Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F41B4_5
(987 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|25147648|ref|NP_741823.1| AMPA GLutamate Receptor subunit (gl... 625 e-178
gi|37515237|gb|AAM54176.2| Glutamate receptor family (ampa) prot... 585 e-166
gi|25147645|ref|NP_741822.1| AMPA GLutamate Receptor subunit (gl... 585 e-166
gi|39586756|emb|CAE65798.1| Hypothetical protein CBG10905 [Caeno... 578 e-164
gi|12658342|gb|AAK01098.1| ionotropic glutamate receptor GLR-6 [... 510 e-143
gi|48095742|ref|XP_394523.1| similar to CG11155-PA [Apis mellifera] 234 2e-60
gi|48095735|ref|XP_394522.1| similar to CG11155-PA [Apis mellifera] 223 5e-57
gi|24638809|ref|NP_651941.1| CG11155-PA [Drosophila melanogaster... 221 2e-56
gi|9506755|ref|NP_062182.1| glutamate receptor 6 [Rattus norvegi... 209 6e-53
gi|227861|prf||1712322A Glu receptor 209 6e-53
gi|3287972|sp|P39087|GLK2_MOUSE Glutamate receptor, ionotropic k... 208 2e-52
gi|11386137|ref|NP_068775.1| glutamate receptor 6 isoform 1 prec... 208 2e-52
gi|3287965|sp|P42260|GLK2_RAT Glutamate receptor, ionotropic kai... 208 2e-52
gi|56280|emb|CAA77778.1| kainate receptor [Rattus norvegicus] 208 2e-52
gi|6754074|ref|NP_034479.1| glutamate receptor, ionotropic, kain... 207 2e-52
gi|28559003|ref|NP_786944.1| glutamate receptor 6 isoform 2 prec... 207 2e-52
gi|17384624|emb|CAC81020.1| kainate receptor subunit [Homo sapiens] 207 2e-52
gi|39581617|emb|CAE58402.1| Hypothetical protein CBG01531 [Caeno... 206 7e-52
gi|17566612|ref|NP_505244.1| AMPA GLutamate Receptor subunit (10... 206 9e-52
gi|627450|pir||A54260 glutamate receptor 6 kainate-preferring pr... 206 9e-52
gi|284968|pir||A43954 glutamate receptor beta-2 chain - mouse >g... 204 3e-51
gi|12658340|gb|AAK01097.1| ionotropic glutamate receptor GLR-5 [... 204 3e-51
gi|47212512|emb|CAF93734.1| unnamed protein product [Tetraodon n... 204 3e-51
gi|50729903|ref|XP_416697.1| PREDICTED: similar to Glutamate rec... 204 3e-51
gi|204390|gb|AAA02874.1| glutamate receptor subunit 5-2 203 4e-51
gi|9837162|gb|AAG00455.1| glutamate receptor 5 [Danio aequipinna... 203 4e-51
gi|56276|emb|CAA77776.1| kainate receptor [Rattus norvegicus] 203 4e-51
gi|8393481|ref|NP_058937.1| Glutamate receptor, ionotropic, kain... 203 4e-51
gi|26335871|dbj|BAC31636.1| unnamed protein product [Mus musculus] 203 6e-51
gi|26335229|dbj|BAC31315.1| unnamed protein product [Mus musculus] 203 6e-51
gi|26335749|dbj|BAC31575.1| unnamed protein product [Mus musculus] 203 6e-51
gi|22164778|ref|NP_666184.1| Glutamate receptor, ionotropic, kai... 203 6e-51
gi|48094781|ref|XP_394264.1| similar to ENSANGP00000001667 [Apis... 202 7e-51
gi|31418230|gb|AAH52975.1| GRIK5 protein [Homo sapiens] 202 1e-50
gi|29029597|ref|NP_002079.3| glutamate receptor KA2 precursor; e... 202 1e-50
gi|33989316|gb|AAH52009.2| Glutamate receptor, ionotropic, kaina... 202 1e-50
gi|13994161|ref|NP_113696.1| glutamate receptor KA2 precursor [R... 202 1e-50
gi|6680093|ref|NP_032194.1| glutamate receptor, ionotropic, kain... 202 1e-50
gi|10242381|ref|NP_058958.1| glutamate receptor KA2 precursor [R... 202 1e-50
gi|47221075|emb|CAG12769.1| unnamed protein product [Tetraodon n... 202 1e-50
gi|17384611|emb|CAC80547.1| kainate receptor subunit KA2a [Homo ... 202 1e-50
gi|28416444|ref|NP_783300.1| Glutamate receptor, ionotropic, kai... 202 1e-50
gi|790530|gb|AAA95961.1| EAA3 202 1e-50
gi|1169962|sp|P22756|GLK1_RAT Glutamate receptor, ionotropic kai... 201 2e-50
gi|56274|emb|CAA77775.1| kainate receptor [Rattus norvegicus] 201 2e-50
gi|50760077|ref|XP_417889.1| PREDICTED: similar to glutamate rec... 201 2e-50
gi|47227095|emb|CAG00457.1| unnamed protein product [Tetraodon n... 200 4e-50
gi|1480300|emb|CAA60854.1| glutamate receptor InvGluR-K1 polypep... 200 4e-50
gi|3287849|sp|Q16478|GLK5_HUMAN Glutamate receptor, ionotropic k... 200 5e-50
gi|4504117|ref|NP_000821.1| Glutamate receptor, ionotropic, kain... 200 5e-50
gi|30348983|ref|NP_780690.1| glutamate receptor KA1 precursor [M... 198 1e-49
gi|31204785|ref|XP_311341.1| ENSANGP00000001667 [Anopheles gambi... 198 2e-49
gi|3287853|sp|Q91755|GLK2_XENLA Glutamate receptor, ionotropic k... 198 2e-49
gi|38078800|ref|XP_131647.2| glutamate receptor 7 precursor [Mus... 197 3e-49
gi|17384613|emb|CAC80548.1| glutamate/kainate receptor subtype G... 197 3e-49
gi|15028907|emb|CAC44965.1| glutamate receptor 7 [Homo sapiens] 197 3e-49
gi|92440|pir||S19810 glutamate receptor GluR7 - rat 197 3e-49
gi|28605145|ref|NP_000822.2| glutamate receptor 7 precursor; exc... 197 3e-49
gi|1169965|sp|P42264|GLK3_RAT Glutamate receptor, ionotropic kai... 197 3e-49
gi|9623184|gb|AAF90049.1| kainate receptor GluR7 3 subunit [Mus ... 197 3e-49
gi|3935134|gb|AAC80577.1| glutamate receptor subunit kainate sub... 197 3e-49
gi|227860|prf||1712321A kainate receptor KA-1 197 3e-49
gi|3287848|sp|Q16099|GLK4_HUMAN Glutamate receptor, ionotropic k... 197 3e-49
gi|3287839|sp|Q01812|GLK4_RAT Glutamate receptor, ionotropic kai... 197 3e-49
gi|10242377|ref|NP_036704.1| glutamate receptor KA1 precursor [R... 197 3e-49
gi|29029595|ref|NP_055434.2| glutamate receptor KA1 precursor; e... 197 3e-49
gi|47224664|emb|CAG03648.1| unnamed protein product [Tetraodon n... 197 3e-49
gi|31077130|ref|NP_852038.1| glutamate receptor, ionotropic, kai... 196 5e-49
gi|3287976|sp|Q13003|GLK3_HUMAN Glutamate receptor, ionotropic k... 196 7e-49
gi|790534|gb|AAB60407.1| EAA5 196 7e-49
gi|50759754|ref|XP_417766.1| PREDICTED: similar to glutamate rec... 196 7e-49
gi|26329735|dbj|BAC28606.1| unnamed protein product [Mus musculus] 196 9e-49
gi|39582776|emb|CAE74239.1| Hypothetical protein CBG21924 [Caeno... 195 2e-48
gi|39595950|emb|CAE67453.1| Hypothetical protein CBG12954 [Caeno... 194 3e-48
gi|24648559|ref|NP_650925.1| CG3822-PA [Drosophila melanogaster]... 194 3e-48
gi|25147803|ref|NP_495639.2| AMPA GLutamate Receptor subunit (gl... 193 4e-48
gi|21430570|gb|AAM50963.1| RE06730p [Drosophila melanogaster] 193 6e-48
gi|12658338|gb|AAK01096.1| ionotropic glutamate receptor GLR-4 [... 192 8e-48
gi|7505722|pir||T23570 hypothetical protein K10D3.1 - Caenorhabd... 192 8e-48
gi|25143192|ref|NP_492017.2| AMPA GLutamate Receptor subunit (gl... 192 8e-48
gi|48094783|ref|XP_394265.1| similar to ENSANGP00000001667 [Apis... 191 2e-47
gi|12658336|gb|AAK01095.1| ionotropic glutamate receptor GLR-3 [... 191 3e-47
gi|14714846|gb|AAH10574.1| GRIA2 protein [Homo sapiens] 190 5e-47
gi|41281627|ref|NP_571969.1| glutamate receptor, ionotropic, AMP... 189 6e-47
gi|13366253|gb|AAA86646.2| glutamate receptor AMPA/kainate type ... 189 8e-47
gi|47225085|emb|CAF97500.1| unnamed protein product [Tetraodon n... 189 1e-46
gi|23831146|sp|P42262|GLR2_HUMAN Glutamate receptor 2 precursor ... 188 1e-46
gi|940272|gb|AAB37745.1| glutamate receptor subunit 2B 188 1e-46
gi|7305115|ref|NP_038568.1| glutamate receptor, ionotropic, AMPA... 187 3e-46
gi|45387863|ref|NP_991293.1| AMPA receptor subunit GluR1B [Danio... 187 3e-46
gi|940268|gb|AAB37743.1| glutamate receptor subunit 2B 187 3e-46
gi|50746158|ref|XP_420381.1| PREDICTED: AMPA glutamate receptor ... 187 4e-46
gi|630991|pir||S47031 glutamate receptor chain II precursor - pi... 187 4e-46
gi|16033405|gb|AAL13230.1| AMPA receptor subunit 2a [Danio rerio] 187 4e-46
gi|204382|gb|AAA41240.1| glutamate receptor subunit 2 >gnl|BL_OR... 186 5e-46
gi|625322|pir||ACGAE glutamate receptor precursor - great pond s... 186 5e-46
gi|45387623|ref|NP_991161.1| AMPA receptor subunit GluR1A [Danio... 186 5e-46
gi|4758480|ref|NP_000817.1| glutamate receptor, ionotropic, AMPA... 186 7e-46
gi|121438|sp|P26591|GLRK_LYMST Glutamate receptor precursor >gnl... 186 7e-46
gi|50755013|ref|XP_414582.1| PREDICTED: similar to AMPA receptor... 186 7e-46
gi|940266|gb|AAB37742.1| glutamate receptor subunit 2A 186 7e-46
gi|940270|gb|AAB37744.1| glutamate receptor subunit 2Ac 186 7e-46
gi|33327158|gb|AAQ08957.1| AMPA receptor subunit GluR2B [Danio r... 186 7e-46
gi|22096313|sp|P23819|GLR2_MOUSE Glutamate receptor 2 precursor ... 186 9e-46
gi|49169812|ref|NP_001001775.1| AMPA glutamate receptor 2 [Gallu... 186 9e-46
gi|111678|pir||S13677 glutamate receptor B precursor - rat 185 1e-45
gi|8393475|ref|NP_058957.1| glutamate receptor, ionotropic, 2; ... 185 1e-45
gi|23491752|dbj|BAC19820.1| AMPA GluR2 [Taeniopygia guttata] 185 1e-45
gi|3287964|sp|P19491|GLR2_RAT Glutamate receptor 2 precursor (Gl... 185 2e-45
gi|38511947|gb|AAH60702.1| Gria1 protein [Mus musculus] 184 2e-45
gi|4504113|ref|NP_000818.1| glutamate receptor, ionotropic, AMPA... 184 2e-45
gi|478699|pir||S25852 glutamate receptor GluR1 - human >gnl|BL_O... 184 2e-45
gi|29789269|ref|NP_113796.1| glutamate receptor, ionotropic, AMP... 184 2e-45
gi|34328128|ref|NP_032191.2| glutamate receptor, ionotropic, AMP... 184 2e-45
gi|14028807|gb|AAK52503.1| AMPA glutamate receptor subunit 1a sh... 184 3e-45
gi|17028054|gb|AAL34308.1| glutamate receptor subunit 1 alpha fl... 184 3e-45
gi|14028803|gb|AAK52501.1| AMPA glutamate receptor subunit 1a lo... 184 3e-45
gi|279674|pir||ACRTK1 glutamate receptor K1 precursor - rat >gnl... 184 4e-45
gi|24648478|ref|NP_651982.1| CG18039-PA [Drosophila melanogaster... 183 5e-45
gi|481504|pir||S38723 glutamate receptor GLUR1 - human 183 6e-45
gi|121431|sp|P19490|GLR1_RAT Glutamate receptor 1 precursor (Glu... 182 8e-45
gi|9738981|gb|AAF97859.1| glutamate receptor subunit 3 flop isof... 182 1e-44
gi|48994235|ref|NP_001001774.1| AMPA glutamate receptor [Gallus ... 182 1e-44
gi|18858769|ref|NP_571970.1| glutamate receptor, ionotropic, AMP... 182 1e-44
gi|14028805|gb|AAK52502.1| AMPA glutamate receptor subunit 1a sh... 182 1e-44
gi|17028052|gb|AAL34307.1| glutamate receptor subunit 1 alpha fl... 182 1e-44
gi|14028801|gb|AAK52500.1| AMPA glutamate receptor subunit 1a lo... 182 1e-44
gi|9738980|gb|AAF97858.1| glutamate receptor subunit 3 flip isof... 181 2e-44
gi|47222963|emb|CAF99119.1| unnamed protein product [Tetraodon n... 181 2e-44
gi|33327162|gb|AAQ08959.1| AMPA receptor subunit GluR3B [Danio r... 181 3e-44
gi|227246|prf||1617121A Glu receptor 1 181 3e-44
gi|183281|gb|AAA58613.1| glutamate receptor subunit 181 3e-44
gi|121430|sp|P23818|GLR1_MOUSE Glutamate receptor 1 precursor (G... 181 3e-44
gi|106114|pir||A41273 glutamate receptor precursor - human (frag... 181 3e-44
gi|31204789|ref|XP_311343.1| ENSANGP00000021312 [Anopheles gambi... 180 4e-44
gi|1389971|gb|AAB03117.1| GluR3 flip [Gallus gallus] 180 4e-44
gi|121434|sp|P19492|GLR3_RAT Glutamate receptor 3 precursor (Glu... 179 7e-44
gi|1169961|sp|P42263|GLR3_HUMAN Glutamate receptor 3 precursor (... 179 7e-44
gi|7406947|gb|AAF61847.1| glutamate receptor subunit 3 [Homo sap... 179 7e-44
gi|4504115|ref|NP_000819.1| glutamate receptor 3 isoform flop pr... 179 7e-44
gi|348418|pir||A44839 glutamate receptor 4c - rat >gnl|BL_ORD_ID... 179 7e-44
gi|202868|gb|AAA63479.1| AMPA selective glutamate receptor 179 7e-44
gi|940274|gb|AAA74200.1| glutamate receptor subunit 2Ac 179 7e-44
gi|38198631|ref|NP_938153.1| glutamate receptor, ionotropic, AMP... 179 9e-44
gi|26327421|dbj|BAC27454.1| unnamed protein product [Mus musculus] 179 9e-44
gi|15147226|ref|NP_116785.1| glutamate receptor, ionotropic, AMP... 179 1e-43
gi|8393313|ref|NP_058582.1| glutamate receptor, ionotropic, AMP... 179 1e-43
gi|8393478|ref|NP_058959.1| glutamate receptor, ionotropic, 4; g... 179 1e-43
gi|45382593|ref|NP_990545.1| AMPA receptor GluR4/D [Gallus gallu... 179 1e-43
gi|1082398|pir||S50128 glutamate receptor 3 isoform flip - human... 179 1e-43
gi|40254542|ref|NP_062665.2| glutamate receptor, ionotropic, AMP... 179 1e-43
gi|7406948|gb|AAF61848.1| glutamate receptor subunit 3 [Homo sap... 179 1e-43
gi|32528276|ref|NP_015564.2| glutamate receptor 3 isoform flip p... 179 1e-43
gi|45382595|ref|NP_990546.1| AMPA receptor GluR3/C [Gallus gallu... 178 1e-43
gi|121435|sp|P19493|GLR4_RAT Glutamate receptor 4 precursor (Glu... 178 1e-43
gi|202874|gb|AAA63481.1| AMPA selective glutamate receptor 178 2e-43
gi|2895127|gb|AAC02905.1| ionotropic glutamate recetor subunit 3... 178 2e-43
gi|511489|gb|AAA19859.1| glutamate receptor 4 >gnl|BL_ORD_ID|499... 177 3e-43
gi|47222566|emb|CAG02931.1| unnamed protein product [Tetraodon n... 177 3e-43
gi|4557631|ref|NP_000820.1| glutamate receptor, ionotrophic; glu... 177 3e-43
gi|2895125|gb|AAC02904.1| ionotropic glutamate recetor subunit 3... 177 3e-43
gi|1813507|gb|AAB41693.1| AMPA glutamate receptor isoform Flop [... 177 3e-43
gi|31074381|gb|AAP41205.1| glutamate receptor subunit protein Gl... 177 4e-43
gi|47086545|ref|NP_997917.1| AMPA receptor subunit GluR4B [Danio... 177 4e-43
gi|2119542|pir||I49695 glutamate receptor chain B (version flop)... 176 6e-43
gi|31200657|ref|XP_309276.1| ENSANGP00000011407 [Anopheles gambi... 176 7e-43
gi|31074389|gb|AAP41209.1| glutamate receptor subunit protein Gl... 176 7e-43
gi|20138449|sp|Q9Z2W8|GLR4_MOUSE Glutamate receptor 4 precursor ... 176 1e-42
gi|2119541|pir||I49696 glutamate receptor chain B (version flip)... 176 1e-42
gi|47221424|emb|CAF97342.1| unnamed protein product [Tetraodon n... 175 2e-42
gi|47209848|emb|CAF88978.1| unnamed protein product [Tetraodon n... 175 2e-42
gi|47550905|ref|NP_999971.1| AMPA receptor subunit GluR4A [Danio... 174 2e-42
gi|24581972|ref|NP_523484.2| CG6992-PI [Drosophila melanogaster]... 173 6e-42
gi|29823896|emb|CAD58975.1| glutamate receptor [Loligo opalescens] 171 2e-41
gi|31074379|gb|AAP41204.1| glutamate receptor subunit protein Gl... 170 4e-41
gi|31074383|gb|AAP41206.1| glutamate receptor subunit protein Gl... 169 1e-40
gi|6688642|emb|CAB65182.1| glutamate receptor [Loligo opalescens] 169 1e-40
gi|31206331|ref|XP_312117.1| ENSANGP00000016771 [Anopheles gambi... 168 2e-40
gi|1389965|gb|AAB03114.1| GluR2 flop [Gallus gallus] 168 2e-40
gi|39591662|emb|CAE71239.1| Hypothetical protein CBG18112 [Caeno... 166 6e-40
gi|157509|gb|AAA28574.1| glutamate receptor subunit 166 1e-39
gi|21355999|ref|NP_650927.1| CG5621-PA [Drosophila melanogaster]... 166 1e-39
gi|1389963|gb|AAB03113.1| GluR2 flip [Gallus gallus] 166 1e-39
gi|103181|pir||A39280 glutamate receptor GluR-II precursor - fru... 165 1e-39
gi|25144707|ref|NP_498887.2| NOse Touch response abnormal NOT-3,... 164 2e-39
gi|25295807|pir||B88533 glutamate receptor protein homolog C06E1... 164 2e-39
gi|630992|pir||S47032 glutamate receptor chain III - pigeon (fra... 164 3e-39
gi|11062401|emb|CAC14583.1| dJ1171F9.1 (glutamate receptor, iono... 164 4e-39
gi|33438244|dbj|BAC81534.1| AMPA-type glutamate receptor subunit... 162 8e-39
gi|1389969|gb|AAB03116.1| GluR4 flop [Gallus gallus] 162 1e-38
gi|1389959|gb|AAB03111.1| GluR1 flip [Gallus gallus] 160 3e-38
gi|31215640|ref|XP_316066.1| ENSANGP00000005861 [Anopheles gambi... 160 4e-38
gi|1389961|gb|AAB03112.1| GluR1 flop [Gallus gallus] 159 9e-38
gi|24661440|ref|NP_524755.2| CG4481-PA [Drosophila melanogaster]... 158 2e-37
gi|6687409|emb|CAB64939.1| ionotropic glutamate receptor subunit... 158 2e-37
gi|3287852|sp|Q90218|GLRK_ANAPL Probable glutamate receptor prec... 158 2e-37
gi|24648476|ref|NP_732538.1| CG31201-PA [Drosophila melanogaster... 157 3e-37
gi|1389967|gb|AAB03115.1| GluR4 flip [Gallus gallus] 157 3e-37
gi|3287847|sp|Q03445|GLK1_DROME Glutamate receptor I precursor (... 157 4e-37
gi|27819849|gb|AAO24973.1| RE03717p [Drosophila melanogaster] 156 6e-37
gi|3510454|gb|AAC34247.1| GluR4c protein [Gallus gallus] 156 6e-37
gi|17136702|ref|NP_476855.1| CG8442-PA [Drosophila melanogaster]... 156 6e-37
gi|31074385|gb|AAP41207.1| glutamate receptor subunit protein Gl... 156 8e-37
gi|422439|pir||A46421 kainate-selective glutamate receptor DGluR... 156 8e-37
gi|47229815|emb|CAG07011.1| unnamed protein product [Tetraodon n... 156 8e-37
gi|3510456|gb|AAC34248.1| GluR4d protein [Gallus gallus] 155 1e-36
gi|21954542|dbj|BAC06343.1| DjGluR2 [Dugesia japonica] 155 2e-36
gi|45382513|ref|NP_990684.1| kainate binding protein [Gallus gal... 155 2e-36
gi|2119552|pir||A57720 kainate receptor alpha chain precursor - ... 150 3e-35
gi|33638219|gb|AAQ24210.1| glutamate receptor subunit AMPA1 [Ovi... 149 1e-34
gi|17861732|gb|AAL39343.1| GH25591p [Drosophila melanogaster] 148 2e-34
gi|24580751|ref|NP_608557.2| CG4226-PA [Drosophila melanogaster]... 148 2e-34
gi|47205431|emb|CAF94897.1| unnamed protein product [Tetraodon n... 147 3e-34
gi|45549153|ref|NP_523485.3| CG7234-PI [Drosophila melanogaster]... 147 5e-34
gi|515481|gb|AAA21578.1| kainate receptor alpha subunit 146 6e-34
gi|26335713|dbj|BAC31557.1| unnamed protein product [Mus musculus] 145 1e-33
gi|26336607|dbj|BAC31986.1| unnamed protein product [Mus musculu... 145 1e-33
gi|2119553|pir||B57720 kainate receptor beta chain precursor - g... 145 1e-33
gi|31074387|gb|AAP41208.1| glutamate receptor subunit protein Gl... 145 2e-33
gi|12852206|dbj|BAB29316.1| unnamed protein product [Mus musculus] 144 2e-33
gi|47216794|emb|CAG10116.1| unnamed protein product [Tetraodon n... 143 5e-33
gi|48096450|ref|XP_394694.1| similar to ENSANGP00000005861 [Apis... 143 7e-33
gi|47210498|emb|CAF93180.1| unnamed protein product [Tetraodon n... 142 1e-32
gi|2828714|gb|AAC00192.1| glutamate receptor DGluRIIB [Drosophil... 142 2e-32
gi|18448653|gb|AAL69894.1| putative glutamate receptor subunit U... 141 2e-32
gi|25144703|ref|NP_498561.2| AMPA GLutamate Receptor subunit (gl... 141 3e-32
gi|33860153|sp|Q10914|GLR2_CAEEL Glutamate receptor 2 precursor ... 141 3e-32
gi|24585613|ref|NP_523610.2| CG8681-PA [Drosophila melanogaster]... 140 3e-32
gi|3287854|sp|Q91756|GLRK_XENLA Glutamate receptor U1 precursor ... 137 3e-31
gi|33638221|gb|AAQ24211.1| glutamate receptor subunit AMPA2 [Ovi... 136 6e-31
gi|39594032|emb|CAE70142.1| Hypothetical protein CBG16604 [Caeno... 136 8e-31
gi|121439|sp|P20262|GLRK_RANBE Probable glutamate receptor precu... 135 1e-30
gi|33638223|gb|AAQ24212.1| glutamate receptor subunit AMPA3 [Ovi... 135 1e-30
gi|2119543|pir||I50452 glutamate receptor chain IV - pigeon (fra... 135 2e-30
gi|56286|emb|CAA78936.1| glutamate receptor subtype delta-1 [Rat... 134 3e-30
gi|13259380|ref|NP_077354.1| glutamate receptor delta-1 subunit ... 134 3e-30
gi|6680089|ref|NP_032192.1| glutamate receptor, ionotropic, delt... 134 3e-30
gi|347009|pir||S28857 glutamate receptor delta-1 chain precursor... 134 3e-30
gi|7494809|pir||T15306 hypothetical protein B0280.12 - Caenorhab... 134 4e-30
gi|23491750|dbj|BAC19819.1| AMPA GluR1 [Taeniopygia guttata] 133 7e-30
gi|7441647|pir||T15427 hypothetical protein C06A8.9 - Caenorhabd... 131 3e-29
gi|6330597|dbj|BAA86534.1| KIAA1220 protein [Homo sapiens] 130 4e-29
gi|37550768|ref|XP_043613.9| glutamate receptor, ionotropic, del... 130 4e-29
gi|23491754|dbj|BAC19821.1| AMPA GluR3 [Taeniopygia guttata] 126 7e-28
gi|12539600|emb|CAC25104.1| bA487F5.1 (glutamate receptor, ionot... 126 9e-28
gi|347011|pir||S28858 glutamate receptor delta-2 chain precursor... 126 9e-28
gi|50744948|ref|XP_426186.1| PREDICTED: similar to glutamate rec... 126 9e-28
gi|34855896|ref|XP_346702.1| hypothetical protein XP_346701 [Rat... 126 9e-28
gi|6680091|ref|NP_032193.1| glutamate receptor, ionotropic, delt... 126 9e-28
gi|13259382|ref|NP_077355.1| glutamate receptor, ionotropic, del... 126 9e-28
gi|10764816|gb|AAG22820.1| AMPA type glutamate receptor [Ctenoph... 125 2e-27
gi|33638225|gb|AAQ24213.1| glutamate receptor subunit AMPA4 [Ovi... 124 3e-27
gi|24581733|ref|NP_608863.1| CG15627-PA [Drosophila melanogaster... 122 2e-26
gi|4557633|ref|NP_001501.1| glutamate receptor, ionotropic, delt... 122 2e-26
gi|48124944|ref|XP_393270.1| similar to CG32704-PA [Apis mellifera] 121 3e-26
gi|8170811|gb|AAB25781.2| AMPA-selective glutamate receptor-A; G... 120 4e-26
gi|3510452|gb|AAC34246.1| GluR4 short [Gallus gallus] 119 1e-25
gi|47211653|emb|CAF95059.1| unnamed protein product [Tetraodon n... 118 2e-25
gi|31074377|gb|AAP41203.1| glutamate receptor subunit protein Gl... 116 9e-25
gi|39591098|emb|CAE58878.1| Hypothetical protein CBG02111 [Caeno... 115 1e-24
gi|48116288|ref|XP_396400.1| similar to ENSANGP00000014374 [Apis... 115 2e-24
gi|24640783|ref|NP_727328.1| CG32704-PA [Drosophila melanogaster... 114 3e-24
gi|21358761|gb|AAM47017.1| ionotropic glutamate receptor subunit... 114 3e-24
gi|24158948|pdb|1M5D|A Chain A, X-Ray Structure Of The Glur2 Lig... 113 6e-24
gi|7497362|pir||T29996 hypothetical protein C43H6.9 - Caenorhabd... 113 8e-24
gi|11513719|pdb|1FW0|A Chain A, Crystal Structure Of The Glur2 L... 112 1e-23
gi|21466032|pdb|1LB8|A Chain A, Crystal Structure Of The Non-Des... 112 1e-23
gi|34810774|pdb|1MQH|A Chain A, Crystal Structure Of The Glur2 L... 112 1e-23
gi|33357341|pdb|1MQD|A Chain A, X-Ray Structure Of The Glur2 Lig... 112 2e-23
gi|17028056|gb|AAL34309.1| glutamate receptor subunit 1B [Oreoch... 111 3e-23
gi|32566141|ref|NP_508441.2| AMPA GLutamate Receptor subunit (gl... 111 3e-23
gi|33357837|pdb|1P1N|A Chain A, Glur2 Ligand Binding Core (S1s2j... 111 3e-23
gi|33357844|pdb|1P1W|A Chain A, Crystal Structure Of The Glur2 L... 111 3e-23
gi|3287850|sp|Q60934|GLK1_MOUSE Glutamate receptor, ionotropic k... 110 4e-23
gi|47215057|emb|CAG03492.1| unnamed protein product [Tetraodon n... 110 4e-23
gi|21466037|pdb|1LBC|A Chain A, Crystal Structure Of Glur2 Ligan... 110 5e-23
gi|21466036|pdb|1LBB|A Chain A, Crystal Structure Of The Glur2 L... 110 5e-23
gi|4139716|pdb|1GR2|A Chain A, Structure Of A Glutamate Receptor... 110 6e-23
gi|12658344|gb|AAK01099.1| ionotropic glutamate receptor GLR-7 [... 109 1e-22
gi|47826527|dbj|BAD20813.1| kainate type glutamate receptor 6 [T... 108 1e-22
gi|47826525|dbj|BAD20812.1| kainate type glutamate receptor 5 [T... 108 1e-22
gi|47826529|dbj|BAD20814.1| kainate type glutamate receptor 7 [T... 107 3e-22
gi|31236710|ref|XP_319463.1| ENSANGP00000014374 [Anopheles gambi... 107 5e-22
gi|33243903|gb|AAO46102.1| NMDA-like receptor splice form [Aplys... 104 3e-21
gi|32378818|gb|AAP80570.1| NMDA-type glutamate receptor [Aplysia... 104 3e-21
gi|33243901|gb|AAO62106.1| NMDA-like glutamate receptor protein ... 104 3e-21
gi|48101258|ref|XP_392657.1| NMDA-type glutamate receptor 1 [Api... 104 4e-21
gi|31205179|ref|XP_311538.1| ENSANGP00000024918 [Anopheles gambi... 102 2e-20
gi|27802719|emb|CAD60809.1| SI:bZ1O18.1 (novel protein similar t... 102 2e-20
gi|31242431|ref|XP_321646.1| ENSANGP00000011536 [Anopheles gambi... 100 5e-20
gi|24644257|ref|NP_730940.1| CG2902-PA [Drosophila melanogaster]... 100 7e-20
gi|25147808|ref|NP_495033.2| N-Methyl-D-aspartate-type ionotropi... 96 1e-18
gi|39596879|emb|CAE59106.1| Hypothetical protein CBG02401 [Caeno... 94 4e-18
gi|2119551|pir||I73672 AMPA-selective glutamate receptor-B - rat... 93 8e-18
gi|3493580|gb|AAC33440.1| N-methyl-D-aspartate receptor NR1 subu... 93 8e-18
gi|2343289|gb|AAB67724.1| NMDAR1 subunit isoform 4b [Homo sapiens] 93 8e-18
gi|2343287|gb|AAB67723.1| NMDAR1 subunit isoform 3b [Homo sapiens] 93 8e-18
gi|1122392|emb|CAA63871.1| NMDA glutamate receptor subunit [Xeno... 92 1e-17
gi|292287|gb|AAB59361.1| NMDA receptor subunit 92 2e-17
gi|321323|pir||JN0336 N-methyl-D-aspartate receptor 1 precursor,... 92 2e-17
gi|37606204|emb|CAE49101.1| SI:bZ1O1.1 (novel protein similar to... 92 2e-17
gi|7441646|pir||A47551 N-methyl-D-aspartate receptor chain 1 pre... 92 2e-17
gi|11038635|ref|NP_067544.1| NMDA receptor 1 isoform NR1-2 precu... 92 2e-17
gi|475564|gb|AAB50931.1| N-methyl-D-aspartate receptor NMDAR1-3b... 92 2e-17
gi|321324|pir||JN0337 N-methyl-D-aspartate receptor 1 precursor,... 92 2e-17
gi|292285|gb|AAA36198.1| NMDA receptor subunit 92 2e-17
gi|472846|gb|AAA62111.1| N-methyl-D-aspartate receptor subunit 92 2e-17
gi|321328|pir||JN0341 N-methyl-D-aspartate receptor 1 precursor,... 92 2e-17
gi|423920|pir||A46296 N-methyl-D-aspartate receptor (NMDAR1) spl... 92 2e-17
gi|321327|pir||JN0340 N-methyl-D-aspartate receptor 1 precursor,... 92 2e-17
gi|321325|pir||JN0338 N-methyl-D-aspartate receptor 1 precursor,... 92 2e-17
gi|8393484|ref|NP_058706.1| glutamate receptor, ionotropic, N-me... 92 2e-17
gi|11038637|ref|NP_015566.1| NMDA receptor 1 isoform NR1-3 precu... 92 2e-17
gi|6680095|ref|NP_032195.1| glutamate receptor, ionotropic, NMDA... 92 2e-17
gi|228224|prf||1718345A NMDA receptor 1 92 2e-17
gi|508971|gb|AAA19659.1| NMDAR1 glutamate receptor subunit [Ratt... 92 2e-17
gi|11496971|ref|NP_000823.4| NMDA receptor 1 isoform NR1-1 precu... 92 2e-17
gi|321326|pir||JN0339 N-methyl-D-aspartate receptor 1 precursor,... 92 2e-17
gi|24657649|gb|AAH39157.1| Grin1 protein [Mus musculus] 92 2e-17
gi|46195826|ref|NP_996862.1| N-methyl-D-aspartate receptor type ... 92 2e-17
gi|49425248|gb|AAT66021.1| N-methyl-D-aspartate receptor 1 subun... 92 2e-17
gi|2147747|pir||I51244 N-methyl-D-aspartate receptor type 1 - du... 92 2e-17
gi|743475|prf||2012328A D-MeAsp receptor:ISOTYPE=NR1 92 2e-17
gi|7441645|pir||T15967 hypothetical protein F07F6.6 - Caenorhabd... 91 5e-17
gi|47189318|emb|CAF92376.1| unnamed protein product [Tetraodon n... 90 9e-17
gi|951156|gb|AAA85222.1| glutamate receptor subunit 5 >gnl|BL_OR... 89 2e-16
gi|24638811|ref|NP_726648.1| CG11155-PB [Drosophila melanogaster... 88 3e-16
gi|21428388|gb|AAM49854.1| HL08030p [Drosophila melanogaster] 88 3e-16
gi|951154|gb|AAA85221.1| glutamate receptor subunit 6 >gnl|BL_OR... 87 4e-16
gi|21954540|dbj|BAC06342.1| DjGluR1 [Dugesia japonica] 82 2e-14
gi|15485588|emb|CAC67485.1| putative GluR6 kainate receptor [Hom... 81 4e-14
gi|39583360|emb|CAE66334.1| Hypothetical protein CBG11585 [Caeno... 80 7e-14
gi|47207253|emb|CAF91654.1| unnamed protein product [Tetraodon n... 80 7e-14
gi|47220672|emb|CAG06594.1| unnamed protein product [Tetraodon n... 80 9e-14
gi|45549279|ref|NP_525085.3| CG14793-PA [Drosophila melanogaster... 79 1e-13
gi|48095785|gb|AAT40462.1| NMDA receptor subunit 2-3 [Drosophila... 79 1e-13
gi|48095783|gb|AAT40461.1| NMDA receptor subunit 2-2 [Drosophila... 79 1e-13
gi|7512003|pir||T13603 probable N-methyl-D-aspartate receptor - ... 79 1e-13
gi|21310151|gb|AAM46167.1| NMDA receptor 2 [Drosophila melanogas... 79 1e-13
gi|25148397|ref|NP_506694.2| N-Methyl-D-aspartate-type ionotropi... 79 2e-13
gi|21711785|gb|AAM75083.1| RH23394p [Drosophila melanogaster] 77 6e-13
gi|24638677|ref|NP_651931.1| CG9935-PA [Drosophila melanogaster]... 77 6e-13
gi|31213167|ref|XP_315527.1| ENSANGP00000021754 [Anopheles gambi... 76 1e-12
gi|7506834|pir||T20939 hypothetical protein T01C3.10 - Caenorhab... 76 1e-12
gi|48110488|ref|XP_396271.1| similar to CG14793-PA [Apis mellifera] 76 1e-12
gi|20127397|ref|NP_569722.1| glutamate receptor, ionotropic, NMD... 75 2e-12
gi|548374|sp|Q00961|NME3_RAT Glutamate [NMDA] receptor subunit e... 75 2e-12
gi|286236|dbj|BAA02499.1| N-methyl-D-aspartate receptor subunit ... 75 2e-12
gi|348496|pir||B45219 N-methyl-D-aspartate receptor chain NMDAR2... 75 2e-12
gi|50802949|ref|XP_428642.1| PREDICTED: similar to Glutamate [NM... 75 2e-12
gi|285348|pir||C43274 N-methyl D-aspartate receptor (NMDR) gluta... 75 3e-12
gi|31542919|ref|NP_036707.2| glutamate receptor, ionotropic, NMD... 75 3e-12
gi|17529721|gb|AAL40418.1| N-methyl-D-aspartate receptor 3B [Mus... 74 4e-12
gi|12658350|gb|AAK01102.1| ionotropic glutamate receptor NMR-2 [... 74 4e-12
gi|20376816|ref|NP_579842.2| glutamate receptor, ionotropic, NMD... 74 4e-12
gi|4504129|ref|NP_000826.1| N-methyl-D-aspartate receptor subuni... 74 7e-12
gi|2492629|sp|Q14957|NME3_HUMAN Glutamate [NMDA] receptor subuni... 74 7e-12
gi|26996819|gb|AAH41128.1| Similar to glutamate receptor, ionotr... 74 7e-12
gi|348497|pir||C45219 N-methyl-D-aspartate receptor chain NMDAR2... 73 1e-11
gi|286238|dbj|BAA02500.1| N-methyl-D-aspartate receptor subunit ... 73 1e-11
gi|18202594|sp|Q62645|NME4_RAT Glutamate [NMDA] receptor subunit... 73 1e-11
gi|284981|pir||S27224 N-methyl-D-aspartate receptor epsilon-4 ch... 73 1e-11
gi|469067|gb|AAC37646.1| NMDA receptor subunit NR2D 73 1e-11
gi|6680101|ref|NP_032198.1| glutamate receptor, ionotropic, NMDA... 73 1e-11
gi|12248181|ref|NP_073634.1| glutamate receptor, ionotropic, NMD... 73 1e-11
gi|4504131|ref|NP_000827.1| N-methyl-D-aspartate receptor subuni... 73 1e-11
gi|4504127|ref|NP_000825.1| N-methyl-D-aspartate receptor subuni... 72 1e-11
gi|560547|gb|AAB60368.1| N-methyl-D-aspartate receptor subunit N... 72 1e-11
gi|14548162|sp|Q13224|NME2_HUMAN Glutamate [NMDA] receptor subun... 72 1e-11
gi|4099613|gb|AAD00659.1| N-methyl-D-aspartate receptor subunit ... 72 1e-11
gi|2135784|pir||S52086 N-methyl-D-aspartate receptor chain NR3 -... 72 1e-11
gi|6980984|ref|NP_036706.1| glutamate receptor, ionotropic, NMDA... 72 1e-11
gi|2119555|pir||I49704 glutamate receptor channel subunit epsilo... 72 1e-11
gi|41680710|ref|NP_032197.2| glutamate receptor, ionotropic, NMD... 72 1e-11
gi|548372|sp|Q00960|NME2_RAT Glutamate [NMDA] receptor subunit e... 72 1e-11
gi|228950|prf||1814459A D-MeAsp receptor:SUBUNIT=epsilon2 72 1e-11
gi|47181662|emb|CAG14452.1| unnamed protein product [Tetraodon n... 72 2e-11
gi|3025446|gb|AAC12680.1| R32184_2 [Homo sapiens] 72 2e-11
gi|37552313|ref|XP_290850.2| glutamate receptor, ionotropic, N-m... 72 2e-11
gi|20142345|tpg|DAA00018.1| TPA: NMDA type glutamate receptor su... 72 2e-11
gi|228951|prf||1814459B D-MeAsp receptor:ISOTYPE=epsilon3 72 2e-11
gi|1352507|sp|Q01098|NME3_MOUSE Glutamate [NMDA] receptor subuni... 72 2e-11
gi|7110609|ref|NP_034480.1| glutamate receptor, ionotropic, NMDA... 72 2e-11
gi|475552|gb|AAA17833.1| N-methyl-D-aspartate receptor NMDAR2D s... 72 3e-11
gi|3915771|sp|Q00959|NME1_RAT Glutamate [NMDA] receptor subunit ... 71 4e-11
gi|17567257|ref|NP_509097.1| AMPA GLutamate Receptor subunit (gl... 71 4e-11
gi|7499619|pir||T34233 hypothetical protein F22A3.3 - Caenorhabd... 71 4e-11
gi|47221652|emb|CAF97917.1| unnamed protein product [Tetraodon n... 71 4e-11
gi|50728616|ref|XP_416204.1| PREDICTED: similar to Glutamate [NM... 71 4e-11
gi|18033606|gb|AAL57195.1| AMPA receptor subunit 2 [Tetraodon fl... 70 6e-11
gi|4504125|ref|NP_000824.1| N-methyl-D-aspartate receptor subuni... 70 6e-11
gi|420206|pir||S29159 glutamate receptor, NMDA-sensitive, epsilo... 70 7e-11
gi|41680705|ref|NP_032196.2| glutamate receptor, ionotropic, NMD... 70 7e-11
gi|31377498|ref|NP_036705.2| glutamate receptor, ionotropic, N-m... 70 1e-10
gi|286234|dbj|BAA02498.1| N-methyl-D-aspartate receptor subunit ... 70 1e-10
gi|47218142|emb|CAG10062.1| unnamed protein product [Tetraodon n... 70 1e-10
gi|47217954|emb|CAG02237.1| unnamed protein product [Tetraodon n... 69 2e-10
gi|50726500|dbj|BAD34108.1| putative Avr9/Cf-9 rapidly elicited ... 69 2e-10
gi|26328479|dbj|BAC27978.1| unnamed protein product [Mus musculus] 68 4e-10
gi|5305435|gb|AAD41650.1| N-methyl-D-aspartate receptor splice v... 67 5e-10
gi|17530177|gb|AAL40734.1| N-methyl-D-aspartate receptor 3A [Hom... 67 5e-10
gi|20143964|ref|NP_597702.1| glutamate receptor, ionotropic, N-m... 67 5e-10
gi|7514020|pir||T31068 N-methyl-D-aspartate receptor homolog NMD... 67 5e-10
gi|18916849|dbj|BAB85559.1| KIAA1973 protein [Homo sapiens] 67 5e-10
gi|228723|prf||1809347A D-MeAsp receptor:SUBUNIT=epsilon1 67 5e-10
gi|20372905|emb|CAC95229.2| N-methyl D-aspartate subunit 3A [Hom... 67 6e-10
gi|18033610|gb|AAL57197.1| putative AMPA receptor subunit 2 [Par... 67 8e-10
gi|50511213|dbj|BAD32592.1| mKIAA1973 protein [Mus musculus] 67 8e-10
gi|47209023|emb|CAF94353.1| unnamed protein product [Tetraodon n... 66 1e-09
gi|743476|prf||2012328B D-MeAsp receptor:ISOTYPE=NR2A 65 2e-09
gi|25073695|gb|AAN65280.1| NMDA receptor subunit NR2B [Apteronot... 65 2e-09
gi|50749516|ref|XP_426488.1| PREDICTED: similar to glutamate rec... 65 2e-09
gi|39585857|emb|CAE61271.1| Hypothetical protein CBG05086 [Caeno... 64 4e-09
gi|47217487|emb|CAG10867.1| unnamed protein product [Tetraodon n... 64 7e-09
gi|18033612|gb|AAL57198.1| putative AMPA receptor subunit 1 [Par... 63 9e-09
gi|33438242|dbj|BAC81533.1| NMDA-type glutamate receptor subunit... 63 1e-08
gi|35210513|dbj|BAC92372.1| N-methyl-D-aspartate receptor NR1 su... 63 1e-08
gi|12658346|gb|AAK01100.1| ionotropic glutamate receptor GLR-8 [... 62 2e-08
gi|50726502|dbj|BAD34110.1| putative Avr9/Cf-9 rapidly elicited ... 62 2e-08
gi|31240301|ref|XP_320564.1| ENSANGP00000015225 [Anopheles gambi... 62 2e-08
gi|2119546|pir||I51308 N-methyl-D-aspartate receptor - goldfish ... 62 3e-08
gi|23491764|dbj|BAC19826.1| NMDAR1 [Taeniopygia guttata] 61 3e-08
gi|50726504|dbj|BAD34112.1| putative Avr9/Cf-9 rapidly elicited ... 60 6e-08
gi|47212216|emb|CAF94983.1| unnamed protein product [Tetraodon n... 60 6e-08
gi|47218959|emb|CAF98157.1| unnamed protein product [Tetraodon n... 60 8e-08
gi|47219645|emb|CAG02690.1| unnamed protein product [Tetraodon n... 59 1e-07
gi|48138553|ref|XP_396906.1| similar to ENSANGP00000005528 [Apis... 59 2e-07
gi|2137577|pir||I55466 N-methyl-D-aspartate receptor subunit NR2... 58 3e-07
gi|50726498|dbj|BAD34106.1| putative Avr9/Cf-9 rapidly elicited ... 57 5e-07
gi|24667182|ref|NP_649176.1| CG7385-PA [Drosophila melanogaster]... 57 6e-07
gi|15240443|ref|NP_198062.1| glutamate receptor family protein (... 56 1e-06
gi|31220509|ref|XP_316930.1| ENSANGP00000010947 [Anopheles gambi... 55 2e-06
gi|39545692|gb|AAR27949.1| GLR3.3 [Arabidopsis thaliana] 55 2e-06
gi|15217450|ref|NP_174978.1| glutamate receptor family protein (... 55 2e-06
gi|3822016|gb|AAD11811.1| NMDA receptor-like long variant [Rattu... 55 2e-06
gi|41017231|sp|Q9LFN5|GR25_ARATH Glutamate receptor 2.5 precurso... 55 2e-06
gi|15238991|ref|NP_196682.1| glutamate receptor family protein (... 55 2e-06
gi|50755932|ref|XP_425252.1| PREDICTED: similar to N-methyl-D-as... 55 3e-06
gi|48127406|ref|XP_396608.1| similar to CG17274-PA [Apis mellifera] 55 3e-06
gi|47215036|emb|CAF95890.1| unnamed protein product [Tetraodon n... 54 4e-06
gi|48098554|ref|XP_394100.1| similar to CG17274-PA [Apis mellifera] 54 5e-06
gi|50726494|dbj|BAD34102.1| putative Avr9/Cf-9 rapidly elicited ... 54 7e-06
gi|12964235|emb|CAC29254.1| ligand gated channel-like protein pr... 54 7e-06
gi|41052836|dbj|BAD07727.1| putative glutamate receptor [Oryza s... 54 7e-06
gi|41017232|sp|Q9LFN8|GR26_ARATH Glutamate receptor 2.6 precurso... 53 1e-05
gi|7487876|pir||T02741 probable ligand-gated ion channel protein... 52 2e-05
gi|30684127|ref|NP_180475.2| glutamate receptor family protein (... 52 2e-05
gi|15224608|ref|NP_180048.1| glutamate receptor family protein (... 52 3e-05
gi|41017064|sp|O04660|GR21_ARATH Glutamate receptor 2.1 precurso... 52 3e-05
gi|47216887|emb|CAG11694.1| unnamed protein product [Tetraodon n... 52 3e-05
gi|7485303|pir||T01809 hypothetical protein A_TM021B04.3 - Arabi... 52 3e-05
gi|42565836|ref|NP_190716.3| glutamate receptor family protein (... 51 5e-05
gi|6980913|gb|AAF23958.2| glutamate receptor B flop isoform [Gal... 50 6e-05
gi|6980911|gb|AAF23955.2| glutamate receptor B flop isoform [Hom... 50 6e-05
gi|6690042|gb|AAF23960.1| glutamate receptor B [Oreochromis nilo... 50 6e-05
gi|30013669|gb|AAP03877.1| Avr9/Cf-9 rapidly elicited protein 14... 50 8e-05
gi|6690048|gb|AAF23966.1| glutamate receptor D [Oreochromis nilo... 50 1e-04
gi|6690046|gb|AAF23964.1| glutamate receptor C [Gallus gallus] 50 1e-04
gi|15227034|ref|NP_180474.1| glutamate receptor family protein (... 49 2e-04
gi|40557612|gb|AAR88099.1| putative glutamate receptor ion chann... 49 2e-04
gi|899437|gb|AAA69920.1| NMDA receptor subtype 2B subunit 49 2e-04
gi|33304542|gb|AAQ02674.1| glutamate receptor [Raphanus sativus ... 49 2e-04
gi|30679923|ref|NP_028351.2| glutamate receptor family protein (... 49 2e-04
gi|41017148|sp|Q7XJL2|GR31_ARATH Glutamate receptor 3.1 precurso... 49 2e-04
gi|2119554|pir||I39066 N-methyl-D-aspartate receptor chain NMDAR... 49 2e-04
gi|11358484|pir||T51133 ligand gated channel-like protein [impor... 48 3e-04
gi|28572148|ref|NP_650923.3| CG17274-PA [Drosophila melanogaster... 48 3e-04
gi|47497756|dbj|BAD19856.1| putative glutamate receptor subunit ... 48 3e-04
gi|25009918|gb|AAN71127.1| AT31673p [Drosophila melanogaster] 48 3e-04
gi|24648555|ref|NP_732567.1| CG17274-PB [Drosophila melanogaster... 48 3e-04
gi|6980914|gb|AAF34724.1| glutamate receptor B flip isoform [Gal... 48 3e-04
gi|14329721|emb|CAC40655.1| glutamate receptor 7 [Homo sapiens] 48 3e-04
gi|6980912|gb|AAF34723.1| glutamate receptor B flip isoform [Hom... 48 3e-04
gi|14329722|emb|CAC40656.1| glutamate receptor 7 [Homo sapiens] 48 3e-04
gi|15224606|ref|NP_180047.1| glutamate receptor family protein (... 48 4e-04
gi|11358941|pir||T51131 ligand gated channel-like protein [impor... 47 7e-04
gi|47190822|emb|CAF87309.1| unnamed protein product [Tetraodon n... 47 7e-04
gi|25408232|pir||F84732 probable ligand-gated ion channel subuni... 47 9e-04
gi|41017205|sp|Q8LGN0|GR27_ARATH Glutamate receptor 2.7 precurso... 47 9e-04
gi|30684130|ref|NP_180476.2| glutamate receptor family protein (... 47 9e-04
gi|7487877|pir||T02742 probable ligand-gated ion channel protein... 47 9e-04
gi|41017072|sp|O81776|GR24_ARATH Glutamate receptor 2.4 precurso... 47 9e-04
gi|33638227|gb|AAQ24214.1| glutamate receptor subunit NR1 [Ovis ... 47 9e-04
gi|18402960|ref|NP_565744.1| glutamate receptor family protein (... 47 9e-04
gi|22091416|gb|AAL85964.2| putative ligand-gated ion channel pro... 47 9e-04
gi|31213053|ref|XP_315470.1| ENSANGP00000021669 [Anopheles gambi... 47 9e-04
gi|40557616|gb|AAR88101.1| putative glutamate receptor ion chann... 47 9e-04
gi|47184031|emb|CAF92510.1| unnamed protein product [Tetraodon n... 47 9e-04
gi|50726227|dbj|BAD33804.1| putative Avr9/Cf-9 rapidly elicited ... 46 0.001
gi|32487556|emb|CAE03759.1| OSJNBa0013K16.8 [Oryza sativa (japon... 46 0.001
gi|15238975|ref|NP_196679.1| glutamate receptor family protein (... 45 0.002
gi|47211789|emb|CAF93757.1| unnamed protein product [Tetraodon n... 45 0.002
gi|11358469|pir||T51136 ionotropic glutamate receptor glr5 [impo... 45 0.002
gi|6690047|gb|AAF23965.1| glutamate receptor C [Columba livia] 45 0.003
gi|34915464|ref|NP_919189.1| glutamate receptor, ionotropic kain... 45 0.003
gi|23491770|dbj|BAC19829.1| NMDAR2D [Taeniopygia guttata] 44 0.004
gi|23491766|dbj|BAC19827.1| NMDAR2A [Taeniopygia guttata] 43 0.010
gi|6690043|gb|AAF23961.1| glutamate receptor C [Homo sapiens] 43 0.010
gi|11358647|pir||T51138 probable glutamate receptor GLR1 [import... 43 0.013
gi|15229229|ref|NP_187061.1| glutamate receptor family protein (... 43 0.013
>gi|25147648|ref|NP_741823.1| AMPA GLutamate Receptor subunit
(glr-6) [Caenorhabditis elegans]
gi|21450543|gb|AAM54177.1| Glutamate receptor family (ampa) protein
6, isoform b [Caenorhabditis elegans]
Length = 328
Score = 625 bits (1613), Expect = e-178
Identities = 312/328 (95%), Positives = 312/328 (95%)
Frame = -1
Query: 987 MSLLGSPFIKIEYFIEYSIIFSVWTFSXXXXXXXXXXXXXXXXLSPKESTAEFKIQNSVW 808
MSLLGSPFIKIEYFIEYSIIFSVWTFS LSPKESTAEFKIQNSVW
Sbjct: 1 MSLLGSPFIKIEYFIEYSIIFSVWTFSAIATVITALLVTVAAVLSPKESTAEFKIQNSVW 60
Query: 807 YLVCILLRAGSGYNCQAGATRLISAVWWSFTLVLIAQYTANFAALLTVDRKSMPFNSFEE 628
YLVCILLRAGSGYNCQAGATRLISAVWWSFTLVLIAQYTANFAALLTVDRKSMPFNSFEE
Sbjct: 61 YLVCILLRAGSGYNCQAGATRLISAVWWSFTLVLIAQYTANFAALLTVDRKSMPFNSFEE 120
Query: 627 LGNQTEYNFGSILGGSTMQFFKYSRIETFRRLWERMQSAEPSAFVGTNHEGVNRVLNEKY 448
LGNQTEYNFGSILGGSTMQFFKYSRIETFRRLWERMQSAEPSAFVGTNHEGVNRVLNEKY
Sbjct: 121 LGNQTEYNFGSILGGSTMQFFKYSRIETFRRLWERMQSAEPSAFVGTNHEGVNRVLNEKY 180
Query: 447 VFLMESATLDYQVTQNCNLTRVGNVVLGSNGYSIALPKGSKWREKLTRQILDLNEKGIIL 268
VFLMESATLDYQVTQNCNLTRVGNVVLGSNGYSIALPKGSKWREKLTRQILDLNEKGIIL
Sbjct: 181 VFLMESATLDYQVTQNCNLTRVGNVVLGSNGYSIALPKGSKWREKLTRQILDLNEKGIIL 240
Query: 267 MLKNNWWKKSQQECQSSEPEDLQTALGAENVYGLFLLLALGSGIGVLCAVLEHTHFIFFE 88
MLKNNWWKKSQQECQSSEPEDLQTALGAENVYGLFLLLALGSGIGVLCAVLEHTHFIFFE
Sbjct: 241 MLKNNWWKKSQQECQSSEPEDLQTALGAENVYGLFLLLALGSGIGVLCAVLEHTHFIFFE 300
Query: 87 KNKRNGQTPKLQQMIETIHAEIRNSPKF 4
KNKRNGQTPKLQQMIETIHAEIRNSPKF
Sbjct: 301 KNKRNGQTPKLQQMIETIHAEIRNSPKF 328