Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= F39B2_3
         (354 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17508699|ref|NP_493571.1| ribosomal Protein, Small subunit (1...   144   4e-34
gi|39584439|emb|CAE72577.1| Hypothetical protein CBG19764 [Caeno...   139   1e-32
gi|11276651|pir||T50825 ribosomal protein S26 [imported] - nemat...   124   6e-28
gi|1173235|sp|P41959|RS26_BRUPA 40S ribosomal protein S26 >gnl|B...   122   2e-27
gi|31240029|ref|XP_320428.1| ENSANGP00000016601 [Anopheles gambi...   117   6e-26
gi|31197479|ref|XP_307687.1| ENSANGP00000017104 [Anopheles gambi...   117   6e-26
gi|31340418|sp|Q9GT45|RS26_ANOGA 40S ribosomal protein S26 >gnl|...   117   6e-26
gi|49532838|dbj|BAD26654.1| Ribosomal protein S26 [Plutella xylo...   117   7e-26
gi|133893|sp|P27085|RS26_OCTVU 40S ribosomal protein S26 >gnl|BL...   115   3e-25
gi|50604177|gb|AAH77637.1| Unknown (protein for MGC:86356) [Xeno...   114   4e-25
gi|50416640|gb|AAH77656.1| Unknown (protein for MGC:89670) [Xeno...   114   4e-25
gi|50344518|emb|CAH04345.1| S26e ribosomal protein [Cicindela ca...   114   6e-25
gi|15213838|gb|AAK92194.1| ribosomal protein S26 [Spodoptera fru...   113   8e-25
gi|50344520|emb|CAH04346.1| S26e ribosomal protein [Dascillus ce...   113   1e-24
gi|41152199|ref|NP_957036.1| ribosomal protein S26 [Danio rerio]...   113   1e-24
gi|41053335|ref|NP_956319.1| Unknown (protein for MGC:77927); wu...   113   1e-24
gi|47229575|emb|CAG06771.1| unnamed protein product [Tetraodon n...   113   1e-24
gi|37540308|ref|XP_208690.2| similar to 40S ribosomal protein S2...   112   1e-24
gi|15294065|gb|AAK95209.1| 40S ribosomal protein S26-2 [Ictaluru...   112   1e-24
gi|6981488|ref|NP_037356.1| ribosomal protein S26 [Rattus norveg...   112   1e-24
gi|7305447|ref|NP_038793.1| ribosomal protein S26 [Mus musculus]...   112   1e-24
gi|11276655|pir||T50824 ribosomal protein S26 [imported] - human...   112   1e-24
gi|32264431|gb|AAP78710.1| ribosomal protein S26 [Equus caballus]     112   1e-24
gi|45384777|gb|AAS59431.1| ribosomal protein S26 [Chinchilla lan...   112   2e-24
gi|27666352|ref|XP_221359.1| similar to 40S ribosomal protein S2...   112   2e-24
gi|17647893|ref|NP_523595.1| CG10305-PB [Drosophila melanogaster...   111   3e-24
gi|45642965|gb|AAS72377.1| ribosomal protein S26 [Ovis aries]         111   4e-24
gi|266970|sp|P30742|RS26_CRICR 40S RIBOSOMAL PROTEIN S26 >gnl|BL...   111   4e-24
gi|1085377|pir||S55545 ribosomal protein S26, cytosolic - human ...   111   4e-24
gi|11276654|pir||T50822 ribosomal protein S26, cytosolic [import...   111   4e-24
gi|42660121|ref|XP_375035.1| similar to 40S ribosomal protein S2...   110   5e-24
gi|15294063|gb|AAK95208.1| 40S ribosomal protein S26-1 [Ictaluru...   110   5e-24
gi|1350970|sp|P49171|RS26_PIG 40S RIBOSOMAL PROTEIN S26               110   9e-24
gi|27486549|ref|XP_210082.1| similar to 40S ribosomal protein S2...   110   9e-24
gi|13639392|ref|XP_017661.1| similar to 40S ribosomal protein S2...   108   2e-23
gi|27486662|ref|XP_210094.1| similar to 40S ribosomal protein S2...   107   4e-23
gi|50254920|gb|EAL17660.1| hypothetical protein CNBL1750 [Crypto...   107   4e-23
gi|11276652|pir||T50823 ribosomal protein S26 homolog [imported]...   107   7e-23
gi|46444351|gb|EAL03626.1| hypothetical protein CaO19.9045 [Cand...   106   1e-22
gi|15228895|ref|NP_191193.1| 40S ribosomal protein S26 (RPS26C) ...   106   1e-22
gi|15226694|ref|NP_181583.1| 40S ribosomal protein S26 (RPS26A) ...   105   2e-22
gi|15226715|ref|NP_181591.1| 40S ribosomal protein S26 (RPS26B) ...   105   2e-22
gi|27478493|ref|XP_209827.1| similar to 40S ribosomal protein S2...   105   2e-22
gi|50412805|ref|XP_457166.1| unnamed protein product [Debaryomyc...   105   2e-22
gi|41149238|ref|XP_372330.1| similar to 40S ribosomal protein S2...   105   3e-22
gi|45198712|ref|NP_985741.1| AFR194Wp [Eremothecium gossypii] >g...   104   4e-22
gi|15214276|sp|O93931|RS26_SCHCO 40S ribosomal protein S26 >gnl|...   104   4e-22
gi|20466414|gb|AAM20524.1| 40S ribosomal protein S26 [Arabidopsi...   104   5e-22
gi|34860628|ref|XP_227704.2| similar to 40S ribosomal protein S2...   103   6e-22
gi|20558393|ref|XP_167001.1| similar to 40S ribosomal protein S2...   103   1e-21
gi|46227447|gb|EAK88382.1| 40S ribosomal protein S26 [Cryptospor...   103   1e-21
gi|34862517|ref|XP_213058.2| similar to ribosomal protein S26 [R...   102   1e-21
gi|34875956|ref|XP_344203.1| similar to 40S ribosomal protein S2...   102   1e-21
gi|49077384|ref|XP_402558.1| hypothetical protein UM04943.1 [Ust...   102   1e-21
gi|50306629|ref|XP_453288.1| unnamed protein product [Kluyveromy...   102   2e-21
gi|49096784|ref|XP_409852.1| RS26_NEUCR 40S ribosomal protein S2...   102   2e-21
gi|38107487|gb|EAA53652.1| hypothetical protein MG07929.4 [Magna...   102   2e-21
gi|32406584|ref|XP_323905.1| hypothetical protein [Neurospora cr...   102   2e-21
gi|133892|sp|P21772|RS26_NEUCR 40S ribosomal protein S26E (CRP5)...   102   2e-21
gi|21104588|dbj|BAB93181.1| putative 40S ribosomal protein S26 [...   101   4e-21
gi|50553494|ref|XP_504158.1| hypothetical protein [Yarrowia lipo...   100   5e-21
gi|6321249|ref|NP_011326.1| Protein component of the small (40S)...   100   5e-21
gi|6320978|ref|NP_011057.1| Protein component of the small (40S)...   100   5e-21
gi|46575999|gb|AAT01360.1| putative 40S ribosomal protein S26 [O...   100   7e-21
gi|11276657|pir||T43515 ribosomal protein S26 - fission yeast (S...   100   9e-21
gi|50291769|ref|XP_448317.1| unnamed protein product [Candida gl...   100   9e-21
gi|19114834|ref|NP_593922.1| 40s ribosomal protein s26 [Schizosa...   100   9e-21
gi|34864595|ref|XP_345934.1| similar to ribosomal protein S26 [R...   100   1e-20
gi|42658912|ref|XP_376787.1| similar to 40S ribosomal protein S2...    99   2e-20
gi|29740610|ref|XP_291745.1| similar to 40S ribosomal protein S2...    98   5e-20
gi|19113765|ref|NP_592853.1| 40s ribosomal protein s26 [Schizosa...    97   6e-20
gi|1350969|sp|P49216|RS26_ORYSA 40S RIBOSOMAL PROTEIN S26 (S31) ...    97   6e-20
gi|40950499|gb|AAR97883.1| RpS26 [Chironomus duplex]                   96   2e-19
gi|27673565|ref|XP_236845.1| similar to 40S ribosomal protein S2...    94   7e-19
gi|16805065|ref|NP_473094.1| Ribosomal protein S26e, putative [P...    93   1e-18
gi|23479899|gb|EAA16608.1| Ribosomal protein S26e [Plasmodium yo...    93   1e-18
gi|38050383|ref|XP_126911.3| similar to hypothetical protein FLJ...    92   3e-18
gi|12641796|emb|CAC27533.1| 40S ribosomal protein S26 [Platichth...    91   7e-18
gi|27718601|ref|XP_235217.1| similar to 40S ribosomal protein S2...    90   1e-17
gi|27689163|ref|XP_220913.1| similar to 40S ribosomal protein S2...    82   3e-15
gi|31340417|sp|Q9BHU1|RS26_OXYNO 40S ribosomal protein S26 >gnl|...    82   3e-15
gi|47156966|gb|AAT12345.1| small subunit ribosomal protein S26e ...    81   4e-15
gi|168798|gb|AAA33580.1| ribosomal protein                             80   1e-14
gi|29246971|gb|EAA38548.1| GLP_725_13442_13771 [Giardia lamblia ...    79   2e-14
gi|38090050|ref|XP_357968.1| similar to 40S ribosomal protein S2...    69   2e-11
gi|19074395|ref|NP_585901.1| 40S RIBOSOMAL PROTEIN S26 [Encephal...    67   1e-10
gi|13812347|ref|NP_113465.1| 40S ribosomal protein S26 [Guillard...    67   1e-10
gi|41187888|ref|XP_372815.1| similar to 40S ribosomal protein S2...    66   2e-10
gi|50306627|ref|XP_453287.1| unnamed protein product [Kluyveromy...    60   1e-08
gi|34853570|ref|XP_226700.2| similar to hypothetical protein [Ra...    59   2e-08
gi|38080511|ref|XP_357505.1| similar to 40S ribosomal protein S2...    48   4e-05
gi|28876010|gb|AAO60019.1| putative ribosomal protein [Oryza sat...    47   7e-05
gi|3088343|dbj|BAA25824.1| ribosomal protein S26 [Homo sapiens]        47   9e-05
gi|1173236|sp|P41692|RS26_MUSVI 40S RIBOSOMAL PROTEIN S26 >gnl|B...    40   0.011
gi|4432747|dbj|BAA25823.1| ribosomal protein S26 [Homo sapiens]        38   0.056
gi|18313151|ref|NP_559818.1| ribosomal protein S26 [Pyrobaculum ...    34   0.62
gi|41202041|ref|XP_370682.1| KIAA1467 protein [Homo sapiens]           32   2.3
gi|41614839|ref|NP_963337.1| NEQ043 [Nanoarchaeum equitans Kin4-...    32   3.1
gi|15897490|ref|NP_342095.1| LSU ribosomal protein S26E (rps26E)...    32   3.1
gi|485510|pir||S33616 embryonic abundant protein, group 3 - whea...    32   4.0
gi|50875383|emb|CAG35223.1| unknown protein [Desulfotalea psychr...    31   6.8
gi|49091126|ref|XP_407024.1| hypothetical protein AN2887.2 [Aspe...    31   6.8
gi|46806733|dbj|BAD17783.1| hypothetical protein [Oryza sativa (...    31   6.8
gi|25402790|pir||G86282 protein F10B6.32 [imported] - Arabidopsi...    30   8.9
gi|50748484|ref|XP_421267.1| PREDICTED: similar to HESB like dom...    30   8.9
gi|15223949|ref|NP_172944.1| epsin N-terminal homology (ENTH) do...    30   8.9
gi|48894390|ref|ZP_00327499.1| COG2274: ABC-type bacteriocin/lan...    30   8.9


>gi|17508699|ref|NP_493571.1| ribosomal Protein, Small subunit (13.2
           kD) (rps-26) [Caenorhabditis elegans]
 gi|31340394|sp|O45499|RS26_CAEEL 40S ribosomal protein S26
 gi|7500840|pir||T21988 hypothetical protein F39B2.6 -
           Caenorhabditis elegans
 gi|3876913|emb|CAB07387.1| Hypothetical protein F39B2.6
           [Caenorhabditis elegans]
          Length = 117

 Score =  144 bits (363), Expect = 4e-34
 Identities = 70/84 (83%), Positives = 70/84 (83%)
 Frame = +1

Query: 1   MTFXXXXXXXXXXXXXXVAFIRCTNCGRCCPKDKAIKKFVVRNIVEAAAVRDIGDASAYT 180
           MTF              VAFIRCTNCGRCCPKDKAIKKFVVRNIVEAAAVRDIGDASAYT
Sbjct: 1   MTFKRRNHGRNKKNRGHVAFIRCTNCGRCCPKDKAIKKFVVRNIVEAAAVRDIGDASAYT 60

Query: 181 QYALPKLYHKLHYCIACAIHSKVV 252
           QYALPKLYHKLHYCIACAIHSKVV
Sbjct: 61  QYALPKLYHKLHYCIACAIHSKVV 84




[DB home][top]