Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F40G9_12
(192 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17553338|ref|NP_497175.1| cytochrome C oxidase (6.8 kD) (3A80... 134 4e-31
gi|39588886|emb|CAE69516.1| Hypothetical protein CBG15725 [Caeno... 100 1e-20
gi|24642093|ref|NP_572998.1| CG9065-PA [Drosophila melanogaster]... 85 5e-16
gi|16758308|ref|NP_445992.1| cytochrome c oxidase, subunit XVII ... 83 1e-15
gi|47680384|gb|AAT37154.1| cytochrome c oxidase copper chaperone... 83 1e-15
gi|2829723|sp|P81045|COXS_PIG Cytochrome c oxidase copper chaper... 82 2e-15
gi|10442710|gb|AAG17444.1| cytochrome C oxidase copper chaperone... 82 3e-15
gi|5031645|ref|NP_005685.1| COX17 homolog, cytochrome c oxidase ... 82 3e-15
gi|18400730|ref|NP_566508.1| cytochrome c oxidase copper chapero... 79 3e-14
gi|47497218|dbj|BAD19263.1| putative copper chaperone COX17-1 [O... 79 3e-14
gi|50725970|dbj|BAD33497.1| copper chaperone COX17-1-like protei... 77 8e-14
gi|19113441|ref|NP_596649.1| putative cytochrome c oxidase coppe... 72 4e-12
gi|15219166|ref|NP_175711.1| cytochrome c oxidase copper chapero... 70 2e-11
gi|21536915|gb|AAM61247.1| cytochrome C oxidase assembly protein... 68 6e-11
gi|23508055|ref|NP_700725.1| hypothetical protein [Plasmodium fa... 65 4e-10
gi|9022433|gb|AAF82382.1| putative copper chaperone Cox17 [Chlam... 65 4e-10
gi|32187007|gb|AAP73466.1| cytochrome C oxidase copper chaperone... 63 2e-09
gi|50729594|ref|XP_425526.1| PREDICTED: similar to Cytochrome c ... 63 2e-09
gi|50254965|gb|EAL17705.1| hypothetical protein CNBL2200 [Crypto... 62 3e-09
gi|23478532|gb|EAA15594.1| copper chaperone COX17-1 [Plasmodium ... 61 6e-09
gi|50286451|ref|XP_445654.1| unnamed protein product [Candida gl... 55 5e-07
gi|6323020|ref|NP_013092.1| Copper metallochaperone that shuttle... 52 3e-06
gi|50405513|ref|XP_456392.1| unnamed protein product [Debaryomyc... 52 5e-06
gi|50548943|ref|XP_501942.1| hypothetical protein [Yarrowia lipo... 50 1e-05
gi|50311521|ref|XP_455785.1| unnamed protein product [Kluyveromy... 50 2e-05
gi|45184663|ref|NP_982381.1| AAL161Wp [Eremothecium gossypii] >g... 47 9e-05
gi|49095078|ref|XP_409000.1| hypothetical protein AN4863.2 [Aspe... 46 2e-04
gi|38109636|gb|EAA55474.1| hypothetical protein MG09281.4 [Magna... 43 0.002
gi|32422571|ref|XP_331729.1| predicted protein [Neurospora crass... 42 0.003
gi|42517032|emb|CAE17996.1| COX17 protein [Podospora anserina] >... 40 0.014
gi|46107346|ref|XP_380732.1| hypothetical protein FG00556.1 [Gib... 39 0.031
gi|47202291|emb|CAF87355.1| unnamed protein product [Tetraodon n... 33 1.3
gi|47211697|emb|CAF90813.1| unnamed protein product [Tetraodon n... 32 3.7
gi|7710074|ref|NP_057919.1| nucleosome binding protein 1; nucleo... 31 6.4
gi|27378213|ref|NP_769742.1| penicillin binding protein [Bradyrh... 31 6.4
gi|5852133|emb|CAB55377.1| putative chaperone [Leishmania major] 31 6.4
gi|32403428|ref|XP_322327.1| predicted protein [Neurospora crass... 31 8.3
>gi|17553338|ref|NP_497175.1| cytochrome C oxidase (6.8 kD) (3A809)
[Caenorhabditis elegans]
gi|7503106|pir||T33630 hypothetical protein F40G9.2 -
Caenorhabditis elegans
gi|3790743|gb|AAC68797.1| Hypothetical protein F40G9.2
[Caenorhabditis elegans]
Length = 63
Score = 134 bits (338), Expect = 4e-31
Identities = 63/63 (100%), Positives = 63/63 (100%)
Frame = +1
Query: 1 MPAEPQKSTEAGSVAPEKKLKACCACPETKRVRDACIIENGEEKCGKLIEAHKACMRAAG 180
MPAEPQKSTEAGSVAPEKKLKACCACPETKRVRDACIIENGEEKCGKLIEAHKACMRAAG
Sbjct: 1 MPAEPQKSTEAGSVAPEKKLKACCACPETKRVRDACIIENGEEKCGKLIEAHKACMRAAG 60
Query: 181 FNI 189
FNI
Sbjct: 61 FNI 63