Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F39H2_4
(555 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17508765|ref|NP_492345.1| putative nuclear protein, with 2 co... 363 1e-99
gi|39589469|emb|CAE74498.1| Hypothetical protein CBG22249 [Caeno... 186 3e-46
gi|47212267|emb|CAF96463.1| unnamed protein product [Tetraodon n... 45 7e-04
gi|1903280|emb|CAA98620.1| USO1 [Saccharomyces cerevisiae] 44 0.002
gi|677198|gb|AAB00143.1| putative 44 0.002
gi|6320145|ref|NP_010225.1| involved intracellular protein trans... 44 0.002
gi|137175|sp|P25386|USO1_YEAST Intracellular protein transport p... 44 0.002
gi|127758|sp|P05659|MYSN_ACACA Myosin II heavy chain, non muscle... 44 0.003
gi|27806123|ref|NP_776877.1| Rho-associated, coiled-coil contain... 42 0.006
gi|28211875|ref|NP_782819.1| conserved protein [Clostridium teta... 42 0.006
gi|13549081|gb|AAK29627.1| Rho-associated coiled-coil forming ki... 42 0.007
gi|42519604|ref|NP_965534.1| hypothetical protein LJ1729 [Lactob... 42 0.007
gi|45387641|ref|NP_991170.1| TRAF interacting protein [Danio rer... 42 0.007
gi|50737091|ref|XP_419151.1| PREDICTED: similar to corneal epith... 42 0.007
gi|5924306|gb|AAD56544.1| ADA2-like protein [Plasmodium falciparum] 41 0.012
gi|32408715|ref|XP_324838.1| hypothetical protein [Neurospora cr... 41 0.012
gi|16081854|ref|NP_394249.1| chromosome segregation protein rela... 41 0.012
gi|23507947|ref|NP_700617.1| ADA2-like protein [Plasmodium falci... 41 0.012
gi|34907340|ref|NP_915017.1| P0471B04.4 [Oryza sativa (japonica ... 41 0.016
gi|726492|gb|AAC46633.1| filarin 40 0.021
gi|32473935|ref|NP_866929.1| probable myosin heavy chain [Pirell... 40 0.021
gi|46228061|gb|EAK88960.1| large protein with a UBR1-like ring f... 40 0.021
gi|19113921|ref|NP_593009.1| hypothetical coiled-coil protein [S... 40 0.028
gi|47222189|emb|CAG11615.1| unnamed protein product [Tetraodon n... 40 0.028
gi|46109064|ref|XP_381590.1| hypothetical protein FG01414.1 [Gib... 40 0.036
gi|24286605|gb|AAN46661.1| M protein precursor [Streptococcus py... 40 0.036
gi|23508608|ref|NP_701277.1| hypothetical protein [Plasmodium fa... 40 0.036
gi|37680482|ref|NP_935091.1| cell division protein MukB [Vibrio ... 40 0.036
gi|34786063|gb|AAH57969.1| Expressed sequence AI595338 [Mus musc... 39 0.047
gi|50286051|ref|XP_445454.1| unnamed protein product [Candida gl... 39 0.047
gi|45383209|ref|NP_989808.1| Hec1 protein [Gallus gallus] >gnl|B... 39 0.047
gi|22324427|dbj|BAC10344.1| centromere protein-like [Oryza sativ... 39 0.047
gi|48133166|ref|XP_393334.1| similar to myosin heavy chain 2, mu... 39 0.062
gi|15678568|ref|NP_275683.1| intracellular protein transport pro... 39 0.062
gi|4761082|gb|AAD29246.1| intermediate filament filarin [Hirudo ... 39 0.081
gi|50728478|ref|XP_416138.1| PREDICTED: similar to Early endosom... 39 0.081
gi|50745035|ref|XP_419954.1| PREDICTED: similar to Rho-associate... 39 0.081
gi|13549083|gb|AAK29628.1| Rho-associated coiled coil forming ki... 39 0.081
gi|48856396|ref|ZP_00310553.1| COG1579: Zn-ribbon protein, possi... 39 0.081
gi|50409256|ref|XP_456854.1| unnamed protein product [Debaryomyc... 39 0.081
gi|46107656|ref|XP_380887.1| hypothetical protein FG00711.1 [Gib... 39 0.081
gi|27365475|ref|NP_761003.1| Cell division protein MukB [Vibrio ... 39 0.081
gi|40788305|dbj|BAA31594.2| KIAA0619 protein [Homo sapiens] 39 0.081
gi|47605963|sp|O75116|ROC2_HUMAN Rho-associated protein kinase 2... 39 0.081
gi|41872583|ref|NP_004841.2| Rho-associated, coiled-coil contain... 39 0.081
gi|4520225|dbj|BAA75636.1| Rho kinase [Homo sapiens] 39 0.081
gi|6981478|ref|NP_037154.1| Rho-associated coiled-coil forming k... 38 0.11
gi|20094208|ref|NP_614055.1| Uncharacterized protein [Methanopyr... 38 0.11
gi|50404852|ref|YP_053944.1| Conserved hypothetical protein, TPR... 38 0.11
gi|48111808|ref|XP_396309.1| similar to hypothetical protein [Ap... 38 0.11
gi|23484474|gb|EAA19791.1| hypothetical protein [Plasmodium yoel... 38 0.11
gi|18309198|ref|NP_561132.1| probable exonuclease [Clostridium p... 38 0.11
gi|47229426|emb|CAF99414.1| unnamed protein product [Tetraodon n... 38 0.14
gi|46228476|gb|EAK89346.1| Smc like ABC ATpase involved in DNA r... 38 0.14
gi|20806787|ref|NP_621958.1| ATPase involved in DNA repair [Ther... 38 0.14
gi|45509670|ref|ZP_00162003.1| COG1196: Chromosome segregation A... 38 0.14
gi|48106436|ref|XP_393062.1| similar to ENSANGP00000005190 [Apis... 38 0.14
gi|31203693|ref|XP_310795.1| ENSANGP00000023103 [Anopheles gambi... 38 0.14
gi|31225876|ref|XP_317627.1| ENSANGP00000002259 [Anopheles gambi... 37 0.18
gi|50550759|ref|XP_502852.1| hypothetical protein [Yarrowia lipo... 37 0.18
gi|32413318|ref|XP_327139.1| hypothetical protein [Neurospora cr... 37 0.18
gi|23509106|ref|NP_701774.1| t-SNARE, putative [Plasmodium falci... 37 0.18
gi|30022084|ref|NP_833715.1| hypothetical Exported Protein [Baci... 37 0.18
gi|6677761|ref|NP_033098.1| Rho-associated coiled-coil forming k... 37 0.18
gi|50416526|gb|AAH77739.1| Unknown (protein for MGC:78831) [Xeno... 37 0.18
gi|48862000|ref|ZP_00315898.1| COG4942: Membrane-bound metallope... 37 0.18
gi|48892360|ref|ZP_00325747.1| COG3206: Uncharacterized protein ... 37 0.18
gi|25453232|sp|O61308|PUMA_PARUN 227 kDa spindle- and centromere... 37 0.23
gi|1263021|gb|AAA96959.1| M protein 37 0.23
gi|50545503|ref|XP_500289.1| hypothetical protein [Yarrowia lipo... 37 0.23
gi|31202221|ref|XP_310059.1| ENSANGP00000015064 [Anopheles gambi... 37 0.23
gi|32469711|sp|Q8CHG3|GCC2_MOUSE GRIP and coiled-coil domain-con... 37 0.23
gi|46431250|gb|EAK90848.1| hypothetical protein CaO19.2629 [Cand... 37 0.23
gi|47221621|emb|CAF97886.1| unnamed protein product [Tetraodon n... 37 0.23
gi|19115532|ref|NP_594620.1| tpr1 protein [Schizosaccharomyces p... 37 0.23
gi|26006147|dbj|BAC41416.1| mKIAA0336 protein [Mus musculus] 37 0.23
gi|11282503|pir||T43678 tetratricopeptide repeat protein tpr1 - ... 37 0.23
gi|47203563|emb|CAG13765.1| unnamed protein product [Tetraodon n... 37 0.23
gi|47565872|ref|ZP_00236911.1| hypothetical protein exported pro... 37 0.23
gi|48866267|ref|ZP_00320123.1| COG1196: Chromosome segregation A... 37 0.23
gi|15895993|ref|NP_349342.1| ATPase involved in DNA repair [Clos... 37 0.23
gi|46318872|ref|ZP_00219300.1| COG0419: ATPase involved in DNA r... 37 0.23
gi|20073167|gb|AAH27339.1| 2600014C01Rik protein [Mus musculus] 37 0.23
gi|10803361|emb|CAC13106.1| nuclear lamin L1 alpha [Urochordate ... 37 0.31
gi|15485411|emb|CAC67634.1| hypothetical predicted protein L7913... 37 0.31
gi|47220539|emb|CAG05565.1| unnamed protein product [Tetraodon n... 37 0.31
gi|13541826|ref|NP_111514.1| Predicted coiled-coil protein [Ther... 37 0.31
gi|19879404|gb|AAK85118.1| non-muscle myosin II heavy chain [Lol... 37 0.31
gi|26325468|dbj|BAC26488.1| unnamed protein product [Mus musculus] 37 0.31
gi|38073681|ref|XP_129658.4| leucine, glutamic acid, lysine fami... 37 0.31
gi|10803363|emb|CAC13107.1| nuclear lamin L1 beta [Urochordate s... 37 0.31
gi|46227399|gb|EAK88334.1| conserved eukaryotic nuclear protein ... 37 0.31
gi|50286815|ref|XP_445837.1| unnamed protein product [Candida gl... 37 0.31
gi|50550267|ref|XP_502606.1| hypothetical protein [Yarrowia lipo... 37 0.31
gi|6320562|ref|NP_010643.1| may be involved in connecting nuclea... 36 0.40
gi|47605987|sp|P61584|ROC1_PANTR Rho-associated protein kinase 1... 36 0.40
gi|19112774|ref|NP_595982.1| conserved hypothetical protein [Sch... 36 0.40
gi|39593982|emb|CAE70092.1| Hypothetical protein CBG16534 [Caeno... 36 0.40
gi|50419075|ref|XP_458060.1| unnamed protein product [Debaryomyc... 36 0.40
gi|49078844|ref|XP_403134.1| hypothetical protein UM05519.1 [Ust... 36 0.40
gi|31544003|ref|NP_852728.1| hypothetical protein Aaphi23p06 [Ba... 36 0.40
gi|46432411|gb|EAK91894.1| hypothetical protein CaO19.13673 [Can... 36 0.40
gi|4885583|ref|NP_005397.1| Rho-associated, coiled-coil containi... 36 0.40
gi|47227338|emb|CAF96887.1| unnamed protein product [Tetraodon n... 36 0.40
gi|15221524|ref|NP_177046.1| expressed protein [Arabidopsis thal... 36 0.40
gi|42783093|ref|NP_980340.1| lipoprotein, putative [Bacillus cer... 36 0.40
gi|42519392|ref|NP_965322.1| chromosome partitioning protein Smc... 36 0.40
gi|23487793|gb|EAA21147.1| protein mix-1, putative [Plasmodium y... 36 0.40
gi|50740139|ref|XP_429241.1| PREDICTED: hypothetical protein XP_... 36 0.52
gi|45597449|ref|NP_035646.1| synaptonemal complex protein 1 [Mus... 36 0.52
gi|735904|gb|AAA64514.1| testicular protein 36 0.52
gi|15615399|ref|NP_243702.1| BH2836~unknown [Bacillus halodurans... 36 0.52
gi|212451|gb|AAA48987.1| nonmuscle myosin heavy chain 36 0.52
gi|49068802|ref|XP_398690.1| hypothetical protein UM01075.1 [Ust... 36 0.52
gi|15227947|ref|NP_181776.1| meprin and TRAF homology domain-con... 36 0.52
gi|18202023|sp|O33600|RA50_SULAC DNA double-strand break repair ... 36 0.52
gi|212450|gb|AAA48986.1| nonmuscle myosin heavy chain 36 0.52
gi|212449|gb|AAA48985.1| nonmuscle myosin heavy chain 36 0.52
gi|45382679|ref|NP_990805.1| nonmuscle myosin heavy chain [Gallu... 36 0.52
gi|28897811|ref|NP_797416.1| cell division protein MukB [Vibrio ... 36 0.52
gi|30264069|ref|NP_846446.1| lipoprotein, putative [Bacillus ant... 36 0.52
gi|46913979|emb|CAG20761.1| putative cell division protein MukB ... 36 0.52
gi|49094764|ref|XP_408843.1| hypothetical protein AN4706.2 [Aspe... 36 0.52
gi|23612499|ref|NP_704060.1| erythrocyte membrane protein 1 (PfE... 36 0.52
gi|21402048|ref|NP_658033.1| hypothetical protein predicted by G... 36 0.52
gi|37805135|gb|AAH60166.1| Rabep1 protein [Mus musculus] 35 0.68
gi|12005629|gb|AAG44544.1| rabaptin-5gamma [Mus musculus] 35 0.68
gi|32328841|emb|CAD66596.2| SMC protein [Desulfitobacterium hafn... 35 0.68
gi|23619086|ref|NP_705048.1| hypothetical protein [Plasmodium fa... 35 0.68
gi|109322|pir||A41604 myosin heavy chain, smooth muscle, long sp... 35 0.68
gi|50414793|gb|AAH77786.1| Unknown (protein for IMAGE:4970537) [... 35 0.68
gi|1346644|sp|P35748|MYHB_RABIT Myosin heavy chain, smooth muscl... 35 0.68
gi|23509300|ref|NP_701967.1| hypothetical protein [Plasmodium fa... 35 0.68
gi|50427657|ref|XP_462441.1| unnamed protein product [Debaryomyc... 35 0.68
gi|16804929|ref|NP_472958.1| hypothetical protein [Plasmodium fa... 35 0.68
gi|1661003|dbj|BAA13639.1| synaptonemal complex protein 1 [Mus m... 35 0.68
gi|48103366|ref|XP_395558.1| similar to CG15792-PA [Apis mellifera] 35 0.68
gi|9507021|ref|NP_062273.1| rabaptin, RAB GTPase binding effecto... 35 0.68
gi|2696101|dbj|BAA23818.1| neurocrescin [Mus musculus] 35 0.68
gi|31377798|ref|NP_004694.2| rabaptin, RAB GTPase binding effect... 35 0.68
gi|26386312|dbj|BAB31710.2| unnamed protein product [Mus musculus] 35 0.68
gi|23112534|ref|ZP_00098006.1| COG1196: Chromosome segregation A... 35 0.68
gi|13195256|gb|AAK15625.1| 235 kDa rhoptry protein [Plasmodium y... 35 0.89
gi|50421379|ref|XP_459239.1| unnamed protein product [Debaryomyc... 35 0.89
gi|26190420|emb|CAD32955.1| rhoptry protein [Plasmodium yoelii y... 35 0.89
gi|38079784|ref|XP_148244.4| golgi autoantigen, golgin subfamily... 35 0.89
gi|28829494|gb|AAO52027.1| similar to Dictyostelium discoideum (... 35 0.89
gi|1709211|sp|P54697|MYSJ_DICDI Myosin IJ heavy chain >gnl|BL_OR... 35 0.89
gi|13592049|ref|NP_112360.1| Rho-associated kinase beta [Rattus ... 35 0.89
gi|23479124|gb|EAA16038.1| repeat organellar protein-related [Pl... 35 0.89
gi|1589173|prf||2210342A myosin:SUBUNIT=heavy chain 35 0.89
gi|9280323|dbj|BAB01702.1| kinesin (centromeric protein)-like pr... 35 0.89
gi|14248766|gb|AAK57644.1| LafA1 [Aeromonas punctata] 35 0.89
gi|47224673|emb|CAG03657.1| unnamed protein product [Tetraodon n... 35 0.89
gi|42733675|gb|AAO50853.2| similar to Dictyostelium discoideum (... 35 0.89
gi|46189017|ref|ZP_00124114.2| COG0653: Preprotein translocase s... 35 0.89
gi|47605964|sp|O77819|ROC1_RABIT Rho-associated protein kinase 1... 35 0.89
gi|6677759|ref|NP_033097.1| Rho-associated coiled-coil forming k... 35 0.89
gi|47223159|emb|CAG11294.1| unnamed protein product [Tetraodon n... 35 0.89
gi|23480265|gb|EAA16872.1| 235 kDa rhoptry protein [Plasmodium y... 35 0.89
gi|26351889|dbj|BAC39581.1| unnamed protein product [Mus musculus] 35 0.89
gi|33086618|gb|AAP92621.1| Ac2-154 [Rattus norvegicus] 35 0.89
gi|32363162|sp|Q8HZQ5|EZRI_RABIT Ezrin (p81) (Cytovillin) (Villi... 35 0.89
gi|15220486|ref|NP_174250.1| zinc finger protein-related [Arabid... 35 0.89
gi|42564999|ref|NP_188535.3| kinesin motor protein-related [Arab... 35 0.89
gi|26251716|gb|AAH40461.1| Golgb1 protein [Mus musculus] 35 0.89
gi|15641718|ref|NP_231350.1| cell division protein MukB [Vibrio ... 35 0.89
gi|26517854|gb|AAN78319.1| cGMP-specific phosphodiesterase [Dict... 35 1.2
gi|21361706|ref|NP_060601.2| chromosome 10 open reading frame 3 ... 35 1.2
gi|34364797|emb|CAE45837.1| hypothetical protein [Homo sapiens] 35 1.2
gi|33945009|ref|XP_340652.1| hypothetical protein Tb927.2.5530 [... 35 1.2
gi|37220738|gb|AAQ89710.1| rhoptry associated membrane antigen [... 35 1.2
gi|48120804|ref|XP_393229.1| similar to CG18251-PB [Apis mellifera] 35 1.2
gi|48845135|ref|ZP_00299422.1| COG0840: Methyl-accepting chemota... 35 1.2
gi|39590394|emb|CAE66133.1| Hypothetical protein CBG11357 [Caeno... 35 1.2
gi|23480734|gb|EAA17216.1| hypothetical protein [Plasmodium yoel... 35 1.2
gi|49091278|ref|XP_407100.1| hypothetical protein AN2963.2 [Aspe... 35 1.2
gi|40789293|ref|NP_776123.2| centromere protein E; kinesin 10; k... 35 1.2
gi|39591036|emb|CAE58816.1| Hypothetical protein CBG02025 [Caeno... 35 1.2
gi|46434613|gb|EAK94017.1| hypothetical protein CaO19.1877 [Cand... 35 1.2
gi|50310189|ref|XP_455114.1| unnamed protein product [Kluyveromy... 35 1.2
gi|31206889|ref|XP_312411.1| ENSANGP00000003008 [Anopheles gambi... 35 1.2
gi|47223940|emb|CAG06117.1| unnamed protein product [Tetraodon n... 35 1.2
gi|42783653|ref|NP_980900.1| DNA recombinase, putative [Bacillus... 35 1.2
gi|7494208|pir||T18438 hypothetical protein C0415c - malaria par... 34 1.5
gi|39582082|emb|CAE63725.1| Hypothetical protein CBG08250 [Caeno... 34 1.5
gi|47211846|emb|CAF95409.1| unnamed protein product [Tetraodon n... 34 1.5
gi|20302065|ref|NP_620240.1| golgi-associated protein GCP360 [Ra... 34 1.5
gi|23308649|ref|NP_694500.1| insulin-like growth factor 1a recep... 34 1.5
gi|23612979|ref|NP_704518.1| hypothetical protein [Plasmodium fa... 34 1.5
gi|28839596|gb|AAH47871.1| CDC42BPB protein [Homo sapiens] 34 1.5
gi|7022637|dbj|BAA91670.1| unnamed protein product [Homo sapiens] 34 1.5
gi|7494129|pir||T18296 myosin heavy chain - Entamoeba histolytic... 34 1.5
gi|38101659|gb|EAA48588.1| hypothetical protein MG00246.4 [Magna... 34 1.5
gi|17556164|ref|NP_497576.1| C.Elegans Homeobox (ceh-44) [Caenor... 34 1.5
gi|2982220|gb|AAC06351.1| Rho-associated kinase alpha [Xenopus l... 34 1.5
gi|50287485|ref|XP_446172.1| unnamed protein product [Candida gl... 34 1.5
gi|34852562|ref|XP_228197.2| similar to Golgi coiled coil protei... 34 1.5
gi|32564492|ref|NP_497577.2| C.Elegans Homeobox (71.0 kD) (ceh-4... 34 1.5
gi|50752881|ref|XP_413790.1| PREDICTED: similar to hypothetical ... 34 1.5
gi|50542952|ref|XP_499642.1| hypothetical protein [Yarrowia lipo... 34 1.5
gi|17561652|ref|NP_505094.1| myosin heavy chain family member (5... 34 1.5
gi|14422164|gb|AAK60425.1| cardiac muscle factor 1 [Gallus gallus] 34 1.5
gi|23619383|ref|NP_705345.1| hypothetical protein [Plasmodium fa... 34 1.5
gi|15899022|ref|NP_343627.1| Purine NTPase [Sulfolobus solfatari... 34 1.5
gi|14133241|dbj|BAA86438.2| KIAA1124 protein [Homo sapiens] 34 1.5
gi|50755409|ref|XP_414731.1| PREDICTED: similar to RIKEN cDNA 49... 34 1.5
gi|17945862|gb|AAL48977.1| RE39037p [Drosophila melanogaster] 34 1.5
gi|46126781|ref|XP_387944.1| hypothetical protein FG07768.1 [Gib... 34 1.5
gi|24657547|ref|NP_647893.2| CG15015-PA [Drosophila melanogaster... 34 1.5
gi|45382843|ref|NP_989976.1| cardiac muscle factor 1 CMF1 [Gallu... 34 1.5
gi|23957746|ref|NP_473216.2| hypothetical protein [Plasmodium fa... 34 1.5
gi|23483603|gb|EAA19220.1| hypothetical protein [Plasmodium yoel... 34 1.5
gi|6678571|ref|NP_033536.1| villin 2 [Mus musculus] >gnl|BL_ORD_... 34 1.5
gi|15668305|ref|NP_247101.1| ribonuclease HII (rnhB) [Methanocal... 34 1.5
gi|32564490|ref|NP_497575.2| C.Elegans Homeobox (ceh-44) [Caenor... 34 1.5
gi|50545729|ref|XP_500403.1| hypothetical protein [Yarrowia lipo... 34 1.5
gi|8650501|gb|AAF78238.1| rabaptin-5delta [Mus musculus] 34 1.5
gi|28316402|dbj|BAC56936.1| structural maintenance of chromosome... 34 1.5
gi|46433735|gb|EAK93166.1| hypothetical protein CaO19.6148 [Cand... 34 1.5
gi|5006445|gb|AAD37506.1| CDC42-binding protein kinase beta [Hom... 34 1.5
gi|16357474|ref|NP_006026.2| CDC42-binding protein kinase beta; ... 34 1.5
gi|48894399|ref|ZP_00327508.1| COG0845: Membrane-fusion protein ... 34 1.5
gi|26190416|emb|CAD32953.1| rhoptry protein [Plasmodium yoelii y... 34 2.0
gi|47564810|ref|ZP_00235854.1| reticulocyte binding protein [Bac... 34 2.0
gi|6319606|ref|NP_009688.1| Protein that acts as an adaptor betw... 34 2.0
gi|6324503|ref|NP_014572.1| Spindle pole body protein, required ... 34 2.0
gi|50728408|ref|XP_416130.1| PREDICTED: similar to KIAA0373 [Gal... 34 2.0
gi|31212227|ref|XP_315098.1| ENSANGP00000010787 [Anopheles gambi... 34 2.0
gi|38566922|emb|CAE76225.1| related to putative cytoplasmic stru... 34 2.0
gi|23509322|ref|NP_701989.1| hypothetical protein [Plasmodium fa... 34 2.0
gi|48730002|ref|ZP_00263751.1| COG3206: Uncharacterized protein ... 34 2.0
gi|416720|sp|P32985|BPS2_ACIAM Protein bps2 >gnl|BL_ORD_ID|83743... 34 2.0
gi|32419136|ref|XP_330046.1| hypothetical protein [Neurospora cr... 34 2.0
gi|37994693|gb|AAH60254.1| Golgb1 protein [Mus musculus] 34 2.0
gi|7494447|pir||T28634 variant-specific surface protein 7 - mala... 34 2.0
gi|47216210|emb|CAG01244.1| unnamed protein product [Tetraodon n... 34 2.0
gi|32352206|dbj|BAC78596.1| hypothetical protein [Oryza sativa (... 34 2.0
gi|15225334|ref|NP_180225.1| expressed protein [Arabidopsis thal... 34 2.0
gi|25153238|ref|NP_741794.1| putative protein, with 12 coiled co... 34 2.0
gi|48130443|ref|XP_393314.1| similar to ENSANGP00000013495 [Apis... 34 2.0
gi|15643436|ref|NP_228480.1| M-related protein [Thermotoga marit... 34 2.0
gi|23612452|ref|NP_704013.1| hypothetical protein [Plasmodium fa... 34 2.0
gi|25153235|ref|NP_741793.1| putative protein, with 12 coiled co... 34 2.0
gi|28277520|gb|AAH45324.1| Wu:fi22c04 protein [Danio rerio] 34 2.0
gi|39585383|emb|CAE61705.1| Hypothetical protein CBG05654 [Caeno... 34 2.0
gi|23613679|ref|NP_704700.1| transporter, putative [Plasmodium f... 33 2.6
gi|17558352|ref|NP_503787.1| protein kinase beta like family mem... 33 2.6
gi|9828634|gb|AAG00257.1| F1N21.5 [Arabidopsis thaliana] 33 2.6
gi|50417102|gb|AAH77134.1| Unknown (protein for MGC:100899) [Dan... 33 2.6
gi|46442223|gb|EAL01514.1| hypothetical protein CaO19.7067 [Cand... 33 2.6
gi|27467827|ref|NP_764464.1| chromosome segregation SMC protein ... 33 2.6
gi|4417214|dbj|BAA36971.1| smooth muscle myosin heavy chain [Hom... 33 2.6
gi|12045072|ref|NP_072883.1| cytadherence accessory protein (hmw... 33 2.6
gi|27806351|ref|NP_776642.1| villin 2; ezrin [Bos taurus] >gnl|B... 33 2.6
gi|13543854|gb|AAH06075.1| Myh9 protein [Mus musculus] 33 2.6
gi|27881642|gb|AAH43703.1| Myh9 protein [Mus musculus] 33 2.6
gi|3205211|gb|AAC19403.1| non-muscle myosin heavy chain [Bos tau... 33 2.6
gi|48131565|ref|XP_393325.1| similar to LP08646p [Apis mellifera] 33 2.6
gi|47208342|emb|CAF88490.1| unnamed protein product [Tetraodon n... 33 2.6
gi|189036|gb|AAA36349.1| nonmuscle myosin heavy chain (NMHC) 33 2.6
gi|46444900|gb|EAL04172.1| hypothetical protein CaO19.12152 [Can... 33 2.6
gi|7441404|pir||T16416 hypothetical protein F52B10.1 - Caenorhab... 33 2.6
gi|46229652|gb|EAK90470.1| hypothetical low complexity protein w... 33 2.6
gi|28277050|gb|AAH44834.1| Myh9 protein [Mus musculus] 33 2.6
gi|13124879|ref|NP_002465.1| smooth muscle myosin heavy chain 11... 33 2.6
gi|41203775|ref|XP_029353.3| KIAA1509 [Homo sapiens] 33 2.6
gi|23478686|gb|EAA15705.1| retinitis pigmentosa GTPase regulator... 33 2.6
gi|21757308|dbj|BAC05084.1| unnamed protein product [Homo sapiens] 33 2.6
gi|13124875|ref|NP_074035.1| smooth muscle myosin heavy chain 11... 33 2.6
gi|46444745|gb|EAL04018.1| hypothetical protein CaO19.4683 [Cand... 33 2.6
gi|39585311|emb|CAE61633.1| Hypothetical protein CBG05563 [Caeno... 33 2.6
gi|15800223|ref|NP_286235.1| Z0639 gene product [Escherichia col... 33 2.6
gi|19745654|ref|NP_606790.1| putative chromosome segregation SMC... 33 2.6
gi|15674632|ref|NP_268806.1| putative chromosome segregation SMC... 33 2.6
gi|40788309|dbj|BAA31610.2| KIAA0635 protein [Homo sapiens] 33 2.6
gi|50510975|dbj|BAD32473.1| mKIAA1537 protein [Mus musculus] 33 2.6
gi|47847498|dbj|BAD21421.1| mFLJ00279 protein [Mus musculus] 33 2.6
gi|625305|pir||A61231 myosin heavy chain nonmuscle form A - human 33 2.6
gi|50083279|ref|NP_079285.2| KIAA0635 gene product [Homo sapiens] 33 2.6
gi|34932421|ref|XP_225706.2| similar to Potential phospholipid-t... 33 2.6
gi|2104553|gb|AAC31665.1| Myosin heavy chain (MHY11) (5'partial)... 33 2.6
gi|27529744|dbj|BAA74889.2| KIAA0866 protein [Homo sapiens] 33 2.6
gi|15220369|ref|NP_176892.1| expressed protein [Arabidopsis thal... 33 2.6
gi|46436261|gb|EAK95626.1| hypothetical protein CaO19.6967 [Cand... 33 2.6
gi|50355643|dbj|BAD29962.1| Be158 [Babesia equi] 33 2.6
gi|45198804|ref|NP_985833.1| AFR286Wp [Eremothecium gossypii] >g... 33 2.6
gi|10835820|pdb|1EKE|A Chain A, Crystal Structure Of Class Ii Ri... 33 2.6
gi|3414963|gb|AAC31543.1| lamin B1 [Xenopus laevis] 33 2.6
gi|27371024|gb|AAH41185.1| Lmnb1-prov protein [Xenopus laevis] 33 2.6
gi|25150354|ref|NP_508504.2| non-muscle myosin (nmy-1) [Caenorha... 33 2.6
gi|23478753|gb|EAA15754.1| hypothetical protein [Plasmodium yoel... 33 2.6
gi|41469274|gb|AAS07156.1| expressed protein [Oryza sativa (japo... 33 2.6
gi|15925636|ref|NP_373170.1| conserved hypothetical protein [Sta... 33 2.6
gi|21284296|ref|NP_647384.1| conserved hypothetical protein [Sta... 33 2.6
gi|20137006|ref|NP_071855.1| myosin heavy chain IX [Mus musculus... 33 2.6
gi|12667788|ref|NP_002464.1| myosin, heavy polypeptide 9, non-mu... 33 2.6
gi|12311863|emb|CAC22679.1| AMP deaminase [Leishmania major] 33 2.6
gi|27468046|ref|NP_764683.1| ebhA protein [Staphylococcus epider... 33 2.6
gi|15644885|ref|NP_207055.1| conserved hypothetical secreted pro... 33 2.6
gi|48109395|ref|XP_396232.1| similar to CG6450-PC [Apis mellifera] 33 3.4
gi|48823956|ref|ZP_00285407.1| COG3595: Uncharacterized conserve... 33 3.4
gi|47206494|emb|CAF92339.1| unnamed protein product [Tetraodon n... 33 3.4
gi|46227154|gb|EAK88104.1| large protein with signal peptide [Cr... 33 3.4
gi|13022022|gb|AAK11612.1| M ST4547 protein [Streptococcus pyoge... 33 3.4
gi|23508775|ref|NP_701443.1| hypothetical protein [Plasmodium fa... 33 3.4
gi|38090467|ref|XP_125625.2| RIKEN cDNA 4930589M24 [Mus musculus] 33 3.4
gi|2119280|pir||I84737 kinesin heavy chain - mouse (fragment) >g... 33 3.4
gi|24657245|ref|NP_728938.1| CG14998-PB [Drosophila melanogaster... 33 3.4
gi|28830063|gb|AAO52553.1| similar to Plasmodium falciparum. Hyp... 33 3.4
gi|18310227|ref|NP_562161.1| conserved hypothetical protein [Clo... 33 3.4
gi|47205442|emb|CAG05719.1| unnamed protein product [Tetraodon n... 33 3.4
gi|24657240|ref|NP_647861.1| CG14998-PC [Drosophila melanogaster... 33 3.4
gi|47458947|ref|YP_015809.1| heat shock protein GrpE [Mycoplasma... 33 3.4
gi|28211781|ref|NP_782725.1| ethanolamine utilization protein eu... 33 3.4
gi|24954555|gb|AAN64676.1| M protein [Streptococcus pyogenes] 33 3.4
gi|24654769|ref|NP_523873.2| CG17046-PA [Drosophila melanogaster... 33 3.4
gi|24657248|ref|NP_728939.1| CG14998-PE [Drosophila melanogaster... 33 3.4
gi|45187836|ref|NP_984059.1| ADL037Wp [Eremothecium gossypii] >g... 33 3.4
gi|23956210|ref|NP_081701.1| RUN and FYVE domain-containing 2; d... 33 3.4
gi|33636643|gb|AAQ23619.1| LD09626p [Drosophila melanogaster] 33 3.4
gi|39581846|emb|CAE60739.1| Hypothetical protein CBG04423 [Caeno... 33 3.4
gi|12853633|dbj|BAB29801.1| unnamed protein product [Mus musculus] 33 3.4
gi|6981236|ref|NP_037326.1| myosin, heavy polypeptide 9; Myosin,... 33 3.4
gi|47206541|emb|CAF94034.1| unnamed protein product [Tetraodon n... 33 3.4
gi|15238474|ref|NP_200769.1| DNAJ heat shock N-terminal domain-c... 33 3.4
gi|17902245|gb|AAL47844.1| EZRIN [Rattus norvegicus] 33 3.4
gi|33589488|gb|AAQ22511.1| LD36052p [Drosophila melanogaster] 33 3.4
gi|24657256|ref|NP_728941.1| CG14998-PA [Drosophila melanogaster... 33 3.4
gi|4758648|ref|NP_004512.1| kinesin family member 5B; kinesin 1 ... 33 3.4
gi|50748282|ref|XP_429303.1| PREDICTED: hypothetical protein XP_... 33 3.4
gi|6680572|ref|NP_032474.1| kinesin family member 5B; kinesin he... 33 3.4
gi|42524115|ref|NP_969495.1| hypothetical protein predicted by G... 33 3.4
gi|15645080|ref|NP_207250.1| conserved hypothetical protein [Hel... 33 3.4
gi|50303551|ref|XP_451717.1| unnamed protein product [Kluyveromy... 33 3.4
gi|24657252|ref|NP_728940.1| CG14998-PD [Drosophila melanogaster... 33 3.4
gi|50749086|ref|XP_426482.1| PREDICTED: similar to ninein isofor... 33 3.4
gi|47216947|emb|CAG04889.1| unnamed protein product [Tetraodon n... 33 3.4
gi|49119563|gb|AAH73107.1| Unknown (protein for MGC:83587) [Xeno... 33 3.4
gi|21909912|ref|NP_664180.1| putative chromosome condensation an... 33 3.4
gi|24654105|ref|NP_611111.1| CG9068-PA [Drosophila melanogaster]... 33 3.4
gi|37533374|ref|NP_920989.1| putative synaptonemal complex prote... 33 4.4
gi|49486190|ref|YP_043411.1| putative exonuclease [Staphylococcu... 33 4.4
gi|21282962|ref|NP_646050.1| ORFID:MW1233~hypothetical protein, ... 33 4.4
gi|24643299|ref|NP_728269.1| CG14217-PB [Drosophila melanogaster... 33 4.4
gi|47221022|emb|CAG12716.1| unnamed protein product [Tetraodon n... 33 4.4
gi|47222846|emb|CAF96513.1| unnamed protein product [Tetraodon n... 33 4.4
gi|7487525|pir||T01362 probable myosin heavy chain At2g34730 - A... 33 4.4
gi|29250049|gb|EAA41549.1| GLP_546_13955_10599 [Giardia lamblia ... 33 4.4
gi|18767382|gb|AAL79348.1| Putative synaptonemal complex protein... 33 4.4
gi|50293907|ref|XP_449365.1| unnamed protein product [Candida gl... 33 4.4
gi|41222990|emb|CAF18935.1| putative secreted membrane-fusion pr... 33 4.4
gi|23491313|gb|EAA22880.1| Mus musculus GCN2alpha [Plasmodium yo... 33 4.4
gi|50760745|ref|XP_418115.1| PREDICTED: similar to NDP52 [Gallus... 33 4.4
gi|20093808|ref|NP_613655.1| tRNA/rRNA cytosine-C5-methylase [Me... 33 4.4
gi|46441945|gb|EAL01238.1| hypothetical protein CaO19.7895 [Cand... 33 4.4
gi|26330558|dbj|BAC29009.1| unnamed protein product [Mus musculus] 33 4.4
gi|21325768|dbj|BAC00389.1| Membrane-fusion protein [Corynebacte... 33 4.4
gi|31215143|ref|XP_315971.1| ENSANGP00000013531 [Anopheles gambi... 33 4.4
gi|33578097|gb|AAQ22369.1| chromosomal segregation protein [Meth... 33 4.4
gi|16798799|ref|NP_463477.1| putative tape-measure protein [Bact... 33 4.4
gi|47216384|emb|CAG02442.1| unnamed protein product [Tetraodon n... 33 4.4
gi|25150872|ref|NP_506347.2| similar to early endosome-associate... 33 4.4
gi|48764674|ref|ZP_00269225.1| COG2854: ABC-type transport syste... 33 4.4
gi|15238181|ref|NP_198994.1| COP1-interactive protein 1 / CIP1 [... 33 4.4
gi|24643294|ref|NP_728267.1| CG14217-PD [Drosophila melanogaster... 33 4.4
gi|7507640|pir||T24806 hypothetical protein T10G3.5 - Caenorhabd... 33 4.4
gi|30686193|ref|NP_181020.2| myosin heavy chain-related [Arabido... 33 4.4
gi|33601214|ref|NP_888774.1| putative phage tail protein [Bordet... 33 4.4
gi|4894766|gb|AAD32609.1| phospholipid phospholipase C beta isof... 33 4.4
gi|19074240|ref|NP_584846.1| similarity to transcription initiat... 33 4.4
gi|46441807|gb|EAL01101.1| hypothetical protein CaO19.262 [Candi... 33 4.4
gi|5174457|ref|NP_006092.1| kinetochore associated 2; highly exp... 33 4.4
gi|21229113|ref|NP_635035.1| hypothetical protein MM3011 [Methan... 33 4.4
gi|20978622|sp|Q96YR5|RA50_SULTO DNA double-strand break repair ... 33 4.4
gi|42733831|gb|AAS38749.1| similar to Arabidopsis thaliana (Mous... 33 4.4
gi|27923756|sp|Q9PTD7|CING_XENLA Cingulin 33 4.4
gi|34485680|gb|AAQ73225.1| M protein [Streptococcus pyogenes] 33 4.4
gi|34856033|ref|XP_218617.2| similar to nonmuscle myosin heavy c... 33 4.4
gi|15922434|ref|NP_378103.1| 882aa long hypothetical purine NTPa... 33 4.4
gi|49078882|ref|XP_403148.1| hypothetical protein UM05533.1 [Ust... 33 4.4
gi|116130|sp|P25734|CFAE_ECOLI CFA/I FIMBRIAL SUBUNIT E (COLONIZ... 33 4.4
gi|17551408|ref|NP_510666.1| ecotropic viral integration site 5 ... 33 4.4
gi|32363497|sp|P26040|EZRI_MOUSE Ezrin (p81) (Cytovillin) (Villi... 33 4.4
gi|15611121|ref|NP_222772.1| putative [Helicobacter pylori J99] ... 33 4.4
gi|4239734|emb|CAA10769.1| hypothetical protein [Cryptosporidium... 33 4.4
gi|12832989|dbj|BAB22341.1| unnamed protein product [Mus musculus] 33 4.4
gi|13022045|gb|AAK11617.1| M18 protein [Streptococcus pyogenes] 33 4.4
gi|38605794|emb|CAD39990.3| OSJNBb0045P24.8 [Oryza sativa (japon... 33 4.4
gi|38107206|gb|EAA53413.1| hypothetical protein MG07690.4 [Magna... 33 4.4
gi|48105414|ref|XP_393011.1| similar to CG32394-PA [Apis mellifera] 33 4.4
gi|6636514|gb|AAF20208.1| cingulin [Xenopus laevis] 33 4.4
gi|46137317|ref|XP_390350.1| hypothetical protein FG10174.1 [Gib... 33 4.4
gi|45199155|ref|NP_986184.1| AFR637Wp [Eremothecium gossypii] >g... 33 4.4
gi|50732309|ref|XP_418574.1| PREDICTED: similar to Kinesin heavy... 33 4.4
gi|19554189|ref|NP_602191.1| efflux system protein [Corynebacter... 33 4.4
gi|126669|sp|P02977|M5_STRP5 M protein, serotype 5 precursor >gn... 33 4.4
gi|19920342|ref|NP_608319.1| CG14217-PA [Drosophila melanogaster... 33 4.4
gi|6682323|emb|CAB64664.1| catchin protein [Mytilus galloprovinc... 32 5.8
gi|127774|sp|P08799|MYS2_DICDI Myosin II heavy chain, non muscle... 32 5.8
gi|15924336|ref|NP_371870.1| hypothetical protein SAV1346 [Staph... 32 5.8
gi|33638127|gb|AAQ24173.1| nonmuscle myosin II-C heavy chain [Mu... 32 5.8
gi|39591119|emb|CAE58899.1| Hypothetical protein CBG02149 [Caeno... 32 5.8
gi|46228439|gb|EAK89309.1| hypothetical protein cgd8_770 [Crypto... 32 5.8
gi|32418700|ref|XP_329828.1| hypothetical protein [Neurospora cr... 32 5.8
gi|47214667|emb|CAG00903.1| unnamed protein product [Tetraodon n... 32 5.8
gi|19553437|ref|NP_601439.1| Zn-ribbon protein [Corynebacterium ... 32 5.8
gi|340217|gb|AAA61278.1| cytovillin 2 32 5.8
gi|3551531|dbj|BAA33016.1| avena [Gallus gallus] 32 5.8
gi|345377|pir||A45627 myosin heavy chain [similarity] - nematode... 32 5.8
gi|23619240|ref|NP_705202.1| hypothetical protein [Plasmodium fa... 32 5.8
gi|11276953|pir||A59294 skeletal myosin - nematode (Onchocerca v... 32 5.8
gi|19172976|ref|NP_597527.1| hypothetical protein [Encephalitozo... 32 5.8
gi|5410593|gb|AAD43129.1| klarsicht protein [Drosophila melanoga... 32 5.8
gi|49097316|ref|XP_410118.1| hypothetical protein AN5981.2 [Aspe... 32 5.8
gi|50419037|ref|XP_458040.1| unnamed protein product [Debaryomyc... 32 5.8
gi|18641360|ref|NP_569057.1| collectin sub-family member 12 isof... 32 5.8
gi|25392184|pir||JC7595 scavenger receptor with C-type lectin ty... 32 5.8
gi|38174510|gb|AAH60789.1| Collectin sub-family member 12, isofo... 32 5.8
gi|24308073|ref|NP_056281.1| protein tyrosine phosphatase, non-r... 32 5.8
gi|6682319|emb|CAB64662.1| myosin heavy chain [Mytilus galloprov... 32 5.8
gi|477266|pir||A48467 myosin heavy chain - nematode (Brugia mala... 32 5.8
gi|23509074|ref|NP_701742.1| hypothetical protein [Plasmodium fa... 32 5.8
gi|16120118|ref|NP_395706.1| Vng6173c [Halobacterium sp. NRC-1] ... 32 5.8
gi|11276951|pir||A59287 myosin heavy chain - fluke (Schistosoma ... 32 5.8
gi|26328689|dbj|BAC28083.1| unnamed protein product [Mus musculus] 32 5.8
gi|29336026|ref|NP_082297.1| nonmuscle myosin heavy chain [Mus m... 32 5.8
gi|21614499|ref|NP_003370.2| villin 2; ezrin; cytovillin [Homo s... 32 5.8
gi|46249758|gb|AAH68458.1| Villin 2 [Homo sapiens] 32 5.8
gi|39644964|gb|AAH27711.2| PTPN23 protein [Homo sapiens] 32 5.8
gi|119717|sp|P15311|EZRI_HUMAN Ezrin (p81) (Cytovillin) (Villin ... 32 5.8
gi|34860830|ref|XP_221882.2| similar to Interferon-induced guany... 32 5.8
gi|34880469|ref|XP_222745.2| similar to nuclear pore complex-ass... 32 5.8
gi|20521926|dbj|BAA95995.2| KIAA1471 protein [Homo sapiens] 32 5.8
gi|26553608|ref|NP_757542.1| predicted cytoskeletal protein [Myc... 32 5.8
gi|50761569|ref|XP_424768.1| PREDICTED: similar to Homer protein... 32 5.8
gi|32401469|ref|NP_780423.2| kinesin-related protein KIF27 [Mus ... 32 5.8
gi|24378962|ref|NP_720917.1| conserved hypothetical protein [Str... 32 5.8
gi|11276938|pir||T47177 hypothetical protein DKFZp762H157.1 - hu... 32 5.8
gi|31199853|ref|XP_308874.1| ENSANGP00000005723 [Anopheles gambi... 32 5.8
gi|15791440|ref|NP_281263.1| hypothetical protein Cj0041 [Campyl... 32 5.8
gi|13365553|dbj|BAB39148.1| scavenger receptor with C-type lecti... 32 5.8
gi|18641358|ref|NP_110408.2| collectin sub-family member 12 isof... 32 5.8
gi|47228073|emb|CAF97702.1| unnamed protein product [Tetraodon n... 32 5.8
gi|4759198|ref|NP_004263.1| homer 1; Homer, neuronal immediate e... 32 7.6
gi|38102536|gb|EAA49364.1| hypothetical protein MG01022.4 [Magna... 32 7.6
gi|16804326|ref|NP_465811.1| putative tape-measure [Bacteriopha... 32 7.6
gi|3366655|gb|AAC27989.1| granule lattice protein 5 precursor; G... 32 7.6
gi|423123|pir||S33124 tpr protein - human 32 7.6
gi|47230617|emb|CAF99810.1| unnamed protein product [Tetraodon n... 32 7.6
gi|20985496|ref|XP_142131.1| similar to dystrophin-related prote... 32 7.6
gi|11602810|dbj|BAB18909.1| avenaII [Gallus gallus] 32 7.6
gi|13272546|gb|AAK17202.1| major plasmodial myosin heavy chain [... 32 7.6
gi|21724197|gb|AAM28348.1| EIF3 [Culicoides sonorensis] 32 7.6
gi|24641414|ref|NP_572750.2| CG32662-PA [Drosophila melanogaster... 32 7.6
gi|47215978|emb|CAF96380.1| unnamed protein product [Tetraodon n... 32 7.6
gi|15221736|ref|NP_176519.1| expressed protein [Arabidopsis thal... 32 7.6
gi|15233233|ref|NP_188213.1| phox (PX) domain-containing protein... 32 7.6
gi|32307021|gb|AAP78991.1| IpaB [Shigella flexneri] 32 7.6
gi|4507659|ref|NP_003283.1| translocated promoter region (to act... 32 7.6
gi|26329907|dbj|BAC28692.1| unnamed protein product [Mus musculus] 32 7.6
gi|23509886|ref|NP_702553.1| biotin carboxylase subunit of acet... 32 7.6
gi|50291569|ref|XP_448217.1| unnamed protein product [Candida gl... 32 7.6
gi|37534302|ref|NP_921453.1| putative mutator-like transposase [... 32 7.6
gi|37258|emb|CAA44819.1| Tpr [Homo sapiens] 32 7.6
gi|47226837|emb|CAG06679.1| unnamed protein product [Tetraodon n... 32 7.6
gi|23510098|ref|NP_702764.1| hypothetical protein [Plasmodium fa... 32 7.6
gi|27260894|gb|AAN86047.1| heat shock cognate 70 protein [Spodop... 32 7.6
gi|47213146|emb|CAF93836.1| unnamed protein product [Tetraodon n... 32 7.6
gi|23619563|ref|NP_705525.1| hypothetical protein [Plasmodium fa... 32 7.6
gi|23510041|ref|NP_702707.1| sequestrin [Plasmodium falciparum 3... 32 7.6
gi|45383916|ref|NP_034208.1| dystrophin related protein 2 [Mus m... 32 7.6
gi|23483016|gb|EAA18823.1| hypothetical protein [Plasmodium yoel... 32 7.6
gi|18402909|ref|NP_565741.1| expressed protein [Arabidopsis thal... 32 7.6
gi|28396179|gb|AAO38999.1| HOMER1E [Homo sapiens] 32 7.6
gi|16758964|ref|NP_445762.1| homer, neuronal immediate early gen... 32 7.6
gi|42733891|gb|AAS38807.1| hypothetical protein [Dictyostelium d... 32 7.6
gi|39583889|emb|CAE63979.1| Hypothetical protein CBG08571 [Caeno... 32 7.6
gi|32414701|ref|XP_327830.1| hypothetical protein [Neurospora cr... 32 7.6
gi|46438349|gb|EAK97681.1| hypothetical protein CaO19.10929 [Can... 32 7.6
gi|280616|pir||A37103 lamin precursor - fruit fly (Drosophila me... 32 7.6
gi|28396185|gb|AAO39000.1| HOMER1F [Homo sapiens] 32 7.6
gi|49115503|gb|AAH73415.1| Unknown (protein for MGC:80881) [Xeno... 32 7.6
gi|50757619|ref|XP_415580.1| PREDICTED: similar to myosin, heavy... 32 7.6
gi|22036232|gb|AAM89536.1| IpaB [Shigella flexneri] 32 7.6
gi|16304363|gb|AAL15027.1| Sup35p [Saccharomyces paradoxus] 32 7.6
gi|1345860|sp|P49025|CTRO_MOUSE Citron protein (Rho-interacting,... 32 7.6
gi|22036254|gb|AAM89547.1| IpaB [Shigella dysenteriae] 32 7.6
gi|22036206|gb|AAM89523.1| IpaB [Shigella boydii] >gnl|BL_ORD_ID... 32 7.6
gi|22036218|gb|AAM89529.1| IpaB [Shigella boydii] >gnl|BL_ORD_ID... 32 7.6
gi|22036294|gb|AAM89567.1| IpaB [Shigella sonnei] 32 7.6
gi|22036220|gb|AAM89530.1| IpaB [Shigella boydii] 32 7.6
gi|22036208|gb|AAM89524.1| IpaB [Shigella boydii] >gnl|BL_ORD_ID... 32 7.6
gi|48863086|ref|ZP_00316980.1| COG0419: ATPase involved in DNA r... 32 7.6
gi|46133363|ref|ZP_00157068.2| COG2352: Phosphoenolpyruvate carb... 32 7.6
gi|50424829|ref|XP_461004.1| unnamed protein product [Debaryomyc... 32 7.6
gi|23121671|ref|ZP_00103892.1| COG1196: Chromosome segregation A... 32 7.6
gi|47217178|emb|CAG11014.1| unnamed protein product [Tetraodon n... 32 7.6
gi|18309184|ref|NP_561118.1| probable cell wall-binding protein ... 32 7.6
gi|45822228|emb|CAF32691.1| variable membrane protein precursor ... 32 7.6
>gi|17508765|ref|NP_492345.1| putative nuclear protein, with 2
coiled coil-4 domains, SYnaPsis in meiosis abnormal
SYP-3 (syp-3) [Caenorhabditis elegans]
gi|7503024|pir||T22007 hypothetical protein F39H2.4 -
Caenorhabditis elegans
gi|3876968|emb|CAB03087.1| Hypothetical protein F39H2.4
[Caenorhabditis elegans]
Length = 184
Score = 363 bits (931), Expect = 1e-99
Identities = 184/184 (100%), Positives = 184/184 (100%)
Frame = -1
Query: 555 MRQIETQQLEAETSFTERIAEDRVKCAAQRESLERQLQDLTATDNKLSEQKRDWEERQEK 376
MRQIETQQLEAETSFTERIAEDRVKCAAQRESLERQLQDLTATDNKLSEQKRDWEERQEK
Sbjct: 1 MRQIETQQLEAETSFTERIAEDRVKCAAQRESLERQLQDLTATDNKLSEQKRDWEERQEK 60
Query: 375 AYDELMSYLENEDVDSAGTQFGDHFNSLIKSMNNLSHDSMNGQFNSLKNNLDELNIEKKQ 196
AYDELMSYLENEDVDSAGTQFGDHFNSLIKSMNNLSHDSMNGQFNSLKNNLDELNIEKKQ
Sbjct: 61 AYDELMSYLENEDVDSAGTQFGDHFNSLIKSMNNLSHDSMNGQFNSLKNNLDELNIEKKQ 120
Query: 195 LEVAIADQSSTISEMIPSLRPTCGATYKERNTLRIIFHYQVAKLRSEYQKCRLQEEALKA 16
LEVAIADQSSTISEMIPSLRPTCGATYKERNTLRIIFHYQVAKLRSEYQKCRLQEEALKA
Sbjct: 121 LEVAIADQSSTISEMIPSLRPTCGATYKERNTLRIIFHYQVAKLRSEYQKCRLQEEALKA 180
Query: 15 RLST 4
RLST
Sbjct: 181 RLST 184