XP_331271.1| hypothetical protein [Neurospora cr... 41 0.033
gi|42374898|gb|AAS13449.1| merozoite surface protein 6 [Plasmodi... 41 0.033
gi|23484531|gb|EAA19833.1| hypothetical protein [Plasmodium yoel... 41 0.033
gi|45553499|ref|NP_996286.1| CG5794-PD [Drosophila melanogaster]... 41 0.033
gi|24654024|ref|NP_725525.1| CG8421-PA [Drosophila melanogaster]... 41 0.033
gi|6752417|gb|AAF27719.1| PspA [Streptococcus pneumoniae] 41 0.033
gi|6981262|ref|NP_037119.1| nestin [Rattus norvegicus] >gnl|BL_O... 41 0.033
gi|17647175|ref|NP_523757.1| CG8421-PB [Drosophila melanogaster]... 41 0.033
gi|46091445|dbj|BAD13888.1| cag pathogenicity island protein [He... 41 0.033
gi|7710046|ref|NP_057914.1| kinesin family member 21A; N-5 kines... 41 0.043
gi|32411243|ref|XP_326102.1| hypothetical protein [Neurospora cr... 41 0.043
gi|39588109|emb|CAE57341.1| Hypothetical protein CBG00277 [Caeno... 41 0.043
gi|11968247|ref|NP_072034.1| aggregation substance protein, puta... 41 0.043
gi|23491461|gb|EAA22989.1| hypothetical protein [Plasmodium yoel... 41 0.043
gi|9626029|ref|NP_040275.1| ORF 73~ECLF1 [Saimiriine herpesvirus... 41 0.043
gi|228477|prf||1804350B ECLF2 upstream ORF 41 0.043
gi|38173724|gb|AAH60698.1| Kif21a protein [Mus musculus] >gnl|BL... 41 0.043
gi|46431856|gb|EAK91379.1| hypothetical protein CaO19.7818 [Cand... 41 0.043
gi|25411550|pir||F84514 hypothetical protein At2g14140 [imported... 41 0.043
gi|46433489|gb|EAK92927.1| hypothetical protein CaO19.13986 [Can... 41 0.043
gi|48763005|ref|ZP_00267562.1| hypothetical protein Rrub02003719... 41 0.043
gi|4154097|gb|AAD04750.1| unknown [Human herpesvirus 8] 41 0.043
gi|23509094|ref|NP_701762.1| DEAD/DEAH box helicase, putative [P... 41 0.043
gi|23508603|ref|NP_701272.1| hypothetical protein [Plasmodium fa... 41 0.043
gi|7511943|pir||T13691 hypothetical protein EG0003.6 - fruit fly... 41 0.043
gi|3024384|sp|Q26789|PFR2_TRYBB 73 KD PARAFLAGELLAR ROD PROTEIN ... 41 0.043
gi|32422107|ref|XP_331497.1| predicted protein [Neurospora crass... 41 0.043
gi|23478686|gb|EAA15705.1| retinitis pigmentosa GTPase regulator... 41 0.043
gi|32416770|ref|XP_328863.1| predicted protein [Neurospora crass... 41 0.043
gi|33440491|gb|AAH56140.1| PNN protein [Danio rerio] 41 0.043
gi|4468842|emb|CAB38226.1| aggregation substance [Enterococcus f... 41 0.043
gi|24475470|dbj|BAC22730.1| serine-rich protein [Entamoeba histo... 40 0.056
gi|50749292|ref|XP_421573.1| PREDICTED: similar to hypothetical ... 40 0.056
gi|46440639|gb|EAK99943.1| hypothetical protein CaO19.6260 [Cand... 40 0.056
gi|23612482|ref|NP_704043.1| hypothetical protein [Plasmodium fa... 40 0.056
gi|23508759|ref|NP_701427.1| eukaryotic translation initiation f... 40 0.056
gi|5803098|ref|NP_006757.1| MYST histone acetyltransferase (mono... 40 0.056
gi|23509626|ref|NP_702293.1| hypothetical protein [Plasmodium fa... 40 0.056
gi|26000370|gb|AAN75483.1| dentin matrix protein 1 [Thyroptera t... 40 0.056
gi|46107152|ref|XP_380635.1| hypothetical protein FG00459.1 [Gib... 40 0.056
gi|49078064|ref|XP_402822.1| hypothetical protein UM05207.1 [Ust... 40 0.056
gi|49085782|ref|XP_404986.1| hypothetical protein AN0849.2 [Aspe... 40 0.056
gi|34558672|gb|AAQ75078.1| RAD2 [Cryptosporidium parvum] 40 0.056
gi|46226699|gb|EAK87678.1| XPG, DNA excision repair protein, fla... 40 0.056
gi|6752415|gb|AAF27718.1| PspA [Streptococcus pneumoniae] 40 0.056
gi|16768468|gb|AAL28453.1| GM05229p [Drosophila melanogaster] 40 0.056
gi|39581569|emb|CAE58354.1| Hypothetical protein CBG01475 [Caeno... 40 0.056
gi|23613462|ref|NP_703306.1| phosphatidylinositol-4-phosphate 5-... 40 0.056
gi|21703896|ref|NP_663424.1| ISG12 [Mus musculus] >gnl|BL_ORD_ID... 40 0.056
gi|42627815|tpe|CAE00399.1| TPA: putative ISG12(b2) protein [Mus... 40 0.056
gi|32404156|ref|XP_322691.1| predicted protein [Neurospora crass... 40 0.056
gi|42601246|gb|AAS21320.1| major royal jelly protein MRJP5 precu... 40 0.056
gi|46916933|emb|CAG23696.1| conserved hypothetical protein [Phot... 40 0.056
gi|15923760|ref|NP_371294.1| conserved hypothetical protein [Sta... 40 0.074
gi|22788782|ref|NP_690494.1| DNA-directed RNA polymerase [Heliot... 40 0.074
gi|15611543|ref|NP_223194.1| cag island protein [Helicobacter py... 40 0.074
gi|4758172|ref|NP_004398.1| dentin matrix acidic phosphoprotein ... 40 0.074
gi|2654425|gb|AAB87728.1| dentin matrix protein 1 40 0.074
gi|2576331|emb|CAA05158.1| SpsA protein [Streptococcus pneumoniae] 40 0.074
gi|49080700|ref|XP_403839.1| hypothetical protein UM06224.1 [Ust... 40 0.074
gi|48858286|ref|ZP_00312245.1| hypothetical protein Chte02002468... 40 0.074
gi|50401187|sp|Q9QXL2|K21A_MOUSE Kinesin family member 21A 40 0.074
gi|23508016|ref|NP_700686.1| 10b antigen, putative [Plasmodium f... 40 0.074
gi|28829807|gb|AAO52309.1| similar to Oryza sativa (japonica cul... 40 0.074
gi|6321635|ref|NP_011712.1| Protein of unknown function, require... 40 0.074
gi|17530803|ref|NP_511051.1| CG3025-PA [Drosophila melanogaster]... 40 0.074
gi|46229851|gb|EAK90669.1| RIO-like kinase domain; N-terminal re... 40 0.074
gi|423763|pir||A45988 dentin matrix acidic phosphoprotein AG1 - rat 40 0.074
gi|10946479|gb|AAG24911.1| Tash1 protein [Theileria annulata] 40 0.074
gi|15896237|ref|NP_349586.1| Hypothetical protein CAC2985 [Clost... 40 0.074
gi|50744910|ref|XP_419932.1| PREDICTED: similar to myelin transc... 40 0.074
gi|37360516|dbj|BAC98236.1| mKIAA1708 protein [Mus musculus] 40 0.074
gi|39546248|emb|CAE04257.3| OSJNBa0089N06.18 [Oryza sativa (japo... 40 0.074
gi|33303420|gb|AAQ02286.1| dentin matrix protein 1 [Neotoma albi... 40 0.074
gi|6322796|ref|NP_012869.1| RNAPII degradation factor, forms a c... 40 0.074
gi|50545197|ref|XP_500136.1| hypothetical protein [Yarrowia lipo... 40 0.074
gi|32403484|ref|XP_322355.1| hypothetical protein [Neurospora cr... 40 0.074
gi|33303424|gb|AAQ02288.1| dentin matrix protein 1 [Neotoma mexi... 40 0.074
gi|548937|sp|Q06852|SLP1_CLOTM CELL SURFACE GLYCOPROTEIN 1 PRECU... 40 0.074
gi|21954120|gb|AAM80556.1| cuticular collagen [Trichinella spira... 40 0.074
gi|15829164|ref|NP_326524.1| MEMBRANE NUCLEASE, LIPOPROTEIN [Myc... 40 0.096
gi|33563116|dbj|BAC81701.1| serine-rich protein [Entamoeba histo... 40 0.096
gi|2137074|pir||JC5113 ribosomal transcription factor UBF2 - Chi... 40 0.096
gi|1045010|gb|AAB38419.1| putative [Cricetulus griseus] 40 0.096
gi|17507195|ref|NP_492389.1| progestin induced protein like (1J4... 40 0.096
gi|21166153|gb|AAM43770.1| similar to Mus musculus (Mouse). DEAD... 40 0.096
gi|34881305|ref|XP_228502.2| similar to hypothetical protein FLJ... 40 0.096
gi|46444759|gb|EAL04032.1| hypothetical protein CaO19.4697 [Cand... 40 0.096
gi|40253662|dbj|BAD05605.1| putative nucleolin [Oryza sativa (ja... 40 0.096
gi|11345236|gb|AAG34656.1| involucrin [Mus musculus] 40 0.096
gi|23508149|ref|NP_700819.1| merozoite surface protein 6 [Plasmo... 40 0.096
gi|42374892|gb|AAS13446.1| merozoite surface protein 6 [Plasmodi... 40 0.096
gi|46437429|gb|EAK96776.1| hypothetical protein CaO19.2859 [Cand... 40 0.096
gi|46227274|gb|EAK88224.1| hypothetical protein with possible pl... 40 0.096
gi|46444915|gb|EAL04187.1| hypothetical protein CaO19.12167 [Can... 40 0.096
gi|29349227|ref|NP_812730.1| conserved hypothetical protein [Bac... 40 0.096
gi|47228708|emb|CAG07440.1| unnamed protein product [Tetraodon n... 40 0.096
gi|46125615|ref|XP_387361.1| hypothetical protein FG07185.1 [Gib... 40 0.096
gi|48103419|ref|XP_395571.1| similar to Samui [Apis mellifera] 40 0.096
gi|33303444|gb|AAQ02298.1| dentin matrix protein 1 [Peromyscus m... 40 0.096
gi|7500581|pir||T21546 hypothetical protein F36A2.13 - Caenorhab... 40 0.096
gi|28829868|gb|AAO52365.1| similar to T10C6.5.p [Caenorhabditis ... 40 0.096
gi|1045008|gb|AAB38418.1| putative [Cricetulus griseus] 40 0.096
gi|23508849|ref|NP_701517.1| hypothetical protein [Plasmodium fa... 40 0.096
gi|23379705|gb|AAM76595.1| dental matrix acidic phophoprotein 1 ... 40 0.096
gi|2137073|pir||JC5112 ribosomal transcription factor UBF1 - Chi... 40 0.096
gi|45267830|ref|NP_987089.1| dentin matrix protein 1; dentin mat... 40 0.096
gi|1076839|pir||S49313 protein kinase - slime mold (Dictyosteliu... 40 0.096
gi|15230788|ref|NP_189665.1| hypothetical protein [Arabidopsis t... 40 0.096
gi|37540997|ref|XP_166203.2| similar to RIKEN cDNA 1110030K22 [H... 40 0.096
gi|6680506|ref|NP_032438.1| involucrin [Mus musculus] >gnl|BL_OR... 40 0.096
gi|23507939|ref|NP_700609.1| hypothetical protein [Plasmodium fa... 40 0.096
gi|25395321|pir||G87867 protein F36A2.13 [imported] - Caenorhabd... 40 0.096
gi|15902165|ref|NP_357715.1| Surface protein pspA precursor [Str... 40 0.096
gi|27503844|gb|AAH42232.1| MGC52607 protein [Xenopus laevis] 40 0.096
gi|104205|pir||S17196 transcription factor UBF2 - African clawed... 40 0.096
gi|65265|emb|CAA42523.1| a xenopus upstream binding factor [Xeno... 40 0.096
gi|23380405|gb|AAN17915.1| Erp42 protein [Borrelia burgdorferi] 40 0.096
gi|136657|sp|P25980|UBF2_XENLA Nucleolar transcription factor 2 ... 40 0.096
gi|50287533|ref|XP_446196.1| unnamed protein product [Candida gl... 39 0.13
gi|49117528|ref|XP_412210.1| hypothetical protein AN8073.2 [Aspe... 39 0.13
gi|16445033|ref|NP_443189.1| ACRC protein; putative nuclear prot... 39 0.13
gi|46441020|gb|EAL00320.1| hypothetical protein CaO19.12977 [Can... 39 0.13
gi|538593|pir||A45596 trypomastigote-specific surface antigen pr... 39 0.13
gi|12644358|sp|P80544|PLS_STAAU Surface protein precursor (Plasm... 39 0.13
gi|23025181|ref|ZP_00064346.1| COG5263: FOG: Glucan-binding doma... 39 0.13
gi|50806838|ref|XP_428858.1| PREDICTED: similar to tumor-related... 39 0.13
gi|6624223|dbj|BAA88476.1| calreticulin [Eptatretus burgeri] 39 0.13
gi|42374890|gb|AAS13445.1| merozoite surface protein 6 [Plasmodi... 39 0.13
gi|26000380|gb|AAN75471.1| dentin matrix protein 1 [Saccopteryx ... 39 0.13
gi|39580382|emb|CAE71742.1| Hypothetical protein CBG18726 [Caeno... 39 0.13
gi|50795574|ref|XP_423786.1| PREDICTED: similar to kinesin famil... 39 0.13
gi|21756799|dbj|BAC04959.1| unnamed protein product [Homo sapiens] 39 0.13
gi|32419126|ref|XP_330041.1| hypothetical protein [Neurospora cr... 39 0.13
>gi|17533807|ref|NP_496361.1| COLlagen structural gene (30.9 kD)
(col-81) [Caenorhabditis elegans]
gi|7500754|pir||T21938 hypothetical protein F38A3.1 -
Caenorhabditis elegans
gi|3876827|emb|CAA90187.1| Hypothetical protein F38A3.1
[Caenorhabditis elegans]
Length = 306
Score = 229 bits (583), Expect = 9e-59
Identities = 124/184 (67%), Positives = 124/184 (67%)
Frame = -1
Query: 921 MEDKRILVEKEVESFRSIAFVGISVTXXXXXXXXXXXXAFYSYVQHVQSKLDSEVDFCKH 742
MEDKRILVEKEVESFRSIAFVGISVT AFYSYVQHVQSKLDSEVDFCKH
Sbjct: 1 MEDKRILVEKEVESFRSIAFVGISVTIAAALIAVIAIPAFYSYVQHVQSKLDSEVDFCKH 60
Query: 741 RSLSLHNQYEVVEEFTGVPSKFVVKREAHRGMSXXXXXXXXXXXXRQAECCSCXXXXXXX 562
RSLSLHNQYEVVEEFTGVPSKFVVKREAHRGMS RQAECCSC
Sbjct: 61 RSLSLHNQYEVVEEFTGVPSKFVVKREAHRGMSKRRVARRKAIRRRQAECCSCGVGAAGP 120
Query: 561 XXXXXXXXXXXXXXQSGNPGSPGQDGSDSYEHQQNREFCFECADXXXXXXXXXXXXXXXG 382
QSGNPGSPGQDGSDSYEHQQNREFCFECAD G
Sbjct: 121 QGPPGRPGNDGNDGQSGNPGSPGQDGSDSYEHQQNREFCFECADAPAGPPGAPGQAGAPG 180
Query: 381 NDGR 370
NDGR
Sbjct: 181 NDGR 184
Score = 38.1 bits (87), Expect = 0.28
Identities = 13/13 (100%), Positives = 13/13 (100%)
Frame = -1
Query: 42 CDHCPPPRTAPGY 4
CDHCPPPRTAPGY
Sbjct: 294 CDHCPPPRTAPGY 306