Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= F42G8_7
         (831 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17540418|ref|NP_501361.1| iron Sulfur Protein (29.7 kD) (isp-...   536   e-151
gi|39587482|emb|CAE58420.1| Hypothetical protein CBG01551 [Caeno...   510   e-143
gi|31238012|ref|XP_319708.1| ENSANGP00000019464 [Anopheles gambi...   248   9e-65
gi|24580896|ref|NP_722715.1| CG7361-PB [Drosophila melanogaster]...   243   3e-63
gi|47225798|emb|CAF98278.1| unnamed protein product [Tetraodon n...   241   2e-62
gi|47155579|ref|NP_998251.1| ubiquinol-cytochrome c reductase, R...   239   7e-62
gi|13385168|ref|NP_079986.1| ubiquinol-cytochrome c reductase, R...   236   6e-61
gi|39939370|gb|AAR32732.1| ubiquinol-cytochrome c oxidoreductase...   236   6e-61
gi|27371203|gb|AAH41528.1| Uqcrfs1-prov protein [Xenopus laevis]      234   2e-60
gi|48096291|ref|XP_394657.1| similar to Ubiquinol-cytochrome c r...   234   2e-60
gi|39939366|gb|AAR32731.1| ubiquinol-cytochrome c oxidoreductase...   234   2e-60
gi|34875396|ref|XP_214457.2| similar to RIKEN cDNA 4430402G14 [R...   233   4e-60
gi|136708|sp|P20788|UCRI_RAT Ubiquinol-cytochrome c reductase ir...   233   4e-60
gi|39939338|gb|AAR32723.1| ubiquinol-cytochrome c oxidoreductase...   233   5e-60
gi|39939362|gb|AAR32730.1| ubiquinol-cytochrome c oxidoreductase...   232   9e-60
gi|39939334|gb|AAR32721.1| ubiquinol-cytochrome c oxidoreductase...   232   9e-60
gi|27807365|ref|NP_777238.1| ubiquinol-cytochrome c reductase, R...   231   1e-59
gi|1351360|sp|P13272|UCRI_BOVIN Ubiquinol-cytochrome c reductase...   231   1e-59
gi|39939332|gb|AAR32720.1| ubiquinol-cytochrome c oxidoreductase...   231   1e-59
gi|39939328|gb|AAR32718.1| ubiquinol-cytochrome c oxidoreductase...   231   2e-59
gi|38674607|gb|AAR26321.1| Rieske iron sulfur protein/complex II...   231   2e-59
gi|39939336|gb|AAR32722.1| ubiquinol-cytochrome c oxidoreductase...   230   3e-59
gi|39939374|gb|AAR32733.1| ubiquinol-cytochrome c oxidoreductase...   229   4e-59
gi|39939330|gb|AAR32719.1| ubiquinol-cytochrome c oxidoreductase...   229   4e-59
gi|3891852|pdb|1QCR|E Chain E, Crystal Structure Of Bovine Mitoc...   229   6e-59
gi|39939342|gb|AAR32725.1| ubiquinol-cytochrome c oxidoreductase...   229   7e-59
gi|45360473|ref|NP_988911.1| hypothetical protein MGC76317 [Xeno...   228   9e-59
gi|39939346|gb|AAR32726.1| ubiquinol-cytochrome c oxidoreductase...   226   4e-58
gi|39939340|gb|AAR32724.1| Rieske iron sulfur protein [Otolemur ...   226   4e-58
gi|50753749|ref|XP_414117.1| PREDICTED: similar to ubiquinol-cyt...   226   5e-58
gi|5174743|ref|NP_005994.1| ubiquinol-cytochrome c reductase, Ri...   226   5e-58
gi|45768728|gb|AAH67832.1| Ubiquinol-cytochrome c reductase, Rie...   226   5e-58
gi|5042402|gb|AAD38242.1| UCRI_HUMAN; RIESKE IRON-SULFUR PROTEIN...   226   5e-58
gi|3659971|pdb|1BCC|E Chain E, Cytochrome Bc1 Complex From Chick...   226   6e-58
gi|39939382|gb|AAR32735.1| ubiquinol-cytochrome c oxidoreductase...   225   1e-57
gi|37811697|gb|AAR03847.1| rieske iron-sulfur protein [Tigriopus...   224   1e-57
gi|39939358|gb|AAR32729.1| ubiquinol-cytochrome c oxidoreductase...   224   2e-57
gi|6572219|emb|CAB63035.1| dJ370M22.2 (ubiquinol-cytochrome c re...   223   4e-57
gi|39939386|gb|AAR32736.1| ubiquinol-cytochrome c oxidoreductase...   223   5e-57
gi|37811695|gb|AAR03846.1| rieske iron-sulfur protein [Tigriopus...   223   5e-57
gi|37811693|gb|AAR03845.1| rieske iron-sulfur protein [Tigriopus...   222   9e-57
gi|39939378|gb|AAR32734.1| ubiquinol-cytochrome c oxidoreductase...   221   1e-56
gi|37811699|gb|AAR03848.1| rieske iron-sulfur protein [Tigriopus...   218   1e-55
gi|45709479|gb|AAH67544.1| Uqcrfs1 protein [Danio rerio]              208   1e-52
gi|29841428|gb|AAP06460.1| similar to GenBank Accession Number A...   201   2e-50
gi|1942961|pdb|1RIE|  Structure Of A Water Soluble Fragment Of T...   200   4e-50
gi|50543086|ref|XP_499709.1| hypothetical protein [Yarrowia lipo...   198   1e-49
gi|50289911|ref|XP_447387.1| unnamed protein product [Candida gl...   196   7e-49
gi|45190540|ref|NP_984794.1| AEL067Wp [Eremothecium gossypii] >g...   195   9e-49
gi|19112733|ref|NP_595941.1| ubiquinol-cytochrome c reductase ir...   195   1e-48
gi|38106045|gb|EAA52401.1| hypothetical protein MG05093.4 [Magna...   194   2e-48
gi|1397233|gb|AAC49359.1| Rieske iron-sulfur protein                  193   4e-48
gi|49074640|ref|XP_401440.1| hypothetical protein UM03825.1 [Ust...   193   4e-48
gi|50309919|ref|XP_454973.1| unnamed protein product [Kluyveromy...   193   4e-48
gi|6320811|ref|NP_010890.1| oxidizes ubiquinol at center P in th...   192   6e-48
gi|14277716|pdb|1EZV|E Chain E, Structure Of The Yeast Cytochrom...   189   8e-47
gi|50258176|gb|EAL20870.1| hypothetical protein CNBE2310 [Crypto...   189   8e-47
gi|32411961|ref|XP_326461.1| hypothetical protein [Neurospora cr...   188   1e-46
gi|50424569|ref|XP_460873.1| unnamed protein product [Debaryomyc...   188   1e-46
gi|46444970|gb|EAL04241.1| hypothetical protein CaO19.13314 [Can...   188   1e-46
gi|46121745|ref|XP_385427.1| hypothetical protein FG05251.1 [Gib...   187   2e-46
gi|49089474|ref|XP_406443.1| hypothetical protein AN2306.2 [Aspe...   184   2e-45
gi|6102770|emb|CAB59195.1| ubiquinol-cytochrome C reductase iron...   183   5e-45
gi|38347166|emb|CAE05156.2| OSJNBa0039C07.12 [Oryza sativa (japo...   177   3e-43
gi|1717957|sp|P49727|UCRI_MAIZE Ubiquinol-cytochrome c reductase...   175   1e-42
gi|7430477|pir||S71364 ubiquinol-cytochrome-c reductase (EC 1.10...   172   8e-42
gi|1717951|sp|P51133|UCR3_TOBAC Ubiquinol-cytochrome c reductase...   172   1e-41
gi|11248861|pir||T48590 ubiquinol-cytochrome-c reductase (EC 1.1...   172   1e-41
gi|18417067|ref|NP_568288.1| ubiquinol-cytochrome C reductase ir...   172   1e-41
gi|21553507|gb|AAM62600.1| ubiquinol--cytochrome-c reductase-lik...   171   1e-41
gi|15240627|ref|NP_196848.1| ubiquinol-cytochrome C reductase ir...   171   1e-41
gi|21554278|gb|AAM63353.1| ubiquinol--cytochrome-c reductase-lik...   171   1e-41
gi|1717953|sp|P51135|UCR5_TOBAC Ubiquinol-cytochrome c reductase...   171   2e-41
gi|27525857|emb|CAC86460.2| ubiquinol-cytochrome c reductase [Ch...   171   2e-41
gi|49388912|dbj|BAD26134.1| putative ubiquinol-cytochrome c redu...   171   2e-41
gi|1717949|sp|P49729|UCR1_TOBAC Ubiquinol-cytochrome c reductase...   170   3e-41
gi|48763598|ref|ZP_00268152.1| COG0723: Rieske Fe-S protein [Rho...   170   3e-41
gi|136710|sp|P23136|UCRI_RHORU Ubiquinol-cytochrome c reductase ...   170   3e-41
gi|1717950|sp|P51132|UCR2_TOBAC Ubiquinol-cytochrome c reductase...   170   4e-41
gi|1717952|sp|P51134|UCR4_TOBAC Ubiquinol-cytochrome c reductase...   169   7e-41
gi|586145|sp|P37841|UCRI_SOLTU Ubiquinol-cytochrome c reductase ...   168   1e-40
gi|1076675|pir||S46534 ubiquinol-cytochrome-c reductase (EC 1.10...   168   1e-40
gi|48764999|ref|ZP_00269550.1| COG0723: Rieske Fe-S protein [Rho...   168   2e-40
gi|23016086|ref|ZP_00055846.1| COG0723: Rieske Fe-S protein [Mag...   162   1e-38
gi|16124727|ref|NP_419291.1| ubiquinol-cytochrome c reductase, i...   160   3e-38
gi|15892281|ref|NP_359995.1| cytochrome b6-f complex iron-sulfur...   160   3e-38
gi|42453499|ref|ZP_00153406.1| hypothetical protein Rick034901 [...   160   4e-38
gi|34580704|ref|ZP_00142184.1| cytochrome b6-f complex iron-sulf...   159   5e-38
gi|15604140|ref|NP_220655.1| CYTOCHROME B6-F COMPLEX IRON-SULFUR...   156   6e-37
gi|48830861|ref|ZP_00287961.1| COG0723: Rieske Fe-S protein [Mag...   154   2e-36
gi|27377596|ref|NP_769125.1| rieske iron-sulfur protein [Bradyrh...   152   9e-36
gi|46308640|ref|ZP_00210832.1| COG0723: Rieske Fe-S protein [Ehr...   152   1e-35
gi|136706|sp|P05417|UCRI_PARDE Ubiquinol-cytochrome c reductase ...   152   1e-35
gi|39934267|ref|NP_946543.1| cytochrome b6-F complex iron-sulfur...   150   4e-35
gi|6492247|gb|AAF14234.1| ubiquinol-cytochrome c reductase iron-...   148   1e-34
gi|6136100|sp|P81380|UCRI_RHOVI Ubiquinol-cytochrome c reductase...   147   2e-34
gi|23481393|gb|EAA17685.1| ubiquinol-cytochrome c reductase, iro...   146   5e-34
gi|17986756|ref|NP_539390.1| UBIQUINOL-CYTOCHROME C REDUCTASE IR...   146   5e-34
gi|15965572|ref|NP_385925.1| PROBABLE UBIQUINOL-CYTOCHROME C RED...   146   5e-34
gi|23509595|ref|NP_702262.1| ubiquinol cytochrome c oxidoreducta...   145   8e-34
gi|42520998|ref|NP_966913.1| ubiquinol-cytochrome c reductase, i...   145   1e-33
gi|17936122|ref|NP_532912.1| ubiquinol-cytochrome C reductase ir...   145   1e-33
gi|15889515|ref|NP_355196.1| AGR_C_4074p [Agrobacterium tumefaci...   145   1e-33
gi|23502411|ref|NP_698538.1| ubiquinol-cytochrome c reductase, i...   143   5e-33
gi|22596702|gb|AAN03339.1| FbcF [Rhizobium leguminosarum bv. vic...   141   2e-32
gi|45915847|ref|ZP_00194612.2| COG0723: Rieske Fe-S protein [Mes...   138   2e-31
gi|48850811|ref|ZP_00305053.1| COG0723: Rieske Fe-S protein [Nov...   137   2e-31
gi|2133378|pir||S63700 probable ubiquinol-cytochrome-c reductase...   137   3e-31
gi|136709|sp|P08500|UCRI_RHOCA Ubiquinol-cytochrome c reductase ...   137   4e-31
gi|581491|emb|CAA27194.1| unnamed protein product [Rhodobacter s...   135   8e-31
gi|13472419|ref|NP_103986.1| ubiquinol-cytochrome c reductase ir...   135   8e-31
gi|464995|sp|Q02762|UCRI_RHOSH Ubiquinol-cytochrome c reductase ...   130   3e-29
gi|39934091|ref|NP_946367.1| ubiquinol-cytochrome-c reductase, R...   127   3e-28
gi|46193009|ref|ZP_00207523.1| COG0723: Rieske Fe-S protein [Rho...   125   1e-27
gi|17864350|ref|NP_524748.1| CG7361-PA [Drosophila melanogaster]...   124   3e-27
gi|38048323|gb|AAR10064.1| similar to Drosophila melanogaster CG...   123   4e-27
gi|33636485|gb|AAQ23540.1| RH01528p [Drosophila melanogaster]         122   1e-26
gi|13471087|ref|NP_102656.1| ubiquinol-cytochrome c reductase ir...   120   4e-26
gi|15599627|ref|NP_253121.1| probable iron-sulfur protein [Pseud...   112   1e-23
gi|46164884|ref|ZP_00205218.1| COG0723: Rieske Fe-S protein [Pse...   109   8e-23
gi|15677875|ref|NP_275043.1| ubiquinol--cytochrome c reductase, ...   108   2e-22
gi|26988052|ref|NP_743477.1| ubiquinol--cytochrome c reductase, ...   105   9e-22
gi|24372199|ref|NP_716241.1| ubiquinol-cytochrome c reductase, i...   103   6e-21
gi|48863782|ref|ZP_00317675.1| COG0723: Rieske Fe-S protein [Mic...   101   2e-20
gi|27364058|ref|NP_759586.1| Ubiquinol-cytochrome c reductase, i...   100   4e-20
gi|46914764|emb|CAG21541.1| putative ubiquinol-cytochrome c redu...    99   9e-20
gi|47211755|emb|CAG06236.1| unnamed protein product [Tetraodon n...    98   2e-19
gi|28897215|ref|NP_796820.1| ubiquinol-cytochrome c reductase, i...    97   3e-19
gi|23103624|ref|ZP_00090102.1| COG0723: Rieske Fe-S protein [Azo...    97   4e-19
gi|33591513|ref|NP_879157.1| ubiquinol-cytochrome C reductase ir...    96   7e-19
gi|15640595|ref|NP_230224.1| ubiquinol--cytochrome c reductase, ...    96   7e-19
gi|28199648|ref|NP_779962.1| ubiquinol cytochrome C oxidoreducta...    96   1e-18
gi|15837510|ref|NP_298198.1| ubiquinol cytochrome C oxidoreducta...    96   1e-18
gi|22994860|ref|ZP_00039348.1| COG0723: Rieske Fe-S protein [Xyl...    96   1e-18
gi|14165194|gb|AAK55421.1| Rieske protein [Rubrivivax gelatinosus]     95   2e-18
gi|41689438|ref|ZP_00145971.1| COG0723: Rieske Fe-S protein [Psy...    95   2e-18
gi|48730149|ref|ZP_00263897.1| COG0723: Rieske Fe-S protein [Pse...    95   2e-18
gi|34499463|ref|NP_903678.1| ubiquinol-cytochrome c reductase [C...    94   4e-18
gi|17547648|ref|NP_521050.1| PUTATIVE TRANSMEMBRANE UBIQUINOL-CY...    94   5e-18
gi|21231761|ref|NP_637678.1| ubiquinol cytochrome C oxidoreducta...    93   6e-18
gi|48781642|ref|ZP_00278233.1| COG0723: Rieske Fe-S protein [Bur...    93   8e-18
gi|21243190|ref|NP_642772.1| ubiquinol cytochrome C oxidoreducta...    92   1e-17
gi|30248813|ref|NP_840883.1| Rieske iron-sulfur protein 2Fe-2S s...    90   5e-17
gi|3929386|sp|O31214|UCRI_CHRVI Ubiquinol-cytochrome c reductase...    89   9e-17
gi|47573363|ref|ZP_00243402.1| COG0723: Rieske Fe-S protein [Rub...    89   2e-16
gi|46321350|ref|ZP_00221728.1| COG0723: Rieske Fe-S protein [Bur...    87   3e-16
gi|48767762|ref|ZP_00272115.1| COG0723: Rieske Fe-S protein [Ral...    86   8e-16
gi|15792510|ref|NP_282333.1| putative ubiquinol-cytochrome C red...    83   6e-15
gi|34558431|ref|NP_908246.1| PUTATIVE UBIQUINOL-CYTOCHROME C RED...    83   6e-15
gi|46311864|ref|ZP_00212466.1| COG0723: Rieske Fe-S protein [Bur...    80   5e-14
gi|47575558|ref|ZP_00245593.1| COG0723: Rieske Fe-S protein [Rub...    77   4e-13
gi|15612524|ref|NP_224177.1| Ubiquinol cytochrome c oxidoreducta...    76   8e-13
gi|15808115|emb|CAC88362.1| Rieske protein [Acidithiobacillus fe...    76   8e-13
gi|15646147|ref|NP_208331.1| ubiquinol cytochrome c oxidoreducta...    76   1e-12
gi|14251203|gb|AAF76298.2| putative ubiquinol-cytochrome c reduc...    72   1e-11
gi|15028607|emb|CAC44962.1| putative Rieske protein [Acidithioba...    70   6e-11
gi|32266506|ref|NP_860538.1| ubiquinol cytochrome C oxidoreducta...    67   4e-10
gi|15605645|ref|NP_213020.1| Rieske-I iron sulfur protein [Aquif...    64   5e-09
gi|42658172|ref|XP_116623.4| similar to Ubiquinol-cytochrome C r...    62   2e-08
gi|33239912|ref|NP_874854.1| Cytochrome b6/f complex subunit [Pr...    61   3e-08
gi|746438|gb|AAA85857.1| bifunctional glyoxylate cycle protein         61   3e-08
gi|47117391|sp|P83794|UCRI_MASLA Cytochrome B6-F complex iron-su...    60   6e-08
gi|46129755|ref|ZP_00164336.2| COG0723: Rieske Fe-S protein [Syn...    60   8e-08
gi|33861019|ref|NP_892580.1| Rieske iron-sulfur protein [Prochlo...    60   8e-08
gi|13398509|gb|AAK21907.1| cytochrome b6f complex Rieske FeS pro...    59   1e-07
gi|33866373|ref|NP_897932.1| Cytochrome b6/f complex subunit (Ri...    59   1e-07
gi|1695185|emb|CAA70823.1| Rieske iron-sulfur protein [Phormidiu...    59   2e-07
gi|2914267|pdb|1RFS|  Rieske Soluble Fragment From Spinach             57   4e-07
gi|48893044|ref|ZP_00326337.1| COG0723: Rieske Fe-S protein [Tri...    57   4e-07
gi|401249|sp|Q02585|UCRB_TOBAC Cytochrome B6-F complex iron-sulf...    57   4e-07
gi|401247|sp|P30361|UCRA_TOBAC Cytochrome B6-F complex iron-sulf...    57   4e-07
gi|19999|emb|CAA45705.1| Rieske Fe/S protein of cytochrome b6/f ...    57   4e-07
gi|136712|sp|P08980|UCRI_SPIOL Cytochrome B6-F complex iron-sulf...    57   4e-07
gi|17229945|ref|NP_486493.1| plastoquinol--plastocyanin reductas...    57   5e-07
gi|23130143|ref|ZP_00111962.1| COG0723: Rieske Fe-S protein [Nos...    57   5e-07
gi|6911901|emb|CAB72244.1| Rieske FeS-protein [Anabaena variabilis]    56   8e-07
gi|45507863|ref|ZP_00160205.1| COG0723: Rieske Fe-S protein [Ana...    56   8e-07
gi|16330220|ref|NP_440948.1| plastoquinol--plastocyanin reductas...    56   8e-07
gi|1717958|sp|P26290|UCRI_SYNY3 Cytochrome B6-F complex iron-sul...    56   8e-07
gi|22298502|ref|NP_681749.1| cytochrome b6-f complex iron-sulfur...    56   1e-06
gi|48846081|ref|ZP_00300348.1| COG0723: Rieske Fe-S protein [Geo...    56   1e-06
gi|4586598|dbj|BAA76431.1| plastoquinol-plastocyanin reductase [...    55   1e-06
gi|136705|sp|P14698|UCRI_NOSSP Cytochrome B6-F complex iron-sulf...    55   1e-06
gi|30679426|ref|NP_849295.1| cytochrome B6-F complex iron-sulfur...    55   1e-06
gi|9843639|emb|CAC03598.1| Rieske FeS protein [Arabidopsis thali...    55   1e-06
gi|15236275|ref|NP_192237.1| cytochrome B6-F complex iron-sulfur...    55   1e-06
gi|7430481|pir||T05929 probable plastoquinol-plastocyanin reduct...    55   2e-06
gi|32394644|gb|AAM88439.1| putative Rieske Fe-S precursor protei...    55   2e-06
gi|3885886|gb|AAC78103.1| Rieske Fe-S precursor protein [Oryza s...    55   2e-06
gi|33863589|ref|NP_895149.1| Rieske iron-sulfur protein [Prochlo...    55   2e-06
gi|22996962|ref|ZP_00041203.1| COG0723: Rieske Fe-S protein [Xyl...    55   2e-06
gi|136713|sp|P26292|UCRI_SYNP2 Cytochrome B6-F complex iron-sulf...    55   2e-06
gi|1717956|sp|P49728|UCRI_CHLRE Cytochrome B6-F complex iron-sul...    54   3e-06
gi|11135341|sp|Q9SBN3|UCRI_VOLCA Cytochrome B6-F complex iron-su...    54   3e-06
gi|37222949|gb|AAQ90151.1| putative Rieske Fe-S protein precurso...    54   3e-06
gi|40889430|pdb|1Q90|C Chain C, Structure Of The Cytochrome B6f ...    54   3e-06
gi|2500506|sp|Q46136|UCRI_CHLLT Cytochrome B6-F complex iron-sul...    54   4e-06
gi|136707|sp|P26291|UCRI_PEA Cytochrome B6-F complex iron-sulfur...    54   5e-06
gi|37522607|ref|NP_925984.1| plastoquinol--plastocyanin reductas...    52   2e-05
gi|2921504|gb|AAC04807.1| cytochrome B6-F complex iron-sulfur su...    52   2e-05
gi|16332293|ref|NP_443021.1| cytochrome b6/f-complex iron-sulfur...    51   3e-05
gi|48845012|ref|ZP_00299303.1| COG0723: Rieske Fe-S protein [Geo...    50   5e-05
gi|48894263|ref|ZP_00327372.1| COG0723: Rieske Fe-S protein [Tri...    50   5e-05
gi|14250868|emb|CAC39244.1| putative Rieske-FeS protein [Anabaen...    50   5e-05
gi|45509789|ref|ZP_00162122.1| COG0723: Rieske Fe-S protein [Ana...    50   5e-05
gi|551957|gb|AAA26151.1| Rieske Fe-S protein cytochrome b (gtg s...    50   6e-05
gi|32307530|gb|AAP79170.1| Fe-S subunit of cytochrome c6f comple...    50   8e-05
gi|21673141|ref|NP_661206.1| cytochrome b6-f complex, iron-sulfu...    50   8e-05
gi|17232003|ref|NP_488551.1| cytochrome b6/f-complex iron-sulfur...    49   1e-04
gi|10039629|gb|AAG12194.1| cytochrome b6f complex Rieske iron-su...    49   1e-04
gi|551956|gb|AAA26150.1| Rieske Fe-S protein cytochrome b (gtg s...    49   1e-04
gi|21673162|ref|NP_661227.1| gamma-carotene desaturase [Chlorobi...    49   2e-04
gi|49659776|gb|AAT68200.1| putative Rieske Fe-S precursor protei...    49   2e-04
gi|17229005|ref|NP_485553.1| cytochrome b6/f-complex iron-sulfur...    48   2e-04
gi|23124073|ref|ZP_00106087.1| COG0723: Rieske Fe-S protein [Nos...    48   2e-04
gi|37521492|ref|NP_924869.1| probable phytoene dehydrogenase, Ri...    47   4e-04
gi|48847261|ref|ZP_00301518.1| COG0723: Rieske Fe-S protein [Geo...    47   5e-04
gi|39996750|ref|NP_952701.1| cytochrome b/b6 complex, iron-sulfu...    47   5e-04
gi|23125490|ref|ZP_00107421.1| COG0723: Rieske Fe-S protein [Nos...    47   7e-04
gi|21399438|ref|NP_655423.1| Rieske, Rieske [2Fe-2S] domain [Bac...    46   9e-04
gi|39998024|ref|NP_953975.1| cytochrome b/b6 complex, iron-sulfu...    46   9e-04
gi|47565984|ref|ZP_00237022.1| cytochrome b6-f complex, iron-sul...    46   9e-04
gi|30261617|ref|NP_843994.1| menaquinol-cytochrome c reductase, ...    46   9e-04
gi|16330526|ref|NP_441254.1| unknown protein [Synechocystis sp. ...    45   0.001
gi|30019670|ref|NP_831301.1| Menaquinol-cytochrome c reductase i...    45   0.001
gi|6440852|dbj|BAA78591.1| hypothetical protein [Chlamydomonas s...    45   0.001
gi|5354181|gb|AAD42391.1| Rieske iron-sulfur protein [Mycobacter...    45   0.002
gi|17230277|ref|NP_486825.1| probable phytoene dehydrogenase Rie...    45   0.003
gi|21224382|ref|NP_630161.1| putative iron-sulfur binding oxidor...    45   0.003
gi|48857618|ref|ZP_00311609.1| COG0665: Glycine/D-amino acid oxi...    45   0.003
gi|45509403|ref|ZP_00161737.1| COG0723: Rieske Fe-S protein [Ana...    45   0.003
gi|33867150|ref|NP_898708.1| putative Rieske-protein [Rhodococcu...    45   0.003
gi|29832831|ref|NP_827465.1| putative iron sulfur binding protei...    44   0.003
gi|23113262|ref|ZP_00098654.1| COG0723: Rieske Fe-S protein [Des...    44   0.006
gi|46113910|ref|ZP_00184006.2| COG0665: Glycine/D-amino acid oxi...    43   0.007
gi|14250871|emb|CAC39246.1| short putative Rieske-FeS protein [A...    43   0.010
gi|16330855|ref|NP_441583.1| cytochrome b6/f complex iron-sulfur...    43   0.010
gi|45510217|ref|ZP_00162549.1| COG0723: Rieske Fe-S protein [Ana...    42   0.013
gi|17228102|ref|NP_484650.1| cytochrome b6/f-complex iron-sulfur...    42   0.013
gi|23099231|ref|NP_692697.1| menaquinol-cytochrome-c reductase i...    42   0.016
gi|29828477|ref|NP_823111.1| putative iron-sulfur binding oxidor...    41   0.028
gi|30018607|ref|NP_830238.1| Oxidoreductase [Bacillus cereus ATC...    41   0.028
gi|21398313|ref|NP_654298.1| Rieske, Rieske [2Fe-2S] domain [Bac...    41   0.036
gi|30260533|ref|NP_842910.1| Rieske 2Fe-2S iron-sulfur protein, ...    41   0.036
gi|49477982|ref|YP_034683.1| probable oxidoreductase, with Riesk...    41   0.036
gi|47569423|ref|ZP_00240105.1| oxidoreductase [Bacillus cereus G...    41   0.036
gi|42779545|ref|NP_976792.1| Rieske 2Fe-2S iron-sulfur protein, ...    41   0.036
gi|46362827|ref|ZP_00225659.1| COG0723: Rieske Fe-S protein [Kin...    41   0.036
gi|46199870|ref|YP_005537.1| rieske iron-sulfur protein [Thermus...    40   0.048
gi|29833059|ref|NP_827693.1| putative iron sulphur protein [Stre...    40   0.048
gi|33357531|pdb|1NYK|A Chain A, Crystal Structure Of The Rieske ...    40   0.062
gi|25029443|ref|NP_739497.1| conserved hypothetical protein [Cor...    40   0.062
gi|2695699|gb|AAB91482.1| Rieske iron-sulfur protein [Thermus th...    40   0.062
gi|7522095|pir||T31446 plastoquinol-plastocyanin reductase (EC 1...    40   0.062
gi|23099184|ref|NP_692650.1| Rieske [2Fe-2S] iron-sulfur protein...    40   0.062
gi|15616433|ref|NP_244738.1| Rieske [2Fe-2S] iron-sulfur protein...    40   0.062
gi|22972155|ref|ZP_00019051.1| hypothetical protein [Chloroflexu...    40   0.062
gi|18312574|ref|NP_559241.1| Rieske iron sulfur protein (parR) [...    40   0.081
gi|28188808|dbj|BAC56136.1| Rieske iron-sulfur protein [Pyrobacu...    40   0.081
gi|16078103|ref|NP_388920.1| yhfW [Bacillus subtilis subsp. subt...    40   0.081
gi|50842295|ref|YP_055522.1| Rieske iron-sulfur protein [Propion...    39   0.11
gi|45684272|ref|ZP_00195703.1| COG0665: Glycine/D-amino acid oxi...    39   0.11
gi|27381332|ref|NP_772861.1| Rieske iron-sulfur protein [Bradyrh...    39   0.14
gi|46106706|ref|ZP_00187721.2| COG0723: Rieske Fe-S protein [Rub...    39   0.18
gi|21220255|ref|NP_626034.1| putative iron-sulphur protein (puta...    39   0.18
gi|1361934|pir||S56156 Rieske iron-sulfur protein soxF - Sulfolo...    39   0.18
gi|22218863|pdb|1JM1|A Chain A, Crystal Structure Of The Soluble...    39   0.18
gi|21227758|ref|NP_633680.1| oxidoreductase [Methanosarcina maze...    38   0.31
gi|42523704|ref|NP_969084.1| oxidoreductase [Bdellovibrio bacter...    37   0.40
gi|41410316|ref|NP_963152.1| hypothetical protein MAP4218 [Mycob...    37   0.40
gi|13541203|ref|NP_110891.1| Rieske Fe-S protein [Thermoplasma v...    37   0.40
gi|15966356|ref|NP_386709.1| PUTATIVE OXIDOREDUCTASE PROTEIN [Si...    37   0.53
gi|46317122|ref|ZP_00217700.1| COG1473: Metal-dependent amidase/...    37   0.53
gi|29833547|ref|NP_828181.1| putative iron-sulphur protein [Stre...    37   0.53
gi|7715538|gb|AAF68085.1| Rieske type iron sulfur protein [Helio...    37   0.69
gi|46106766|ref|ZP_00200151.1| COG0723: Rieske Fe-S protein [Rub...    37   0.69
gi|23121433|ref|ZP_00103731.1| COG0665: Glycine/D-amino acid oxi...    36   0.90
gi|31793374|ref|NP_855867.1| Probable Rieske iron-sulfur protein...    36   0.90
gi|46107015|ref|ZP_00200280.1| COG2146: Ferredoxin subunits of n...    36   0.90
gi|27380315|ref|NP_771844.1| oxidoreductase [Bradyrhizobium japo...    36   0.90
gi|48478205|ref|YP_023911.1| Rieske iron-sulfur protein [Picroph...    36   1.2
gi|15895855|ref|NP_349204.1| Rieske FeS-domain containing oxidor...    36   1.2
gi|48857972|ref|ZP_00311944.1| COG2208: Serine phosphatase RsbU,...    35   1.5
gi|2500507|sp|Q45657|QCRA_BACTC Menaquinol-cytochrome c reductas...    35   2.0
gi|15609332|ref|NP_216711.1| qcrA [Mycobacterium tuberculosis H3...    35   2.0
gi|13541197|ref|NP_110885.1| Rieske Fe-S protein [Thermoplasma v...    35   2.6
gi|14324585|dbj|BAB59512.1| Rieske iron sulfur protein [Thermopl...    35   2.6
gi|16082599|ref|NP_394685.1| Rieske Fe-S protein [Thermoplasma a...    35   2.6
gi|10640539|emb|CAC12353.1| probable Rieske iron-sulfur protein ...    35   2.6
gi|32476438|ref|NP_869432.1| probable dioxygenase Rieske iron-su...    35   2.6
gi|46106677|ref|ZP_00187647.2| COG0723: Rieske Fe-S protein [Rub...    35   2.6
gi|21229775|ref|NP_635692.1| vanillate O-demethylase oxygenase s...    34   3.4
gi|21241085|ref|NP_640667.1| vanillate O-demethylase oxygenase s...    34   3.4
gi|28210170|ref|NP_781114.1| oxidoreductase [Clostridium tetani ...    34   3.4
gi|15920287|ref|NP_375956.1| 244aa long hypothetical Rieske iron...    34   3.4
gi|16082230|ref|NP_394679.1| Rieske iron-sulfur protein SoxF rel...    34   3.4
gi|16079313|ref|NP_390137.1| menaquinol:cytochrome c oxidoreduct...    34   3.4
gi|15598118|ref|NP_251612.1| probable hydrolase [Pseudomonas aer...    34   4.5
gi|13472722|ref|NP_104289.1| sarcosine oxidase alpha subunit [Me...    34   4.5
gi|45916370|ref|ZP_00197456.1| COG0723: Rieske Fe-S protein [Mes...    34   4.5
gi|25028639|ref|NP_738693.1| putative ubiquinol-cytochrome C red...    34   4.5
gi|46201013|ref|ZP_00056041.2| COG0411: ABC-type branched-chain ...    33   5.8
gi|48856645|ref|ZP_00310802.1| COG0665: Glycine/D-amino acid oxi...    33   5.8
gi|10336542|dbj|BAB13772.1| iron-sulfur protein [Corynebacterium...    33   5.8
gi|19553392|ref|NP_601394.1| Rieske Fe-S protein [Corynebacteriu...    33   5.8
gi|24379185|ref|NP_721140.1| putative peptidoglycan branched pep...    33   5.8
gi|38234200|ref|NP_939967.1| ubiquinol-cytochrome C reductase ir...    33   5.8
gi|11994948|dbj|BAB19985.1| Pf-TBRAIN [Ptychodera flava]               33   7.6
gi|21222494|ref|NP_628273.1| ATP-dependent helicase [Streptomyce...    33   7.6
gi|48783153|ref|ZP_00279615.1| COG4638: Phenylpropionate dioxyge...    33   7.6
gi|33865393|ref|NP_896952.1| cell death suppressor protein Lls1 ...    33   7.6
gi|15789793|ref|NP_279617.1| Vng0584h [Halobacterium sp. NRC-1] ...    33   7.6
gi|20089356|ref|NP_615431.1| conserved hypothetical protein [Met...    33   9.9
gi|21220440|ref|NP_626219.1| putative iron sulphur binding prote...    33   9.9
gi|16799970|ref|NP_470238.1| conserved hypothetical protein [Lis...    33   9.9
gi|2497266|sp|Q48806|DLPA_LEGPN Protein dlpA >gnl|BL_ORD_ID|1678...    33   9.9
gi|49236667|ref|ZP_00330725.1| COG0473: Isocitrate/isopropylmala...    33   9.9


>gi|17540418|ref|NP_501361.1| iron Sulfur Protein (29.7 kD) (isp-1)
           [Caenorhabditis elegans]
 gi|7503274|pir||T32640 ubiquinol-cytochrome-c reductase (EC
           1.10.2.2) Rieske iron-sulfur protein [similarity] -
           Caenorhabditis elegans
 gi|2702451|gb|AAB92071.1| Iron-sulfur protein protein 1
           [Caenorhabditis elegans]
          Length = 276

 Score =  536 bits (1382), Expect = e-151
 Identities = 266/276 (96%), Positives = 266/276 (96%)
 Frame = -1

Query: 831 MASLARSGGFAVKVISGSQQHVNFVXXXXXXXXXXAFRDVPAEFSTAEARQAAVSHSTGG 652
           MASLARSGGFAVKVISGSQQHVNFV          AFRDVPAEFSTAEARQAAVSHSTGG
Sbjct: 1   MASLARSGGFAVKVISGSQQHVNFVAATPAADNVAAFRDVPAEFSTAEARQAAVSHSTGG 60

Query: 651 VFTNGLAVKGINVTSRRLAHTDVTFPDMSNYRRDSTKNTQVPARDTEDQRRALPTALYYG 472
           VFTNGLAVKGINVTSRRLAHTDVTFPDMSNYRRDSTKNTQVPARDTEDQRRALPTALYYG
Sbjct: 61  VFTNGLAVKGINVTSRRLAHTDVTFPDMSNYRRDSTKNTQVPARDTEDQRRALPTALYYG 120

Query: 471 AGGVLSLWAGKEVVQTLVSYKAMAADQRALASIEINMADIPEGKTKTFEWRGKPVFVKHR 292
           AGGVLSLWAGKEVVQTLVSYKAMAADQRALASIEINMADIPEGKTKTFEWRGKPVFVKHR
Sbjct: 121 AGGVLSLWAGKEVVQTLVSYKAMAADQRALASIEINMADIPEGKTKTFEWRGKPVFVKHR 180

Query: 291 TKAEIAKEKAVPVADLRHPQHDDERVQKDEWSVVIGVCTHLGCVPIADAGDYGGYYCPCH 112
           TKAEIAKEKAVPVADLRHPQHDDERVQKDEWSVVIGVCTHLGCVPIADAGDYGGYYCPCH
Sbjct: 181 TKAEIAKEKAVPVADLRHPQHDDERVQKDEWSVVIGVCTHLGCVPIADAGDYGGYYCPCH 240

Query: 111 GSHYDASGRIRKGPAPLNLHVPAYSFKDATIVIGSS 4
           GSHYDASGRIRKGPAPLNLHVPAYSFKDATIVIGSS
Sbjct: 241 GSHYDASGRIRKGPAPLNLHVPAYSFKDATIVIGSS 276




[DB home][top]