Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= F41C3_6
         (339 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17533881|ref|NP_494847.1| i-141 protein like (2F31) [Caenorha...   224   4e-58
gi|39591168|emb|CAE73221.1| Hypothetical protein CBG20627 [Caeno...   217   5e-56
gi|31207271|ref|XP_312602.1| ENSANGP00000015000 [Anopheles gambi...   122   2e-27
gi|48110113|ref|XP_396259.1| similar to ENSANGP00000015000 [Apis...   120   5e-27
gi|7705636|ref|NP_057156.1| CGI-141 protein [Homo sapiens] >gnl|...   115   2e-25
gi|13385354|ref|NP_080148.1| CGI-141 protein; EST AA407874 [Mus ...   115   3e-25
gi|50729084|ref|XP_416423.1| PREDICTED: similar to UPF0198 prote...   115   3e-25
gi|26384022|dbj|BAB31257.2| unnamed protein product [Mus musculus]    115   3e-25
gi|48146895|emb|CAG33670.1| CGI-141 [Homo sapiens]                    114   5e-25
gi|7634779|gb|AAF65181.1| HDCMA39P [Homo sapiens]                     113   8e-25
gi|24642432|ref|NP_727945.1| CG32576-PA [Drosophila melanogaster...   107   4e-23
gi|47217237|emb|CAF96760.1| unnamed protein product [Tetraodon n...   105   2e-22
gi|17945675|gb|AAL48887.1| RE29988p [Drosophila melanogaster]         105   2e-22
gi|46443823|gb|EAL03102.1| hypothetical protein CaO19.3972 [Cand...   102   2e-21
gi|50546140|ref|XP_500597.1| hypothetical protein [Yarrowia lipo...    98   5e-20
gi|21311983|ref|NP_080956.1| RIKEN cDNA 0610012C01 [Mus musculus...    97   8e-20
gi|50427645|ref|XP_462435.1| unnamed protein product [Debaryomyc...    97   8e-20
gi|47224433|emb|CAG08683.1| unnamed protein product [Tetraodon n...    96   2e-19
gi|50258594|gb|EAL21281.1| hypothetical protein CNBD3350 [Crypto...    95   4e-19
gi|50295044|ref|XP_449933.1| unnamed protein product [Candida gl...    94   7e-19
gi|30678779|ref|NP_186968.2| Got1-like family protein [Arabidops...    93   1e-18
gi|6323949|ref|NP_014020.1| Golgi Transport; Got1p [Saccharomyce...    90   1e-17
gi|46226377|gb|EAK87382.1| conserved protein similar to Got1-lik...    88   4e-17
gi|34858579|ref|XP_342783.1| similar to CGI-141 protein; EST AA4...    88   5e-17
gi|50302981|ref|XP_451428.1| unnamed protein product [Kluyveromy...    87   6e-17
gi|38348211|ref|NP_940849.1| FLJ42654 protein [Homo sapiens] >gn...    87   1e-16
gi|45201433|ref|NP_987003.1| AGR337Wp [Eremothecium gossypii] >g...    86   1e-16
gi|15229139|ref|NP_190511.1| Got1-like family protein [Arabidops...    84   9e-16
gi|23510176|ref|NP_702842.1| CGI-141 protein homolog, putative [...    83   2e-15
gi|12324443|gb|AAG52183.1| unknown protein; 50647-51606 [Arabido...    83   2e-15
gi|19075588|ref|NP_588088.1| conserved hypothetical transmembran...    82   3e-15
gi|33146513|dbj|BAC79630.1| NFkB activating protein-like [Oryza ...    81   4e-15
gi|46124027|ref|XP_386567.1| hypothetical protein FG06391.1 [Gib...    79   3e-14
gi|23484669|gb|EAA19919.1| hypothetical protein [Plasmodium yoel...    74   7e-13
gi|6714435|gb|AAF26123.1| unknown protein [Arabidopsis thaliana]       73   2e-12
gi|22329359|ref|NP_683279.1| Got1-like family protein [Arabidops...    72   4e-12
gi|47497305|dbj|BAD19347.1| NFkB activating protein-like [Oryza ...    69   2e-11
gi|32411541|ref|XP_326251.1| hypothetical protein [Neurospora cr...    52   3e-06
gi|19074695|ref|NP_586201.1| hypothetical protein [Encephalitozo...    52   4e-06
gi|15597288|ref|NP_250782.1| probable MFS transporter [Pseudomon...    37   0.074
gi|32042199|ref|ZP_00139782.1| COG2814: Arabinose efflux permeas...    37   0.074
gi|49088362|gb|AAT51561.1| PA2092 [synthetic construct]                37   0.074
gi|5835455|ref|NP_008379.1|ND5_13186 NADH dehydrogenase subunit ...    35   0.48
gi|40548812|ref|NP_954726.1| NADH dehydrogenase subunit 5 [Dirof...    34   0.82
gi|23479406|gb|EAA16244.1| fimbriae-associated protein Fap1 [Pla...    33   1.1
gi|29349993|ref|NP_813496.1| putative Na+/H+ anitporter [Bactero...    33   1.1
gi|23480588|gb|EAA17110.1| hypothetical protein [Plasmodium yoel...    33   1.1
gi|39590065|emb|CAE61063.1| Hypothetical protein CBG04812 [Caeno...    33   1.4
gi|48771192|ref|ZP_00275535.1| COG0659: Sulfate permease and rel...    33   1.4
gi|19703602|ref|NP_603164.1| Transporter [Fusobacterium nucleatu...    33   1.8
gi|23612517|ref|NP_704078.1| hypothetical protein [Plasmodium fa...    32   2.4
gi|49257726|gb|AAH74539.1| Unknown (protein for MGC:69213) [Xeno...    32   3.1
gi|23510077|ref|NP_702743.1| hypothetical protein [Plasmodium fa...    32   3.1
gi|28373155|ref|NP_783754.1| ABC transporter-associated permease...    32   3.1
gi|23508359|ref|NP_701028.1| hypothetical protein [Plasmodium fa...    32   3.1
gi|21226210|ref|NP_632132.1| hypothetical protein MM0108 [Methan...    32   3.1
gi|16802658|ref|NP_464143.1| C-terminal domain similar to glycer...    32   3.1
gi|34880258|ref|XP_344142.1| similar to CG11345-PA [Rattus norve...    32   3.1
gi|15221700|ref|NP_173832.1| paired amphipathic helix repeat-con...    32   4.1
gi|34394726|dbj|BAC84089.1| putative transducin / WD-40 repeat p...    32   4.1
gi|45915997|ref|ZP_00194811.2| COG3333: Uncharacterized protein ...    32   4.1
gi|28828959|gb|AAO51540.1| similar to Plasmodium falciparum. Pla...    32   4.1
gi|23612156|ref|NP_703736.1| hypothetical protein, conserved [Pl...    32   4.1
gi|23482242|gb|EAA18281.1| ERYTHROCYTE MEMBRANE PROTEIN PFEMP3 [...    32   4.1
gi|11990532|gb|AAG42179.1| envelope glycoprotein [Human immunode...    32   4.1
gi|13508304|ref|NP_110254.1| conserved hypothetical protein [Myc...    32   4.1
gi|46199975|ref|YP_005642.1| protoheme IX farnesyltransferase [T...    32   4.1
gi|9506875|ref|NP_062148.1| MAD homolog 4; MAD (mothers against ...    32   4.1
gi|23102031|ref|ZP_00088562.1| COG0477: Permeases of the major f...    31   5.3
gi|48855430|ref|ZP_00309589.1| hypothetical protein Chut02001765...    31   5.3
gi|29655131|ref|NP_820823.1| hypothetical protein CBU1845 [Coxie...    31   5.3
gi|32699048|ref|NP_872420.1| hypothetical protein MGC20579 [Homo...    31   5.3
gi|11466207|ref|NP_066530.1| ribosomal protein S13 [Naegleria gr...    31   5.3
gi|46906861|ref|YP_013250.1| glycerophosphoryl diester phosphodi...    31   5.3
gi|47091577|ref|ZP_00229373.1| glycerophosphoryl diester phospho...    31   5.3
gi|50257588|gb|EAL20293.1| hypothetical protein CNBF1050 [Crypto...    31   5.3
gi|11465929|ref|NP_050062.1| NADH dehydrogenase subunit 2 [Pedin...    31   5.3
gi|45513270|ref|ZP_00164836.1| COG4974: Site-specific recombinas...    31   5.3
gi|37731981|gb|AAO67351.1| PRP1 [Rattus norvegicus]                    31   5.3
gi|38014696|gb|AAH60519.1| Unknown (protein for MGC:72570) [Ratt...    31   5.3
gi|30268589|dbj|BAC76023.1| opsin [Branchiostoma belcheri]             31   7.0
gi|22788858|ref|NP_690572.1| hypothetical protein HZV_153 [Helio...    31   7.0
gi|46362851|ref|ZP_00225676.1| hypothetical protein Krad06004626...    31   7.0
gi|49118319|gb|AAH73327.1| Unknown (protein for MGC:80735) [Xeno...    31   7.0
gi|23509396|ref|NP_702063.1| hypothetical protein [Plasmodium fa...    31   7.0
gi|46156662|ref|ZP_00132303.2| COG0387: Ca2+/H+ antiporter [Haem...    31   7.0
gi|23466557|ref|ZP_00122145.1| COG0387: Ca2+/H+ antiporter [Haem...    31   7.0
gi|23509871|ref|NP_702538.1| hypothetical protein [Plasmodium fa...    31   7.0
gi|23463267|ref|NP_695207.1| GABAB-related G-protein coupled rec...    31   7.0
gi|48783696|ref|ZP_00280148.1| COG0477: Permeases of the major f...    31   7.0
gi|15669067|ref|NP_247871.1| iron(III) dicitrate transport syste...    31   7.0
gi|16805229|ref|NP_473257.1| binding protein, putative; hypothet...    31   7.0
gi|47218160|emb|CAG10080.1| unnamed protein product [Tetraodon n...    31   7.0
gi|23113310|ref|ZP_00098698.1| COG3559: Putative exporter of pol...    31   7.0
gi|22652723|gb|AAN03796.1| GABAB-related G-protein coupled recep...    31   7.0
gi|40254201|ref|NP_700443.2| G protein-coupled receptor 156; GAB...    31   7.0
gi|1079276|pir||A56561 35K proline-rich protein xlan4 - African ...    31   7.0
gi|23007100|ref|ZP_00049117.1| COG1609: Transcriptional regulato...    30   9.1
gi|15237787|ref|NP_197746.1| expressed protein [Arabidopsis thal...    30   9.1
gi|19112553|ref|NP_595761.1| hypothetical protein [Schizosacchar...    30   9.1
gi|23482746|gb|EAA18637.1| hypothetical protein [Plasmodium yoel...    30   9.1
gi|33865334|ref|NP_896893.1| multidrug efflux transporter, MFS f...    30   9.1
gi|48786514|ref|ZP_00282648.1| COG0178: Excinuclease ATPase subu...    30   9.1
gi|18977617|ref|NP_578974.1| hypothetical d-nopaline dehydrogena...    30   9.1
gi|13259497|ref|NP_002883.2| retinoblastoma-binding protein 1 is...    30   9.1
gi|1710030|sp|P29374|RBB1_HUMAN Retinoblastoma-binding protein 1...    30   9.1
gi|40457670|gb|AAR86861.1| maturase K [Ceratostema rauhii]             30   9.1
gi|11036632|ref|NP_055023.1| dentin sialophosphoprotein prepropr...    30   9.1
gi|13195767|gb|AAB25835.2| retinoblastoma binding protein 1 isof...    30   9.1
gi|13259501|ref|NP_075377.1| retinoblastoma-binding protein 1 is...    30   9.1
gi|298682|gb|AAB25833.1| retinoblastoma binding protein 1 isofor...    30   9.1
gi|4322670|gb|AAD16120.1| dentin phosphoryn [Homo sapiens]             30   9.1
gi|298684|gb|AAB25834.1| retinoblastoma binding protein 1 isofor...    30   9.1
gi|13259499|ref|NP_075376.1| retinoblastoma-binding protein 1 is...    30   9.1
gi|17563218|ref|NP_506244.1| serpentine Receptor, class D (delta...    30   9.1
gi|23477966|gb|EAA15181.1| CCAAT-box DNA binding protein subunit...    30   9.1


>gi|17533881|ref|NP_494847.1| i-141 protein like (2F31)
           [Caenorhabditis elegans]
 gi|20532310|sp|Q20263|YUW4_CAEEL Hypothetical UPF0198 protein
           F41C3.4 in chromosome II
 gi|7503144|pir||T16317 hypothetical protein F41C3.4 -
           Caenorhabditis elegans
 gi|746540|gb|AAC46811.1| Hypothetical protein F41C3.4
           [Caenorhabditis elegans]
          Length = 112

 Score =  224 bits (570), Expect = 4e-58
 Identities = 112/112 (100%), Positives = 112/112 (100%)
 Frame = +1

Query: 1   MFLDSALLAIGNLLFIVGITFIIGVQRTLVFFFEFRKLKGSILFFGGILVVLFGYPLFGM 180
           MFLDSALLAIGNLLFIVGITFIIGVQRTLVFFFEFRKLKGSILFFGGILVVLFGYPLFGM
Sbjct: 1   MFLDSALLAIGNLLFIVGITFIIGVQRTLVFFFEFRKLKGSILFFGGILVVLFGYPLFGM 60

Query: 181 IAECWGFIVLFGGFLPGIVNLLRSIPGISTITYLPGIRQVLDRLAPESKYPV 336
           IAECWGFIVLFGGFLPGIVNLLRSIPGISTITYLPGIRQVLDRLAPESKYPV
Sbjct: 61  IAECWGFIVLFGGFLPGIVNLLRSIPGISTITYLPGIRQVLDRLAPESKYPV 112




[DB home][top]