Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F41C3_6
(339 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17533881|ref|NP_494847.1| i-141 protein like (2F31) [Caenorha... 224 4e-58
gi|39591168|emb|CAE73221.1| Hypothetical protein CBG20627 [Caeno... 217 5e-56
gi|31207271|ref|XP_312602.1| ENSANGP00000015000 [Anopheles gambi... 122 2e-27
gi|48110113|ref|XP_396259.1| similar to ENSANGP00000015000 [Apis... 120 5e-27
gi|7705636|ref|NP_057156.1| CGI-141 protein [Homo sapiens] >gnl|... 115 2e-25
gi|13385354|ref|NP_080148.1| CGI-141 protein; EST AA407874 [Mus ... 115 3e-25
gi|50729084|ref|XP_416423.1| PREDICTED: similar to UPF0198 prote... 115 3e-25
gi|26384022|dbj|BAB31257.2| unnamed protein product [Mus musculus] 115 3e-25
gi|48146895|emb|CAG33670.1| CGI-141 [Homo sapiens] 114 5e-25
gi|7634779|gb|AAF65181.1| HDCMA39P [Homo sapiens] 113 8e-25
gi|24642432|ref|NP_727945.1| CG32576-PA [Drosophila melanogaster... 107 4e-23
gi|47217237|emb|CAF96760.1| unnamed protein product [Tetraodon n... 105 2e-22
gi|17945675|gb|AAL48887.1| RE29988p [Drosophila melanogaster] 105 2e-22
gi|46443823|gb|EAL03102.1| hypothetical protein CaO19.3972 [Cand... 102 2e-21
gi|50546140|ref|XP_500597.1| hypothetical protein [Yarrowia lipo... 98 5e-20
gi|21311983|ref|NP_080956.1| RIKEN cDNA 0610012C01 [Mus musculus... 97 8e-20
gi|50427645|ref|XP_462435.1| unnamed protein product [Debaryomyc... 97 8e-20
gi|47224433|emb|CAG08683.1| unnamed protein product [Tetraodon n... 96 2e-19
gi|50258594|gb|EAL21281.1| hypothetical protein CNBD3350 [Crypto... 95 4e-19
gi|50295044|ref|XP_449933.1| unnamed protein product [Candida gl... 94 7e-19
gi|30678779|ref|NP_186968.2| Got1-like family protein [Arabidops... 93 1e-18
gi|6323949|ref|NP_014020.1| Golgi Transport; Got1p [Saccharomyce... 90 1e-17
gi|46226377|gb|EAK87382.1| conserved protein similar to Got1-lik... 88 4e-17
gi|34858579|ref|XP_342783.1| similar to CGI-141 protein; EST AA4... 88 5e-17
gi|50302981|ref|XP_451428.1| unnamed protein product [Kluyveromy... 87 6e-17
gi|38348211|ref|NP_940849.1| FLJ42654 protein [Homo sapiens] >gn... 87 1e-16
gi|45201433|ref|NP_987003.1| AGR337Wp [Eremothecium gossypii] >g... 86 1e-16
gi|15229139|ref|NP_190511.1| Got1-like family protein [Arabidops... 84 9e-16
gi|23510176|ref|NP_702842.1| CGI-141 protein homolog, putative [... 83 2e-15
gi|12324443|gb|AAG52183.1| unknown protein; 50647-51606 [Arabido... 83 2e-15
gi|19075588|ref|NP_588088.1| conserved hypothetical transmembran... 82 3e-15
gi|33146513|dbj|BAC79630.1| NFkB activating protein-like [Oryza ... 81 4e-15
gi|46124027|ref|XP_386567.1| hypothetical protein FG06391.1 [Gib... 79 3e-14
gi|23484669|gb|EAA19919.1| hypothetical protein [Plasmodium yoel... 74 7e-13
gi|6714435|gb|AAF26123.1| unknown protein [Arabidopsis thaliana] 73 2e-12
gi|22329359|ref|NP_683279.1| Got1-like family protein [Arabidops... 72 4e-12
gi|47497305|dbj|BAD19347.1| NFkB activating protein-like [Oryza ... 69 2e-11
gi|32411541|ref|XP_326251.1| hypothetical protein [Neurospora cr... 52 3e-06
gi|19074695|ref|NP_586201.1| hypothetical protein [Encephalitozo... 52 4e-06
gi|15597288|ref|NP_250782.1| probable MFS transporter [Pseudomon... 37 0.074
gi|32042199|ref|ZP_00139782.1| COG2814: Arabinose efflux permeas... 37 0.074
gi|49088362|gb|AAT51561.1| PA2092 [synthetic construct] 37 0.074
gi|5835455|ref|NP_008379.1|ND5_13186 NADH dehydrogenase subunit ... 35 0.48
gi|40548812|ref|NP_954726.1| NADH dehydrogenase subunit 5 [Dirof... 34 0.82
gi|23479406|gb|EAA16244.1| fimbriae-associated protein Fap1 [Pla... 33 1.1
gi|29349993|ref|NP_813496.1| putative Na+/H+ anitporter [Bactero... 33 1.1
gi|23480588|gb|EAA17110.1| hypothetical protein [Plasmodium yoel... 33 1.1
gi|39590065|emb|CAE61063.1| Hypothetical protein CBG04812 [Caeno... 33 1.4
gi|48771192|ref|ZP_00275535.1| COG0659: Sulfate permease and rel... 33 1.4
gi|19703602|ref|NP_603164.1| Transporter [Fusobacterium nucleatu... 33 1.8
gi|23612517|ref|NP_704078.1| hypothetical protein [Plasmodium fa... 32 2.4
gi|49257726|gb|AAH74539.1| Unknown (protein for MGC:69213) [Xeno... 32 3.1
gi|23510077|ref|NP_702743.1| hypothetical protein [Plasmodium fa... 32 3.1
gi|28373155|ref|NP_783754.1| ABC transporter-associated permease... 32 3.1
gi|23508359|ref|NP_701028.1| hypothetical protein [Plasmodium fa... 32 3.1
gi|21226210|ref|NP_632132.1| hypothetical protein MM0108 [Methan... 32 3.1
gi|16802658|ref|NP_464143.1| C-terminal domain similar to glycer... 32 3.1
gi|34880258|ref|XP_344142.1| similar to CG11345-PA [Rattus norve... 32 3.1
gi|15221700|ref|NP_173832.1| paired amphipathic helix repeat-con... 32 4.1
gi|34394726|dbj|BAC84089.1| putative transducin / WD-40 repeat p... 32 4.1
gi|45915997|ref|ZP_00194811.2| COG3333: Uncharacterized protein ... 32 4.1
gi|28828959|gb|AAO51540.1| similar to Plasmodium falciparum. Pla... 32 4.1
gi|23612156|ref|NP_703736.1| hypothetical protein, conserved [Pl... 32 4.1
gi|23482242|gb|EAA18281.1| ERYTHROCYTE MEMBRANE PROTEIN PFEMP3 [... 32 4.1
gi|11990532|gb|AAG42179.1| envelope glycoprotein [Human immunode... 32 4.1
gi|13508304|ref|NP_110254.1| conserved hypothetical protein [Myc... 32 4.1
gi|46199975|ref|YP_005642.1| protoheme IX farnesyltransferase [T... 32 4.1
gi|9506875|ref|NP_062148.1| MAD homolog 4; MAD (mothers against ... 32 4.1
gi|23102031|ref|ZP_00088562.1| COG0477: Permeases of the major f... 31 5.3
gi|48855430|ref|ZP_00309589.1| hypothetical protein Chut02001765... 31 5.3
gi|29655131|ref|NP_820823.1| hypothetical protein CBU1845 [Coxie... 31 5.3
gi|32699048|ref|NP_872420.1| hypothetical protein MGC20579 [Homo... 31 5.3
gi|11466207|ref|NP_066530.1| ribosomal protein S13 [Naegleria gr... 31 5.3
gi|46906861|ref|YP_013250.1| glycerophosphoryl diester phosphodi... 31 5.3
gi|47091577|ref|ZP_00229373.1| glycerophosphoryl diester phospho... 31 5.3
gi|50257588|gb|EAL20293.1| hypothetical protein CNBF1050 [Crypto... 31 5.3
gi|11465929|ref|NP_050062.1| NADH dehydrogenase subunit 2 [Pedin... 31 5.3
gi|45513270|ref|ZP_00164836.1| COG4974: Site-specific recombinas... 31 5.3
gi|37731981|gb|AAO67351.1| PRP1 [Rattus norvegicus] 31 5.3
gi|38014696|gb|AAH60519.1| Unknown (protein for MGC:72570) [Ratt... 31 5.3
gi|30268589|dbj|BAC76023.1| opsin [Branchiostoma belcheri] 31 7.0
gi|22788858|ref|NP_690572.1| hypothetical protein HZV_153 [Helio... 31 7.0
gi|46362851|ref|ZP_00225676.1| hypothetical protein Krad06004626... 31 7.0
gi|49118319|gb|AAH73327.1| Unknown (protein for MGC:80735) [Xeno... 31 7.0
gi|23509396|ref|NP_702063.1| hypothetical protein [Plasmodium fa... 31 7.0
gi|46156662|ref|ZP_00132303.2| COG0387: Ca2+/H+ antiporter [Haem... 31 7.0
gi|23466557|ref|ZP_00122145.1| COG0387: Ca2+/H+ antiporter [Haem... 31 7.0
gi|23509871|ref|NP_702538.1| hypothetical protein [Plasmodium fa... 31 7.0
gi|23463267|ref|NP_695207.1| GABAB-related G-protein coupled rec... 31 7.0
gi|48783696|ref|ZP_00280148.1| COG0477: Permeases of the major f... 31 7.0
gi|15669067|ref|NP_247871.1| iron(III) dicitrate transport syste... 31 7.0
gi|16805229|ref|NP_473257.1| binding protein, putative; hypothet... 31 7.0
gi|47218160|emb|CAG10080.1| unnamed protein product [Tetraodon n... 31 7.0
gi|23113310|ref|ZP_00098698.1| COG3559: Putative exporter of pol... 31 7.0
gi|22652723|gb|AAN03796.1| GABAB-related G-protein coupled recep... 31 7.0
gi|40254201|ref|NP_700443.2| G protein-coupled receptor 156; GAB... 31 7.0
gi|1079276|pir||A56561 35K proline-rich protein xlan4 - African ... 31 7.0
gi|23007100|ref|ZP_00049117.1| COG1609: Transcriptional regulato... 30 9.1
gi|15237787|ref|NP_197746.1| expressed protein [Arabidopsis thal... 30 9.1
gi|19112553|ref|NP_595761.1| hypothetical protein [Schizosacchar... 30 9.1
gi|23482746|gb|EAA18637.1| hypothetical protein [Plasmodium yoel... 30 9.1
gi|33865334|ref|NP_896893.1| multidrug efflux transporter, MFS f... 30 9.1
gi|48786514|ref|ZP_00282648.1| COG0178: Excinuclease ATPase subu... 30 9.1
gi|18977617|ref|NP_578974.1| hypothetical d-nopaline dehydrogena... 30 9.1
gi|13259497|ref|NP_002883.2| retinoblastoma-binding protein 1 is... 30 9.1
gi|1710030|sp|P29374|RBB1_HUMAN Retinoblastoma-binding protein 1... 30 9.1
gi|40457670|gb|AAR86861.1| maturase K [Ceratostema rauhii] 30 9.1
gi|11036632|ref|NP_055023.1| dentin sialophosphoprotein prepropr... 30 9.1
gi|13195767|gb|AAB25835.2| retinoblastoma binding protein 1 isof... 30 9.1
gi|13259501|ref|NP_075377.1| retinoblastoma-binding protein 1 is... 30 9.1
gi|298682|gb|AAB25833.1| retinoblastoma binding protein 1 isofor... 30 9.1
gi|4322670|gb|AAD16120.1| dentin phosphoryn [Homo sapiens] 30 9.1
gi|298684|gb|AAB25834.1| retinoblastoma binding protein 1 isofor... 30 9.1
gi|13259499|ref|NP_075376.1| retinoblastoma-binding protein 1 is... 30 9.1
gi|17563218|ref|NP_506244.1| serpentine Receptor, class D (delta... 30 9.1
gi|23477966|gb|EAA15181.1| CCAAT-box DNA binding protein subunit... 30 9.1
>gi|17533881|ref|NP_494847.1| i-141 protein like (2F31)
[Caenorhabditis elegans]
gi|20532310|sp|Q20263|YUW4_CAEEL Hypothetical UPF0198 protein
F41C3.4 in chromosome II
gi|7503144|pir||T16317 hypothetical protein F41C3.4 -
Caenorhabditis elegans
gi|746540|gb|AAC46811.1| Hypothetical protein F41C3.4
[Caenorhabditis elegans]
Length = 112
Score = 224 bits (570), Expect = 4e-58
Identities = 112/112 (100%), Positives = 112/112 (100%)
Frame = +1
Query: 1 MFLDSALLAIGNLLFIVGITFIIGVQRTLVFFFEFRKLKGSILFFGGILVVLFGYPLFGM 180
MFLDSALLAIGNLLFIVGITFIIGVQRTLVFFFEFRKLKGSILFFGGILVVLFGYPLFGM
Sbjct: 1 MFLDSALLAIGNLLFIVGITFIIGVQRTLVFFFEFRKLKGSILFFGGILVVLFGYPLFGM 60
Query: 181 IAECWGFIVLFGGFLPGIVNLLRSIPGISTITYLPGIRQVLDRLAPESKYPV 336
IAECWGFIVLFGGFLPGIVNLLRSIPGISTITYLPGIRQVLDRLAPESKYPV
Sbjct: 61 IAECWGFIVLFGGFLPGIVNLLRSIPGISTITYLPGIRQVLDRLAPESKYPV 112