Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F41C6_4
(978 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17567621|ref|NP_509162.1| COLlagen structural gene (col-173) ... 271 2e-71
gi|39586769|emb|CAE65811.1| Hypothetical protein CBG10919 [Caeno... 246 7e-64
gi|32566594|ref|NP_872267.1| COLlagen structural gene (col-170) ... 80 7e-14
gi|17569753|ref|NP_509060.1| COLlagen structural gene (28.5 kD) ... 79 2e-13
gi|17569755|ref|NP_509059.1| COLlagen structural gene (28.5 kD) ... 78 3e-13
gi|7507620|pir||T16841 hypothetical protein T10E10.2 - Caenorhab... 78 3e-13
gi|32566570|ref|NP_872255.1| COLlagen structural gene (28.4 kD) ... 77 5e-13
gi|39585826|emb|CAE61239.1| Hypothetical protein CBG05039 [Caeno... 77 6e-13
gi|17550996|ref|NP_509960.1| COLlagen structural gene (col-180Co... 77 6e-13
gi|39585824|emb|CAE61237.1| Hypothetical protein CBG05037 [Caeno... 77 8e-13
gi|30025105|gb|AAP13769.1| Hypothetical protein T07H6.3b [Caenor... 77 8e-13
gi|17569675|ref|NP_509051.1| COLlagen structural gene (col-166) ... 77 8e-13
gi|32566596|ref|NP_872268.1| COLlagen structural gene (col-171) ... 76 1e-12
gi|39585825|emb|CAE61238.1| Hypothetical protein CBG05038 [Caeno... 76 1e-12
gi|39585828|emb|CAE61241.1| Hypothetical protein CBG05041 [Caeno... 76 1e-12
gi|39585827|emb|CAE61240.1| Hypothetical protein CBG05040 [Caeno... 75 2e-12
gi|39585817|emb|CAE61230.1| Hypothetical protein CBG05029 [Caeno... 74 5e-12
gi|1236783|emb|CAA65506.1| cuticular collagen [Teladorsagia circ... 69 2e-10
gi|1236781|emb|CAA65507.1| cuticular collagen [Teladorsagia circ... 69 2e-10
gi|17532621|ref|NP_494879.1| COLlagen structural gene (col-20) [... 55 5e-10
gi|39581442|emb|CAE74724.1| Hypothetical protein CBG22542 [Caeno... 67 5e-10
gi|32567317|ref|NP_506284.2| COLlagen structural gene (30.3 kD) ... 67 8e-10
gi|17559060|ref|NP_505677.1| COLlagen structural gene (col-13) [... 66 1e-09
gi|17559058|ref|NP_505678.1| COLlagen structural gene (30.1 kD) ... 66 1e-09
gi|17533809|ref|NP_496362.1| COLlagen structural gene (29.2 kD) ... 66 1e-09
gi|17561542|ref|NP_506283.1| COLlagen structural gene (col-159) ... 65 2e-09
gi|563237|gb|AAC46628.1| cuticular collagen Bmcol-2 65 2e-09
gi|17541194|ref|NP_499905.1| COLlagen structural gene (col-101) ... 65 3e-09
gi|1814029|gb|AAB41793.1| cuticle collagen [Caenorhabditis brigg... 64 4e-09
gi|39593349|emb|CAE64819.1| Hypothetical protein CBG09613 [Caeno... 64 4e-09
gi|17532495|ref|NP_493660.1| COLlagen structural gene (col-68) [... 64 4e-09
gi|39587231|emb|CAE57699.1| Hypothetical protein CBG00703 [Caeno... 64 4e-09
gi|39586875|emb|CAE62810.1| Hypothetical protein CBG06986 [Caeno... 63 1e-08
gi|17535253|ref|NP_495759.1| COLlagen structural gene (29.4 kD) ... 63 1e-08
gi|17543526|ref|NP_502966.1| predicted CDS, COLlagen structural ... 61 3e-08
gi|7498929|pir||T29980 hypothetical protein F11G11.10 - Caenorha... 61 4e-08
gi|39579269|emb|CAE56956.1| Hypothetical protein CBG24806 [Caeno... 61 4e-08
gi|7504495|pir||T22827 hypothetical protein F57B1.4 - Caenorhabd... 60 8e-08
gi|39597358|emb|CAE59586.1| Hypothetical protein CBG02987 [Caeno... 60 1e-07
gi|17533115|ref|NP_494880.1| COLlagen structural gene (col-73) [... 59 1e-07
gi|39597359|emb|CAE59587.1| Hypothetical protein CBG02988 [Caeno... 59 2e-07
gi|17531395|ref|NP_495104.1| BLIstered cuticle BLI-2, Nematode c... 59 2e-07
gi|39596930|emb|CAE59157.1| Hypothetical protein CBG02463 [Caeno... 59 2e-07
gi|39593181|emb|CAE64650.1| Hypothetical protein CBG09421 [Caeno... 58 3e-07
gi|17533807|ref|NP_496361.1| COLlagen structural gene (30.9 kD) ... 58 4e-07
gi|39587054|emb|CAE62989.1| Hypothetical protein CBG07217 [Caeno... 57 5e-07
gi|39586728|emb|CAE65770.1| Hypothetical protein CBG10862 [Caeno... 55 2e-06
gi|17567513|ref|NP_509121.1| COLlagen structural gene (35.0 kD) ... 55 2e-06
gi|46195903|gb|AAB37842.2| Collagen protein 20 [Caenorhabditis e... 55 3e-06
gi|32563747|ref|NP_494878.2| COLlagen structural gene (col-17) [... 55 3e-06
gi|39585576|emb|CAE65336.1| Hypothetical protein CBG10272 [Caeno... 54 5e-06
gi|687634|gb|AAA62504.1| collagen 54 7e-06
gi|4335794|gb|AAD17458.1| cuticular collagen [Ascaris suum] 54 7e-06
gi|39585160|emb|CAE57403.1| Hypothetical protein CBG00356 [Caeno... 53 9e-06
gi|7378665|emb|CAB85468.1| putative cuticular collagen [Brugia p... 51 3e-05
gi|39597656|emb|CAE68347.1| Hypothetical protein CBG14077 [Caeno... 50 6e-05
gi|17551374|ref|NP_510617.1| COLlagen structural gene (col-186) ... 50 6e-05
gi|7494563|pir||T34507 cutical collagen 6 - Caenorhabditis elegans 50 8e-05
gi|32563818|ref|NP_871912.1| ROLler: helically twisted, animals ... 50 8e-05
gi|39595982|emb|CAE67485.1| Hypothetical protein CBG12990 [Caeno... 50 8e-05
gi|17535689|ref|NP_495582.1| ROLler: helically twisted, animals ... 50 8e-05
gi|84433|pir||JS0167 collagen col-6 - Caenorhabditis elegans >gn... 50 8e-05
gi|17536359|ref|NP_496665.1| COLlagen structural gene (col-85) [... 50 8e-05
gi|11466451|ref|NP_046743.1| Rep-like [Dictyostelium discoideum]... 50 1e-04
gi|5514647|emb|CAB50767.1| putative cuticular collagen protein [... 49 1e-04
gi|17567743|ref|NP_509276.1| COLlagen structural gene (30.0 kD) ... 49 2e-04
gi|17539404|ref|NP_503048.1| COLlagen structural gene (28.0 kD) ... 49 2e-04
gi|17551382|ref|NP_508395.1| DumPY : shorter than wild-type DPY-... 49 2e-04
gi|39594125|emb|CAE70235.1| Hypothetical protein CBG16724 [Caeno... 49 2e-04
gi|39594818|emb|CAE70686.1| Hypothetical protein CBG17403 [Caeno... 48 3e-04
gi|39593182|emb|CAE64651.1| Hypothetical protein CBG09422 [Caeno... 46 0.001
gi|21954120|gb|AAM80556.1| cuticular collagen [Trichinella spira... 45 0.003
gi|687636|gb|AAA62505.1| collagen [Caenorhabditis elegans] 45 0.003
gi|17550810|ref|NP_509869.1| COLlagen structural gene (27.8 kD) ... 44 0.004
gi|39579268|emb|CAE56955.1| Hypothetical protein CBG24805 [Caeno... 44 0.004
gi|32453014|gb|AAA96159.2| Collagen protein 33 [Caenorhabditis e... 44 0.006
gi|1813688|gb|AAC47626.1| unknown [Brugia malayi] >gnl|BL_ORD_ID... 44 0.007
gi|39586045|emb|CAE69121.1| Hypothetical protein CBG15147 [Caeno... 44 0.007
gi|17536229|ref|NP_493913.1| COLlagen structural gene (col-40) [... 43 0.010
gi|17550812|ref|NP_509870.1| COLlagen structural gene (col-179) ... 43 0.012
gi|39590411|emb|CAE66150.1| Hypothetical protein CBG11380 [Caeno... 43 0.012
gi|23510183|ref|NP_702849.1| hypothetical protein [Plasmodium fa... 42 0.016
gi|7378657|emb|CAB85466.1| putative cuticular collagen [Ascaris ... 42 0.016
gi|39594817|emb|CAE70685.1| Hypothetical protein CBG17402 [Caeno... 42 0.021
gi|345339|pir||JC1448 collagen col-34 - Caenorhabditis elegans >... 42 0.021
gi|17566746|ref|NP_505074.1| COLlagen structural gene (29.5 kD) ... 42 0.021
gi|39580357|emb|CAE61462.1| Hypothetical protein CBG05354 [Caeno... 42 0.021
gi|17539490|ref|NP_500520.1| abnormal RAy Morphology RAM-4, COLl... 42 0.021
gi|7496625|pir||T15670 hypothetical protein C27H5.5 - Caenorhabd... 42 0.028
gi|39582304|emb|CAE67553.1| Hypothetical protein CBG13078 [Caeno... 42 0.028
gi|17538876|ref|NP_502107.1| COLlagen structural gene (28.7 kD) ... 42 0.028
gi|17539484|ref|NP_501527.1| COLlagen structural gene (col-3) [C... 42 0.028
gi|39578930|emb|CAE57041.1| Hypothetical protein CBG24927 [Caeno... 42 0.028
gi|39593732|emb|CAE62024.1| Hypothetical protein CBG06035 [Caeno... 42 0.028
gi|17532623|ref|NP_495487.1| COLlagen structural gene (col-36) [... 42 0.028
gi|48060128|gb|AAK68452.2| Collagen protein 108 [Caenorhabditis ... 41 0.036
gi|22096343|sp|P34804|CC40_CAEEL Cuticle collagen 40 41 0.036
gi|17543264|ref|NP_500133.1| COLlagen structural gene (col-108) ... 41 0.036
gi|7508918|pir||T26125 hypothetical protein W03G11.1 - Caenorhab... 41 0.047
gi|39596236|emb|CAE69873.1| Hypothetical protein CBG16210 [Caeno... 41 0.047
gi|17570227|ref|NP_510021.1| COLlagen structural gene (col-181) ... 41 0.047
gi|39592242|emb|CAE75463.1| Hypothetical protein CBG23461 [Caeno... 40 0.062
gi|17563290|ref|NP_506095.1| COLlagen structural gene, SQuaT SQT... 40 0.062
gi|17507553|ref|NP_490679.1| COLlagen structural gene (col-45) [... 40 0.081
gi|25145834|ref|NP_501273.2| COLlagen structural gene (col-14) [... 40 0.11
gi|7497485|pir||T29810 hypothetical protein C46A5.3 - Caenorhabd... 40 0.11
gi|39595004|emb|CAE70872.1| Hypothetical protein CBG17662 [Caeno... 40 0.11
gi|39592038|emb|CAE75258.1| Hypothetical protein CBG23219 [Caeno... 40 0.11
gi|39592014|emb|CAE75234.1| Hypothetical protein CBG23185 [Caeno... 40 0.11
gi|39592016|emb|CAE75236.1| Hypothetical protein CBG23187 [Caeno... 40 0.11
gi|39580360|emb|CAE61465.1| Hypothetical protein CBG05357 [Caeno... 39 0.14
gi|17385615|emb|CAD12627.1| involucrin [Sus scrofa] 39 0.14
gi|23508027|ref|NP_700697.1| dynein heavy chain, putative [Plasm... 39 0.14
gi|17561474|ref|NP_505886.1| COLlagen structural gene (29.3 kD) ... 39 0.14
gi|17539488|ref|NP_500524.1| COLlagen structural gene (col-33) [... 39 0.14
gi|115401|sp|P16253|CAC3_HAECO Cuticle collagen 3A3 >gnl|BL_ORD_... 39 0.14
gi|321006|pir||A44984 collagen - nematode (Haemonchus contortus) 39 0.14
gi|39584781|emb|CAE67676.1| Hypothetical protein CBG13239 [Caeno... 39 0.18
gi|24639713|ref|NP_525072.2| CG3346-PA [Drosophila melanogaster]... 39 0.18
gi|39595798|emb|CAE67301.1| Hypothetical protein CBG12754 [Caeno... 39 0.18
gi|33285161|gb|AAC48094.2| Dumpy : shorter than wild-type protei... 39 0.18
gi|17384366|emb|CAD13202.1| involucrin [Sus scrofa] 39 0.18
gi|34870058|ref|XP_221812.2| similar to ecotropic viral integrat... 38 0.31
gi|32565764|ref|NP_871702.1| COLlagen structural gene (col-95) [... 38 0.31
gi|39584177|emb|CAE61552.1| Hypothetical protein CBG05461 [Caeno... 38 0.31
gi|25153764|ref|NP_741423.1| COLlagen structural gene (28.9 kD) ... 38 0.31
gi|17507951|ref|NP_491958.1| COLlagen structural gene (col-59) [... 38 0.31
gi|84431|pir||JS0169 collagen col-14 - Caenorhabditis elegans >g... 38 0.31
gi|17158629|ref|NP_478050.1| wsv528 [shrimp white spot syndrome ... 38 0.31
gi|39584782|emb|CAE67677.1| Hypothetical protein CBG13240 [Caeno... 38 0.40
gi|17564278|ref|NP_505913.1| predicted CDS, COLlagen structural ... 38 0.40
gi|28850409|gb|AAO53177.1| similar to Dictyostelium discoideum (... 38 0.40
gi|39588940|emb|CAE69570.1| Hypothetical protein CBG15782 [Caeno... 38 0.40
gi|2330003|gb|AAB66717.1| glutamine rich protein [Gallus gallus] 38 0.40
gi|50751893|ref|XP_422565.1| PREDICTED: similar to glutamine ric... 37 0.52
gi|47219637|emb|CAG02682.1| unnamed protein product [Tetraodon n... 37 0.52
gi|39596498|emb|CAE63117.1| Hypothetical protein CBG07414 [Caeno... 37 0.52
gi|46442513|gb|EAL01802.1| hypothetical protein CaO19.4330 [Cand... 37 0.52
gi|33596564|ref|NP_884207.1| putative membrane protein [Bordetel... 37 0.52
gi|17540574|ref|NP_502700.1| COLlagen structural gene (col-133) ... 37 0.68
gi|26351751|dbj|BAC39512.1| unnamed protein product [Mus musculus] 37 0.68
gi|32565788|ref|NP_871711.1| predicted CDS, COLlagen structural ... 37 0.68
gi|11037008|gb|AAG27458.1| latent nuclear antigen [Human herpesv... 37 0.68
gi|39591777|emb|CAE71355.1| Hypothetical protein CBG18258 [Caeno... 37 0.89
gi|17555478|ref|NP_499409.1| COLlagen structural gene (29.2 kD) ... 37 0.89
gi|17555480|ref|NP_499408.1| COLlagen structural gene (29.2 kD) ... 37 0.89
gi|17532741|ref|NP_495367.1| DumPY : shorter than wild-type DPY-... 37 0.89
gi|7332272|gb|AAA17398.2| collagen [Caenorhabditis elegans] 37 0.89
gi|543967|sp|P35799|CCD2_CAEEL Cuticle collagen dpy-2 precursor 37 0.89
gi|7494560|pir||T37285 collagen dpy-2 - Caenorhabditis elegans 37 0.89
gi|17539482|ref|NP_501829.1| COLlagen structural gene (col-2) [C... 37 0.89
gi|39596499|emb|CAE63118.1| Hypothetical protein CBG07415 [Caeno... 37 0.89
gi|17385617|emb|CAD12628.1| involucrin [Sus scrofa] 37 0.89
gi|27461725|gb|AAN05017.1| pinin [Mus musculus] 37 0.89
gi|39585732|emb|CAE59934.1| Hypothetical protein CBG03420 [Caeno... 37 0.89
gi|39594094|emb|CAE70204.1| Hypothetical protein CBG16679 [Caeno... 37 0.89
gi|26326913|dbj|BAC27200.1| unnamed protein product [Mus musculus] 37 0.89
gi|50731940|ref|XP_418425.1| PREDICTED: similar to collagen, typ... 37 0.89
gi|47523948|ref|NP_999613.1| involucrin [Sus scrofa] >gnl|BL_ORD... 37 0.89
gi|320995|pir||A44982 collagen UCOL1 - pig roundworm (fragment) ... 37 0.89
gi|17385613|emb|CAD12626.1| involucrin [Sus scrofa] 37 0.89
gi|15240463|ref|NP_198074.1| protein transport protein-related [... 36 1.2
gi|2464953|emb|CAA90476.1| putative tail protein [Enterobacteria... 36 1.2
gi|17542966|ref|NP_501617.1| COLlagen structural gene (col-120) ... 36 1.2
gi|39595279|emb|CAE60316.1| Hypothetical protein CBG03907 [Caeno... 36 1.2
gi|33601117|ref|NP_888677.1| putative membrane protein [Bordetel... 36 1.2
gi|30262170|ref|NP_844547.1| conserved domain protein [Bacillus ... 36 1.2
gi|39584181|emb|CAE61556.1| Hypothetical protein CBG05465 [Caeno... 36 1.5
gi|33592578|ref|NP_880222.1| putative membrane protein [Bordetel... 36 1.5
gi|115397|sp|P08124|CC01_CAEEL Cuticle collagen 1 precursor (Squ... 36 1.5
gi|6679407|ref|NP_032917.1| pinin [Mus musculus] >gnl|BL_ORD_ID|... 36 1.5
gi|39584784|emb|CAE67679.1| Hypothetical protein CBG13242 [Caeno... 36 1.5
gi|2801529|gb|AAB97359.1| IgG immunoreactive antigen [Strongyloi... 36 1.5
gi|46442648|gb|EAL01936.1| hypothetical protein CaO19.11806 [Can... 36 1.5
gi|27552474|emb|CAD59915.1| M protein [Streptococcus pyogenes] 35 2.0
gi|17553060|ref|NP_499703.1| COLlagen structural gene (col-98) [... 35 2.0
gi|17533645|ref|NP_496367.1| COLlagen structural gene (col-83) [... 35 2.0
gi|39596517|emb|CAE63136.1| Hypothetical protein CBG07436 [Caeno... 35 2.0
gi|17510331|ref|NP_491088.1| COLlagen structural gene (col-48) [... 35 2.0
gi|39595524|emb|CAE60562.1| Hypothetical protein CBG04191 [Caeno... 35 2.0
gi|17568327|ref|NP_509766.1| cuticle collagen 1 like (XL161) [Ca... 35 2.0
gi|47212911|emb|CAF93289.1| unnamed protein product [Tetraodon n... 35 2.0
gi|50553466|ref|XP_504144.1| hypothetical protein [Yarrowia lipo... 35 2.0
gi|50405059|ref|YP_054151.1| hypothetical protein PTMB.222 [Para... 35 2.0
gi|1408192|gb|AAB03660.1| myosin heavy chain [Placopecten magell... 35 2.0
gi|33589138|emb|CAB82206.2| C. elegans COL-83 protein (correspon... 35 2.0
gi|47568496|ref|ZP_00239196.1| spermine/spermidine synthase fami... 35 2.0
gi|1408194|gb|AAB03661.1| myosin heavy chain [Placopecten magell... 35 2.0
gi|5817598|gb|AAD52842.1| myosin heavy chain [Pecten maximus] 35 2.0
gi|14029840|gb|AAK52834.1| cytoplasmic polyadenylation element-b... 35 2.0
gi|17551424|ref|NP_510247.1| COLlagen structural gene (col-183) ... 35 2.0
gi|30230638|gb|AAP20882.1| M protein [Streptococcus pyogenes] 35 2.0
gi|39596084|emb|CAE69720.1| Hypothetical protein CBG15991 [Caeno... 35 2.6
gi|38107659|gb|EAA53803.1| hypothetical protein MG09553.4 [Magna... 35 2.6
gi|17568109|ref|NP_510274.1| COLlagen structural gene (col-44) [... 35 2.6
gi|32698037|emb|CAE11316.1| Hypothetical protein H06A10.2 [Caeno... 35 2.6
gi|17555472|ref|NP_499410.1| COLlagen structural gene (29.2 kD) ... 35 2.6
gi|39591778|emb|CAE71356.1| Hypothetical protein CBG18259 [Caeno... 35 2.6
gi|41203898|ref|XP_372522.1| similar to Plasmodium falciparum tr... 35 2.6
gi|15292193|gb|AAK93365.1| LD41932p [Drosophila melanogaster] 35 2.6
gi|24641414|ref|NP_572750.2| CG32662-PA [Drosophila melanogaster... 35 2.6
gi|42781280|ref|NP_978527.1| hypothetical protein BCE2215 [Bacil... 35 2.6
gi|50551527|ref|XP_503237.1| hypothetical protein [Yarrowia lipo... 35 2.6
gi|39580356|emb|CAE61461.1| Hypothetical protein CBG05353 [Caeno... 35 2.6
gi|17539566|ref|NP_500519.1| DumPY : shorter than wild-type DPY-... 35 2.6
gi|34365399|emb|CAE46015.1| hypothetical protein [Homo sapiens] 35 2.6
gi|28828729|gb|AAO51324.1| similar to Dictyostelium discoideum (... 35 2.6
gi|22477176|gb|AAH36669.1| COL25A1 protein [Homo sapiens] 31 3.1
gi|4581463|emb|CAA70874.1| MEMA [Homo sapiens] 35 3.4
gi|7416980|gb|AAF62392.1| myosin heavy chain catch (smooth) musc... 35 3.4
gi|7416979|gb|AAF62391.1| myosin heavy chain striated muscle spe... 35 3.4
gi|4809258|gb|AAD30169.1| collagen [Haemonchus contortus] 35 3.4
gi|6563230|gb|AAF17209.1| nuclear protein SDK3 [Homo sapiens] 35 3.4
gi|497653|gb|AAC46490.1| myosin heavy chain >gnl|BL_ORD_ID|76853... 35 3.4
gi|11320891|gb|AAG33941.1| pinin [Homo sapiens] 35 3.4
gi|33356174|ref|NP_002678.2| pinin, desmosome associated protein... 35 3.4
gi|7416983|gb|AAF62395.1| myosin heavy chain cardiac muscle spec... 35 3.4
gi|236789|gb|AAB19995.1| myosin heavy chain=rod region [Aequipec... 35 3.4
gi|3746909|gb|AAC64112.1| M protein [Streptococcus pyogenes] 35 3.4
gi|39582210|emb|CAE64161.1| Hypothetical protein CBG08781 [Caeno... 35 3.4
gi|17540822|ref|NP_500071.1| COLlagen structural gene (col-105) ... 35 3.4
gi|1684845|gb|AAB48303.1| pinin [Canis familiaris] 35 3.4
gi|50311107|ref|XP_455577.1| unnamed protein product [Kluyveromy... 35 3.4
gi|3021392|emb|CAA71377.1| nuclear protein SDK3 [Homo sapiens] 35 3.4
gi|20837095|ref|XP_130326.1| RIKEN cDNA 4930525K21 [Mus musculus] 35 3.4
gi|50838816|ref|NP_001002871.1| transcriptional intermediary fac... 35 3.4
gi|7416982|gb|AAF62394.1| myosin heavy chain cardiac muscle spec... 35 3.4
gi|127773|sp|P24733|MYS_AEQIR Myosin heavy chain, striated muscl... 35 3.4
gi|38092641|ref|XP_356565.1| similar to hypothetical protein FLJ... 34 4.4
gi|39580830|emb|CAE73091.1| Hypothetical protein CBG20470 [Caeno... 34 4.4
gi|39586900|emb|CAE62835.1| Hypothetical protein CBG07014 [Caeno... 34 4.4
gi|2623367|gb|AAC53441.1| sex determining protein [Mus musculus ... 34 4.4
gi|23613722|ref|NP_704743.1| hypothetical protein [Plasmodium fa... 34 4.4
gi|47211492|emb|CAF93419.1| unnamed protein product [Tetraodon n... 34 4.4
gi|39598359|emb|CAE69052.1| Hypothetical protein CBG15061 [Caeno... 34 4.4
gi|34853083|ref|XP_342390.1| similar to RIKEN cDNA 5730436L13; s... 34 4.4
gi|50305865|ref|XP_452893.1| unnamed protein product [Kluyveromy... 34 4.4
gi|586120|sp|Q07283|TRHY_HUMAN Trichohyalin >gnl|BL_ORD_ID|13043... 34 4.4
gi|21955241|ref|NP_523865.2| CG16778-PB [Drosophila melanogaster... 34 4.4
gi|480565|pir||S37046 IgA receptor - Streptococcus pyogenes >gnl... 34 4.4
gi|38102931|gb|EAA49705.1| hypothetical protein MG09696.4 [Magna... 34 4.4
gi|33591257|gb|AAL06398.2| unknown [Francisella tularensis subsp... 34 5.8
gi|26342539|dbj|BAC34926.1| unnamed protein product [Mus musculus] 34 5.8
gi|23482650|gb|EAA18573.1| hypothetical protein [Plasmodium yoel... 34 5.8
gi|39597388|emb|CAE59617.1| Hypothetical protein CBG03026 [Caeno... 34 5.8
gi|1222642|emb|CAA63070.1| collagen [Brugia pahangi] 34 5.8
gi|32450714|gb|AAH54083.1| 4633402D15Rik protein [Mus musculus] 34 5.8
gi|17536751|ref|NP_495952.1| predicted CDS, COLlagen structural ... 34 5.8
gi|39939179|ref|NP_950945.1| chromosome segregation ATPase homol... 34 5.8
gi|17560884|ref|NP_504252.1| COLlagen structural gene (col-139) ... 34 5.8
gi|48895636|ref|ZP_00328620.1| COG4252: Predicted transmembrane ... 34 5.8
gi|586121|sp|P37709|TRHY_RABIT Trichohyalin >gnl|BL_ORD_ID|29628... 34 5.8
gi|47229594|emb|CAG06790.1| unnamed protein product [Tetraodon n... 30 6.0
gi|17531401|ref|NP_493635.1| COLlagen structural gene (col-67Co)... 33 7.5
gi|24379903|ref|NP_721858.1| putative chromosome segregation ATP... 33 7.5
gi|2623355|gb|AAC53435.1| sex determining protein [Mus musculus ... 33 7.5
gi|7512516|pir||T34567 hypothetical protein DKFZp434A128.1 - hum... 33 7.5
gi|24649755|ref|NP_651279.1| CG13627-PA [Drosophila melanogaster... 33 7.5
gi|25012526|gb|AAN71366.1| RE32656p [Drosophila melanogaster] 33 7.5
gi|45551964|ref|NP_733032.2| CG13627-PB [Drosophila melanogaster... 33 7.5
gi|49121568|ref|XP_412424.1| hypothetical protein AN8287.2 [Aspe... 33 7.5
gi|42656909|ref|XP_291028.3| hypothetical protein DKFZp434A128 [... 33 7.5
gi|125332|sp|P14083|TKR_DROME Protein TKR >gnl|BL_ORD_ID|1128574... 33 7.5
gi|6634129|emb|CAB64389.1| TKR protein [Drosophila melanogaster] 33 7.5
gi|3834583|gb|AAC72826.1| M protein [Streptococcus pyogenes] 33 7.5
gi|21687020|ref|NP_660288.1| similar to ecotropic viral integrat... 33 7.5
gi|40789293|ref|NP_776123.2| centromere protein E; kinesin 10; k... 33 7.5
gi|31240045|ref|XP_320436.1| ENSANGP00000009214 [Anopheles gambi... 33 7.5
gi|47230645|emb|CAF99838.1| unnamed protein product [Tetraodon n... 33 7.5
gi|42734064|gb|AAS38936.1| similar to Plasmodium falciparum (iso... 33 7.5
gi|24643413|ref|NP_608361.2| CG15618-PA [Drosophila melanogaster... 33 9.9
gi|24375387|ref|NP_719430.1| DNA topoisomerase IV, B subunit [Sh... 33 9.9
gi|45200747|ref|NP_986317.1| AGL350Cp [Eremothecium gossypii] >g... 33 9.9
gi|38109131|gb|EAA55045.1| hypothetical protein MG06702.4 [Magna... 33 9.9
gi|7486768|pir||T08588 hypothetical protein L23H3.30 - Arabidops... 33 9.9
gi|47124909|gb|AAH70689.1| LOC431838 protein [Xenopus laevis] 33 9.9
gi|17535687|ref|NP_495858.1| ROLler: helically twisted, animals ... 33 9.9
gi|39594827|emb|CAE70695.1| Hypothetical protein CBG17418 [Caeno... 33 9.9
gi|586122|sp|P22793|TRHY_SHEEP Trichohyalin >gnl|BL_ORD_ID|21738... 33 9.9
gi|23484285|gb|EAA19671.1| Ran-binding protein [Plasmodium yoeli... 33 9.9
gi|39597391|emb|CAE59620.1| Hypothetical protein CBG03029 [Caeno... 33 9.9
gi|6678163|ref|NP_033314.1| serine/threonine kinase 10 [Mus musc... 33 9.9
gi|39588210|emb|CAE68135.1| Hypothetical protein CBG13781 [Caeno... 33 9.9
gi|17543328|ref|NP_502808.1| COLlagen structural gene (col-134) ... 33 9.9
gi|18418034|ref|NP_567896.1| WD-40 repeat family protein (LEUNIG... 33 9.9
gi|39596546|emb|CAE63165.1| Hypothetical protein CBG07483 [Caeno... 33 9.9
gi|11141605|gb|AAG32022.1| LEUNIG [Arabidopsis thaliana] 33 9.9
gi|1245105|gb|AAC52934.1| glutamine repeat protein-1 33 9.9
gi|28828532|gb|AAO51140.1| similar to Homo sapiens (Human). FLJ0... 33 9.9
gi|50424261|ref|XP_460717.1| unnamed protein product [Debaryomyc... 33 9.9
gi|31201295|ref|XP_309595.1| ENSANGP00000010937 [Anopheles gambi... 33 9.9
gi|42601246|gb|AAS21320.1| major royal jelly protein MRJP5 precu... 33 9.9
gi|4502781|ref|NP_001804.1| centromere protein E; Centromere aut... 33 9.9
gi|382658|prf||1819485A CENP-E protein 33 9.9
gi|50419303|ref|XP_458176.1| unnamed protein product [Debaryomyc... 33 9.9
gi|23489064|gb|EAA21475.1| hypothetical protein [Plasmodium yoel... 33 9.9
>gi|17567621|ref|NP_509162.1| COLlagen structural gene (col-173)
[Caenorhabditis elegans]
gi|7446026|pir||T16324 hypothetical protein F41C6.5 -
Caenorhabditis elegans
gi|1049474|gb|AAA80446.1| Collagen protein 173 [Caenorhabditis
elegans]
Length = 325
Score = 271 bits (692), Expect = 2e-71
Identities = 147/208 (70%), Positives = 147/208 (70%)
Frame = -1
Query: 978 MELDPKXXXXXXXXXXXXXRMAVIGVALSIGAAIVCVMTVPFVYNYVQRVETVLQNEADF 799
MELDPK RMAVIGVALSIGAAIVCVMTVPFVYNYVQRVETVLQNEADF
Sbjct: 1 MELDPKEEAALRAEAERLRRMAVIGVALSIGAAIVCVMTVPFVYNYVQRVETVLQNEADF 60
Query: 798 CRAKRDSVLKELTRTQKRAGLRLKREXXXXXXXXXXXXXXSVPVMHYKSPEVTEHKEERI 619
CRAKRDSVLKELTRTQKRAGLRLKRE SVPVMHYKSPEVTEHKEERI
Sbjct: 61 CRAKRDSVLKELTRTQKRAGLRLKREDTYSGYSASYGTYDSVPVMHYKSPEVTEHKEERI 120
Query: 618 EKKDDFQQXXXXXXXXXXXXXXXGQDGHDGVDGRPGSDGNPGADMHLDDTYNMADQFCFE 439
EKKDDFQQ GQDGHDGVDGRPGSDGNPGADMHLDDTYNMADQFCFE
Sbjct: 121 EKKDDFQQCCGCGFGSPGEPGSPGQDGHDGVDGRPGSDGNPGADMHLDDTYNMADQFCFE 180
Query: 438 CLXXXXXXXXXXXXXXXXXXXGNQGEDA 355
CL GNQGEDA
Sbjct: 181 CLPAPTGPPGPPGLKGMPGIPGNQGEDA 208
Score = 37.7 bits (86), Expect = 0.40
Identities = 13/13 (100%), Positives = 13/13 (100%)
Frame = -1
Query: 42 CNHCPNPRTAPGY 4
CNHCPNPRTAPGY
Sbjct: 313 CNHCPNPRTAPGY 325