Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F40F4_7
(486 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17568901|ref|NP_508558.1| lipid Binding Protein LBP-2, fatty ... 266 2e-70
gi|17568899|ref|NP_508557.1| lipid Binding Protein LBP-1, fatty ... 210 8e-54
gi|39597708|emb|CAE68399.1| Hypothetical protein CBG14168 [Caeno... 206 1e-52
gi|39597709|emb|CAE68400.1| Hypothetical protein CBG14170 [Caeno... 191 5e-48
gi|25150208|ref|NP_508556.2| lipid Binding Protein LBP-3, fatty ... 123 1e-27
gi|7503066|pir||T16308 hypothetical protein F40F4.4 - Caenorhabd... 119 2e-26
gi|2494409|sp|Q20222|FAB3_CAEEL Fatty acid-binding protein homol... 119 2e-26
gi|39597707|emb|CAE68398.1| Hypothetical protein CBG14167 [Caeno... 114 1e-24
gi|2494406|sp|P55776|FABH_ASCSU Fatty acid-binding protein homol... 106 2e-22
gi|17562592|ref|NP_505016.1| lipid Binding Protein LBP-4, fatty ... 102 3e-21
gi|39581097|emb|CAE73175.1| Hypothetical protein CBG20572 [Caeno... 99 5e-20
gi|38176540|gb|AAG09305.3| embryonic fatty acid-binding protein ... 95 7e-19
gi|34783929|gb|AAH56855.1| MGC64521 protein [Xenopus laevis] 51 8e-06
gi|8176557|dbj|BAA92241.3| heart fatty acid binding protein [Ang... 50 2e-05
gi|127724|sp|P02690|MYP2_BOVIN Myelin P2 protein >gnl|BL_ORD_ID|... 46 3e-04
gi|49257292|gb|AAH72965.1| Unknown (protein for MGC:82505) [Xeno... 46 3e-04
gi|15072477|gb|AAK61550.1| heart-type fatty acid-binding protein... 45 6e-04
gi|127727|sp|P02691|MYP2_RABIT Myelin P2 protein >gnl|BL_ORD_ID|... 45 8e-04
gi|4505909|ref|NP_002668.1| peripheral myelin protein 2; M-FABP ... 45 8e-04
gi|45383556|ref|NP_989621.1| fatty acid binding protein 4, adipo... 44 0.001
gi|18874532|gb|AAL79836.1| adipocyte fatty acid-binding protein ... 44 0.001
gi|33356927|pdb|1G74|A Chain A, Toward Changing Specificity: Adi... 44 0.002
gi|34854980|ref|XP_342215.1| similar to myelin P2 protein - mous... 42 0.007
gi|127726|sp|P24526|MYP2_MOUSE Myelin P2 protein >gnl|BL_ORD_ID|... 42 0.007
gi|38076194|ref|XP_357279.1| similar to myelin P2 protein - mous... 42 0.007
gi|47222259|emb|CAG11138.1| unnamed protein product [Tetraodon n... 40 0.015
gi|387504|gb|AAA39870.1| adipocyte P2 40 0.015
gi|14423683|sp|O97788|FABA_PIG Fatty acid-binding protein, adipo... 40 0.015
gi|4557579|ref|NP_001433.1| fatty acid binding protein 4, adipoc... 40 0.015
gi|30584397|gb|AAP36447.1| Homo sapiens fatty acid binding prote... 40 0.015
gi|2811080|sp|O13008|FABH_ONCMY Fatty acid-binding protein, hear... 40 0.015
gi|442633|pdb|1ALB| Adipocyte Lipid-Binding Protein >gnl|BL_ORD... 40 0.019
gi|13242739|gb|AAB32592.2| myelin P2 protein [Homo sapiens] 40 0.019
gi|3318748|pdb|1A18| Phenanthroline Modified Murine Adipocyte L... 40 0.019
gi|14149635|ref|NP_077717.1| fatty acid binding protein 4, adipo... 40 0.019
gi|40804425|gb|AAR91708.1| muscle fatty acid binding protein [Sa... 40 0.019
gi|38541378|gb|AAH61929.1| MGC68491 protein [Xenopus laevis] 40 0.025
gi|20138311|sp|Q99P61|FABH_SPETR Fatty acid-binding protein, hea... 40 0.025
gi|18378600|gb|AAL68638.1| cellular retinoic acid/retinol bindin... 40 0.025
gi|50731654|ref|XP_418309.1| PREDICTED: similar to Myelin P2 pro... 39 0.033
gi|6601500|gb|AAF19003.1| fatty acid-binding protein [Rattus nor... 39 0.033
gi|23308625|ref|NP_694493.1| fatty acid binding protein 3, muscl... 39 0.033
gi|24645979|ref|NP_731589.1| CG31305-PI [Drosophila melanogaster... 39 0.056
gi|47550907|ref|NP_999972.1| fatty acid binding protein 7, brain... 39 0.056
gi|34854891|ref|XP_346620.1| hypothetical protein XP_346619 [Rat... 39 0.056
gi|2494405|sp|P70623|FABA_RAT Fatty acid-binding protein, adipoc... 39 0.056
gi|2738180|gb|AAC60355.1| fatty acid binding protein H6-isoform ... 39 0.056
gi|2738170|gb|AAC60350.1| fatty acid binding protein H6-isoform ... 39 0.056
gi|25013110|gb|AAN71654.1| SD12036p [Drosophila melanogaster] 39 0.056
gi|16758094|ref|NP_445817.1| fatty acid binding protein 4; fatty... 39 0.056
gi|39595764|emb|CAE67267.1| Hypothetical protein CBG12714 [Caeno... 39 0.056
gi|47216139|emb|CAG10013.1| unnamed protein product [Tetraodon n... 38 0.073
gi|2738178|gb|AAC60354.1| fatty acid binding protein H6-isoform ... 38 0.073
gi|2738174|gb|AAC60352.1| fatty acid binding protein H6-isoform ... 38 0.073
gi|17508245|ref|NP_491926.1| lipid Binding Protein LBP-6, adipoc... 38 0.073
gi|2392054|pdb|1ACD| V32dF57H MUTANT OF MURINE ADIPOCYTE LIPID ... 38 0.095
gi|6015123|sp|Q09139|FABB_BOVIN Fatty acid-binding protein, brai... 38 0.095
gi|42658985|ref|XP_378035.1| similar to fatty acid binding prote... 38 0.095
gi|2392041|pdb|1AB0| C1gV32DF57H MUTANT OF MURINE ADIPOCYTE LIP... 38 0.095
gi|20138310|sp|Q99P60|FABA_SPETR Fatty acid-binding protein, adi... 38 0.095
gi|2494403|sp|Q91775|FABI_XENLA Fatty acid-binding protein, inte... 37 0.12
gi|6753810|ref|NP_034304.1| fatty acid binding protein 3, muscle... 37 0.12
gi|32450317|gb|AAH53830.1| Unknown (protein for IMAGE:6873358) [... 37 0.16
gi|49618768|gb|AAT67999.1| fatty acid-binding protein [Gallus ga... 37 0.16
gi|51267|emb|CAA33084.1| unnamed protein product [Mus musculus] 37 0.16
gi|39590475|emb|CAE66215.1| Hypothetical protein CBG11457 [Caeno... 37 0.16
gi|17508243|ref|NP_491928.1| lipid Binding Protein LBP-5, adipoc... 37 0.16
gi|90268|pir||B25952 myelin P2 protein homolog - mouse >gnl|BL_O... 37 0.21
gi|13162363|ref|NP_077076.1| heart fatty acid binding protein; f... 37 0.21
gi|28629197|gb|AAO49500.1| heart-type fatty acid binding protein... 37 0.21
gi|40254574|ref|NP_035728.2| fatty acid binding protein 9, testi... 36 0.28
gi|27805811|ref|NP_776739.1| fatty acid-binding protein, adipocy... 36 0.28
gi|24645977|ref|NP_731588.1| CG31305-PJ [Drosophila melanogaster... 36 0.28
gi|4557581|ref|NP_001435.1| fatty acid binding protein 5 (psoria... 36 0.28
gi|39939390|gb|AAR32738.1| fatty acid-binding protein [Capra hir... 36 0.28
gi|1869803|emb|CAA71305.1| mammary-derived growth inhibitor [Hom... 36 0.28
gi|17562594|ref|NP_506440.1| lipid Binding Protein LBP-7, fatty ... 36 0.28
gi|41202667|ref|XP_370729.1| similar to Fatty acid-binding prote... 36 0.36
gi|33504499|ref|NP_878278.1| cellular retinoic acid binding prot... 36 0.36
gi|6729922|pdb|1BWY|A Chain A, Nmr Study Of Bovine Heart Fatty A... 36 0.36
gi|227994|prf||1714345A fatty acid-binding protein 36 0.36
gi|494781|pdb|2HMB| Fatty Acid Binding Protein (Holo Form, Huma... 36 0.36
gi|30584517|gb|AAP36511.1| Homo sapiens fatty acid binding prote... 36 0.36
gi|27805805|ref|NP_776740.1| fatty acid binding protein 5; epide... 36 0.36
gi|47115839|sp|Q8MUC1|FABP_CLOSI Fatty acid-binding protein >gnl... 36 0.36
gi|27805809|ref|NP_776738.1| fatty acid binding protein ( heart ... 36 0.36
gi|4758328|ref|NP_004093.1| fatty acid binding protein 3; Fatty ... 36 0.36
gi|50759293|ref|XP_417606.1| PREDICTED: similar to retinol bindi... 35 0.47
gi|22024394|ref|NP_665885.1| fatty acid binding protein 5, epide... 35 0.47
gi|39595763|emb|CAE67266.1| Hypothetical protein CBG12713 [Caeno... 35 0.47
gi|2811020|sp|O02772|FABH_PIG Fatty acid-binding protein, heart ... 35 0.47
gi|4887137|gb|AAD32209.1| adipocyte lipid-binding protein [Oryct... 35 0.61
gi|6679737|ref|NP_032006.1| fatty acid binding protein 2, intest... 35 0.61
gi|4826720|ref|NP_000125.1| intestinal fatty acid binding protei... 35 0.61
gi|6730031|pdb|3IFB|A Chain A, Nmr Study Of Human Intestinal Fat... 35 0.61
gi|33357254|pdb|1KZW|A Chain A, Solution Structure Of Human Inte... 35 0.61
gi|33357255|pdb|1KZX|A Chain A, Solution Structure Of Human Inte... 35 0.61
gi|1706754|sp|P55053|FABE_RAT Fatty acid-binding protein, epider... 35 0.61
gi|1836058|gb|AAB46848.1| DA11 [Rattus sp.] 35 0.61
gi|38089194|ref|XP_194404.2| similar to keratinocyate lipid-bind... 35 0.61
gi|15826067|pdb|1FDQ|A Chain A, Crystal Structure Of Human Brain... 35 0.80
gi|24987402|pdb|1JJX|A Chain A, Solution Structure Of Recombinan... 35 0.80
gi|4557585|ref|NP_001437.1| fatty acid binding protein 7, brain;... 35 0.80
gi|2605596|dbj|BAA23324.1| fatty acid binding protein [Homo sapi... 35 0.80
gi|48146231|emb|CAG33338.1| FABP7 [Homo sapiens] 35 0.80
gi|12224842|emb|CAC21646.1| hypothetical protein [Homo sapiens] 35 0.80
gi|6754450|ref|NP_034764.1| fatty acid binding protein 5, epider... 35 0.80
gi|19112618|ref|NP_595826.1| hypothetical coiled-coil protein [S... 35 0.80
gi|40217926|gb|AAR82892.1| cellular retinoic acid-binding protei... 35 0.80
gi|27531025|dbj|BAC54131.1| fatty acid binding protein [Apis mel... 34 1.0
gi|47225916|emb|CAF98396.1| unnamed protein product [Tetraodon n... 34 1.0
gi|48095042|ref|XP_392225.1| similar to fatty acid binding prote... 34 1.0
gi|38112691|gb|AAR11382.1| retinoic acid-binding protein I [Hipp... 34 1.0
gi|494202|pdb|1ICN| Intestinal Fatty Acid Binding Protein Mutan... 34 1.4
gi|7546449|pdb|1DC9|A Chain A, Properties And Crystal Structure ... 34 1.4
gi|230028|pdb|1IFB| Intestinal Fatty Acid Binding Protein (Apo ... 34 1.4
gi|12408304|ref|NP_074045.1| testis lipid binding protein [Rattu... 34 1.4
gi|6978827|ref|NP_037200.1| fatty acid binding protein 1; Fatty ... 34 1.4
gi|1079391|pir||A61629 retinoic acid-binding protein, cellular I... 33 1.8
gi|46115290|ref|XP_383663.1| hypothetical protein FG03487.1 [Gib... 33 1.8
gi|14423714|sp|Q9U5P1|FABP_LEPDS Fatty acid-binding protein (All... 33 1.8
gi|10946572|ref|NP_067247.1| fatty acid binding protein 7, brain... 33 1.8
gi|47209311|emb|CAF90734.1| unnamed protein product [Tetraodon n... 33 1.8
gi|2738184|gb|AAC60357.1| fatty acid binding protein H8-isoform ... 33 1.8
gi|191493|gb|AAA37112.1| 13K protein 33 1.8
gi|1293786|gb|AAB41297.1| LP2 33 2.3
gi|6093953|sp|O42386|RET3_FUGRU Retinoic acid-binding protein I,... 33 2.3
gi|17562596|ref|NP_506444.1| predicted CDS, lipid Binding Protei... 33 3.0
gi|13540630|ref|NP_110459.1| brain lipid binding protein; fatty ... 33 3.0
gi|2811070|sp|O08716|TLBP_MOUSE Testis lipid binding protein (TL... 33 3.0
gi|47229947|emb|CAG10361.1| unnamed protein product [Tetraodon n... 33 3.0
gi|2738182|gb|AAC60356.1| fatty acid binding protein H8-isoform ... 33 3.0
gi|2738188|gb|AAC60359.1| fatty acid binding protein H8-isoform ... 33 3.0
gi|50311085|ref|XP_455566.1| unnamed protein product [Kluyveromy... 32 4.0
gi|11968156|ref|NP_071303.1| retinol binding protein 7, cellular... 32 4.0
gi|17541474|ref|NP_502253.1| no mechanoreceptor potential A like... 32 4.0
gi|1421291|pdb|1CBI|A Chain A, Apo-Cellular Retinoic Acid Bindin... 32 4.0
gi|999883|pdb|1CBR|A Chain A, Cellular Retinoic-Acid-Binding Pro... 32 4.0
gi|4758052|ref|NP_004369.1| cellular retinoic acid binding prote... 32 4.0
gi|48146151|emb|CAG33298.1| CRABP1 [Homo sapiens] 32 4.0
gi|18314500|gb|AAH22069.1| CRABP1 protein [Homo sapiens] 32 4.0
gi|7304975|ref|NP_038524.1| cellular retinoic acid binding prote... 32 4.0
gi|50286729|ref|XP_445794.1| unnamed protein product [Candida gl... 32 4.0
gi|30794346|ref|NP_851371.1| cellular retinoic acid binding prot... 32 4.0
gi|11362263|pir||T46740 microfilarial sheath protein SHP3 [impor... 32 5.2
gi|13094950|gb|AAK12095.1| fatty acid binding protein FABP2 [Ech... 32 5.2
gi|29336919|sp|Q9BMK3|FAB2_ECHGR Fatty acid-binding protein homo... 32 5.2
gi|34864173|ref|XP_219951.2| similar to membrane glycoprotein CI... 32 6.8
gi|50752785|ref|XP_413744.1| PREDICTED: similar to Retinoic acid... 32 6.8
gi|39596661|emb|CAE63280.1| Hypothetical protein CBG07659 [Caeno... 31 8.9
gi|48893374|ref|ZP_00326610.1| COG0167: Dihydroorotate dehydroge... 31 8.9
gi|1169596|sp|P41496|FABM_SCHGR Fatty acid-binding protein, musc... 31 8.9
gi|16418455|ref|NP_443192.1| retinol binding protein 7, cellular... 31 8.9
gi|348407|pir||A44870 fatty acid-binding protein, flight muscle ... 31 8.9
gi|9627274|ref|NP_041755.1| early protein [Human papillomavirus ... 31 8.9
gi|38089844|ref|XP_147335.2| similar to keratinocyate lipid-bind... 31 8.9
gi|49227631|ref|NP_001001842.1| cellular retinoic acid binding p... 31 8.9
gi|50746737|ref|XP_420632.1| PREDICTED: similar to intestinal fa... 31 8.9
gi|18858657|ref|NP_571680.1| fatty acid binding protein 7, brain... 31 8.9
gi|39589558|emb|CAE66793.1| Hypothetical protein CBG12153 [Caeno... 31 8.9
gi|49096312|ref|XP_409616.1| hypothetical protein AN5479.2 [Aspe... 31 8.9
>gi|17568901|ref|NP_508558.1| lipid Binding Protein LBP-2, fatty
acid-binding protein like precursor family member (18.8
kD) (lbp-2) [Caenorhabditis elegans]
gi|2494407|sp|Q20224|FAB2_CAEEL Fatty acid-binding protein homolog
2 precursor
gi|7503064|pir||T16310 hypothetical protein F40F4.2 -
Caenorhabditis elegans
gi|1065519|gb|AAA81435.1| Lipid binding protein protein 2
[Caenorhabditis elegans]
Length = 161
Score = 266 bits (679), Expect = 2e-70
Identities = 131/161 (81%), Positives = 131/161 (81%)
Frame = +1
Query: 1 MSSKFLILLAFCGATLVAAEQLPEKFYGTFDLDHSENFDEYLTAKGYGWFTRKLXXXXXX 180
MSSKFLILLAFCGATLVAAEQLPEKFYGTFDLDHSENFDEYLTAKGYGWFTRKL
Sbjct: 1 MSSKFLILLAFCGATLVAAEQLPEKFYGTFDLDHSENFDEYLTAKGYGWFTRKLVTFATF 60
Query: 181 XXXXXXXXXXXLFDYSNLTSKKDVFYKNVQIGSKFEGEGLDNTKHEVTFTLKDGHLFEHH 360
LFDYSNLTSKKDVFYKNVQIGSKFEGEGLDNTKHEVTFTLKDGHLFEHH
Sbjct: 61 KKVFAKNANKNLFDYSNLTSKKDVFYKNVQIGSKFEGEGLDNTKHEVTFTLKDGHLFEHH 120
Query: 361 KPLXXXXXXXXXXXXXFDGDFLIQKMSFNNIEGRRFYKRLP 483
KPL FDGDFLIQKMSFNNIEGRRFYKRLP
Sbjct: 121 KPLEEGESKEETYEYYFDGDFLIQKMSFNNIEGRRFYKRLP 161