Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F42G9_4
(1362 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|1053155|gb|AAA80686.1| TAU-1a 615 e-175
gi|25151496|ref|NP_497253.2| protein with Tau-Like repeats, Micr... 615 e-175
gi|14589810|gb|AAK70646.1| Protein with tau-like repeats protein... 510 e-143
gi|1053157|gb|AAA80687.1| TAU-1b 510 e-143
gi|17554406|ref|NP_497254.1| protein with Tau-Like repeats, Micr... 506 e-142
gi|20901975|gb|AAM29696.1| Protein with tau-like repeats protein... 494 e-138
gi|39586124|emb|CAE69200.1| Hypothetical protein CBG15240 [Caeno... 453 e-126
gi|7503288|pir||T16349 hypothetical protein F42G9.9 - Caenorhabd... 342 e-103
gi|7503283|pir||T16348 hypothetical protein F42G9.3 - Caenorhabd... 174 4e-42
gi|14388361|dbj|BAB60738.1| hypothetical protein [Macaca fascicu... 135 3e-30
gi|31242219|ref|XP_321540.1| ENSANGP00000018159 [Anopheles gambi... 134 7e-30
gi|19571839|emb|CAD27473.1| putative microtubule binding protein... 132 2e-29
gi|21357661|ref|NP_651575.1| CG31057-PA [Drosophila melanogaster... 127 6e-28
gi|29747932|gb|AAH50893.1| Mtap4 protein [Mus musculus] 127 6e-28
gi|48106034|ref|XP_393045.1| similar to CG31057-PA [Apis mellifera] 120 8e-26
gi|6754638|ref|NP_005901.2| microtubule-associated protein tau i... 112 2e-23
gi|13431915|sp|Q9MYX8|TAU_PAPHA Microtubule-associated protein t... 112 2e-23
gi|8400711|ref|NP_058518.1| microtubule-associated protein tau i... 112 2e-23
gi|27806547|ref|NP_776531.1| microtubule associated protein tau ... 111 5e-23
gi|20530830|gb|AAK56390.1| tau-like protein-1 [Xenopus laevis] 111 5e-23
gi|13431907|sp|O02828|TAU_CAPHI Microtubule-associated protein t... 110 6e-23
gi|34873888|ref|XP_346410.1| hypothetical protein XP_346409 [Rat... 110 6e-23
gi|8393752|ref|NP_058908.1| microtubule-associated protein tau; ... 110 6e-23
gi|92486|pir||JS0306 microtubule-associated protein tau - rat 110 6e-23
gi|13431910|sp|P57786|TAU_MACMU Microtubule-associated protein t... 110 8e-23
gi|22138804|dbj|BAC07258.1| microtubule-associated protein 4 iso... 110 1e-22
gi|22138810|dbj|BAC07261.1| microtubule-associated protein 4 iso... 110 1e-22
gi|33286925|gb|AAH55364.1| Microtubule-associated protein 4 [Mus... 109 1e-22
gi|34866431|ref|XP_345985.1| similar to microtubule-associated p... 109 2e-22
gi|8400713|ref|NP_058519.1| microtubule-associated protein tau i... 108 2e-22
gi|28071271|dbj|BAC56093.1| microtubule-associated protein 4 iso... 108 2e-22
gi|547890|sp|P15146|MAP2_RAT Microtubule-associated protein 2 (M... 108 2e-22
gi|47217623|emb|CAG03020.1| unnamed protein product [Tetraodon n... 108 3e-22
gi|29387211|gb|AAH48200.1| MAP4 protein [Homo sapiens] 108 3e-22
gi|33243962|gb|AAH55332.1| Microtubule-associated protein 4 [Mus... 108 3e-22
gi|32880081|gb|AAP88871.1| microtubule-associated protein 4 [syn... 108 3e-22
gi|20455500|sp|P27816|MAP4_HUMAN Microtubule-associated protein ... 108 3e-22
gi|107082|pir||A33183 microtubule-associated protein 4 - human >... 108 3e-22
gi|47519639|ref|NP_002366.2| microtubule-associated protein 4 is... 108 3e-22
gi|14250528|gb|AAH08715.1| MAP4 protein [Homo sapiens] >gnl|BL_O... 108 3e-22
gi|47519675|ref|NP_112146.2| microtubule-associated protein 4 is... 108 3e-22
gi|525272|emb|CAA52283.1| MAP2d [Rattus norvegicus] 108 4e-22
gi|37528748|gb|AAQ92319.1| microtubule-associated protein tau [S... 108 4e-22
gi|516062|gb|AAA51601.1| tau protein [Bos taurus] 108 4e-22
gi|13432200|sp|P10637|TAU_MOUSE Microtubule-associated protein t... 107 7e-22
gi|284711|pir||A45301 microtubule-associated protein tau - mouse 107 7e-22
gi|606907|gb|AAA58343.1| microtubule-associated protein Tau isof... 107 7e-22
gi|433289|gb|AAB28526.1| high molecular weight tau, HMW [rats, d... 107 7e-22
gi|606911|gb|AAA58345.1| microtubule-associated protein Tau isof... 107 7e-22
gi|606909|gb|AAA58344.1| microtubule-associated protein Tau isof... 107 7e-22
gi|24416560|gb|AAH38857.1| MAP2 protein [Homo sapiens] 107 7e-22
gi|516063|gb|AAA51602.1| tau protein [Bos taurus] 107 9e-22
gi|516065|gb|AAA51604.1| tau protein [Bos taurus] 107 9e-22
gi|71560|pir||QRBOT2 microtubule-associated protein tau, form 3 ... 107 9e-22
gi|31982779|ref|NP_034968.2| microtubule-associated protein tau ... 105 2e-21
gi|13432197|sp|P19332|TAU_RAT Microtubule-associated protein tau... 105 3e-21
gi|285207|pir||A38235 microtubule-associated protein, 110K tau -... 105 3e-21
gi|14195622|ref|NP_114035.1| microtubule-associated protein 2 is... 105 3e-21
gi|38112343|gb|AAR11260.1| microtubule-associated protein tau [M... 105 3e-21
gi|14195620|ref|NP_114034.1| microtubule-associated protein 2 is... 105 3e-21
gi|7106363|ref|NP_032659.1| microtubule-associated protein 4 [Mu... 104 6e-21
gi|516066|gb|AAA51605.1| tau protein [Bos taurus] 103 1e-20
gi|26347017|dbj|BAC37157.1| unnamed protein product [Mus musculus] 103 1e-20
gi|47220989|emb|CAF98218.1| unnamed protein product [Tetraodon n... 102 2e-20
gi|1836033|gb|AAB46832.1| microtubule-associated protein 2c; MAP... 102 3e-20
gi|22138806|dbj|BAC07259.1| microtubule-associated protein 4 iso... 99 2e-19
gi|20530832|gb|AAK56391.1| tau-like protein-2 [Xenopus laevis] 99 2e-19
gi|14195630|ref|NP_112245.1| microtubule-associated protein 4 is... 98 4e-19
gi|539639|pir||A53253 microtubule-associated protein 4 - human (... 98 4e-19
gi|2119247|pir||I52650 microtubule-associated protein 2 4R isofo... 97 7e-19
gi|27806553|ref|NP_776530.1| microtubule-associated protein 4 [B... 94 6e-18
gi|27503563|gb|AAH42645.1| Mtap4 protein [Mus musculus] 94 1e-17
gi|28302189|gb|AAH46689.1| A730034c02-prov protein [Xenopus laevis] 91 5e-17
gi|786428|gb|AAB32526.1| MAP-2 [Bos taurus] 91 8e-17
gi|21732375|emb|CAD38562.1| hypothetical protein [Homo sapiens] 90 1e-16
gi|6678944|ref|NP_032658.1| microtubule-associated protein 2 [Mu... 89 3e-16
gi|57620|emb|CAA37535.1| microtubule-associated protein 2 [Rattu... 89 3e-16
gi|50750071|ref|XP_421857.1| PREDICTED: similar to microtubule-a... 89 3e-16
gi|28981317|gb|AAH48781.1| Similar to microtubule-associated pro... 89 3e-16
gi|56623|emb|CAA35667.1| unnamed protein product [Rattus norvegi... 89 3e-16
gi|30410862|gb|AAH51410.1| Similar to microtubule-associated pro... 89 3e-16
gi|2119248|pir||A55983 microtubule-associated protein MAP2 - bov... 89 3e-16
gi|111965|pir||A37981 microtubule-associated protein 2b - rat >g... 89 3e-16
gi|34876627|ref|XP_346854.1| hypothetical protein XP_346853 [Rat... 89 3e-16
gi|6981182|ref|NP_037198.1| microtubule-associated protein 2 [Ra... 87 7e-16
gi|14195618|ref|NP_114033.1| microtubule-associated protein 2 is... 87 7e-16
gi|14195624|ref|NP_002365.2| microtubule-associated protein 2 is... 87 7e-16
gi|7441345|pir||I67793 microtubule-associated protein 2, splice ... 87 1e-15
gi|2144819|pir||QRHUMT microtubule-associated protein 2, splice ... 87 1e-15
gi|547889|sp|P11137|MAP2_HUMAN Microtubule-associated protein 2 ... 86 2e-15
gi|50732105|ref|XP_418480.1| PREDICTED: similar to Microtubule-a... 86 3e-15
gi|388534|emb|CAA78121.1| tau-protein [Mus musculus] 85 4e-15
gi|8400715|ref|NP_058525.1| microtubule-associated protein tau i... 83 1e-14
gi|30584661|gb|AAP36583.1| Homo sapiens microtubule-associated p... 83 1e-14
gi|71558|pir||QRHUT2 microtubule-associated protein tau, fetal (... 83 1e-14
gi|409875|gb|AAA03354.1| microtubule-associated protein 2 83 2e-14
gi|516064|gb|AAA51603.1| tau protein [Bos taurus] 82 3e-14
gi|22138808|dbj|BAC07260.1| microtubule-associated protein 4 iso... 81 5e-14
gi|91089|pir||B28820 microtubule-associated protein tau type 2 -... 81 7e-14
gi|91088|pir||A28820 microtubule-associated protein tau type 1 -... 81 7e-14
gi|38112341|gb|AAR11259.1| microtubule-associated protein tau [P... 78 4e-13
gi|516067|gb|AAA51606.1| tau protein [Bos taurus] 78 4e-13
gi|42495386|gb|AAS17881.1| microtubule-associated protein tau [H... 78 6e-13
gi|47208996|emb|CAF91402.1| unnamed protein product [Tetraodon n... 74 8e-12
gi|1085573|pir||S51375 microtubule-associated protein MAP2 - rat... 73 2e-11
gi|765293|gb|AAB32560.1| HMW MAP2 [Rattus sp.] 73 2e-11
gi|18999526|gb|AAH24302.1| Unknown (protein for IMAGE:3349693) [... 70 9e-11
gi|47208083|emb|CAF92507.1| unnamed protein product [Tetraodon n... 70 1e-10
gi|7512171|pir||T14007 microtubule-associated protein 4 - Africa... 69 3e-10
gi|50760614|ref|XP_418084.1| PREDICTED: similar to microtubule-a... 60 9e-08
gi|1669674|emb|CAA60502.1| Microtubule-associated protein 4 [Gal... 56 2e-06
gi|7494900|pir||T18723 hypothetical protein B0379.7 - Caenorhabd... 47 8e-04
gi|25144938|ref|NP_740910.1| putative nuclear protein, with a co... 47 0.001
gi|28828505|gb|AAO51113.1| similar to Dictyostelium discoideum (... 47 0.001
gi|17510853|ref|NP_492690.1| predicted CDS, putative nuclear pro... 46 0.002
gi|16762342|ref|NP_457959.1| cell division protein [Salmonella e... 46 0.002
gi|29143830|ref|NP_807172.1| cell division protein [Salmonella e... 45 0.003
gi|17227751|ref|NP_484299.1| unknown protein [Nostoc sp. PCC 712... 45 0.004
gi|31212273|ref|XP_315121.1| ENSANGP00000015220 [Anopheles gambi... 45 0.004
gi|23501917|ref|NP_698044.1| hypothetical protein [Brucella suis... 45 0.004
gi|2865427|gb|AAC02666.1| polyprotein [Arabidopsis thaliana] 45 0.005
gi|2865424|gb|AAC02664.1| polyprotein [Arabidopsis thaliana] 45 0.005
gi|2865431|gb|AAC02669.1| polyprotein [Arabidopsis thaliana] 45 0.005
gi|32489754|emb|CAE03878.1| OSJNBb0015N08.6 [Oryza sativa (japon... 45 0.005
gi|282110|pir||C41859 IgA-specific metalloendopeptidase (EC 3.4.... 45 0.005
gi|1170517|sp|P45386|IGA4_HAEIN Immunoglobulin A1 protease precu... 45 0.005
gi|50748492|ref|XP_421271.1| PREDICTED: similar to FLJ00353 prot... 45 0.005
gi|37522975|ref|NP_926352.1| unknown protein [Gloeobacter violac... 45 0.005
gi|44917423|tpg|DAA02048.1| TPA: GRP21 [Arabidopsis thaliana] 45 0.005
gi|40888884|gb|AAR97288.1| DIF insensitive mutant A [Dictyosteli... 44 0.007
gi|28829317|gb|AAO51859.1| similar to Homo sapiens (Human). Muci... 44 0.007
gi|32307128|ref|NP_054790.2| nuclear receptor coactivator 6; nuc... 44 0.007
gi|28380068|sp|Q14686|NCO6_HUMAN Nuclear receptor coactivator 6 ... 44 0.007
gi|20521840|dbj|BAA11498.2| KIAA0181 [Homo sapiens] 44 0.007
gi|8218097|emb|CAB92721.1| dJ1181N3.2 (Thyroid hormone receptor ... 44 0.007
gi|6540580|gb|AAF16403.1| transcriptional coactivator AIB3 [Homo... 44 0.007
gi|23577891|ref|NP_703081.1| unknown [Rachiplusia ou multiple nu... 44 0.009
gi|39585373|emb|CAE61695.1| Hypothetical protein CBG05643 [Caeno... 44 0.009
gi|49088670|ref|XP_406132.1| hypothetical protein AN1995.2 [Aspe... 44 0.009
gi|10048483|ref|NP_064483.1| multidomain presynaptic cytomatrix ... 44 0.009
gi|7493836|gb|AAF07822.2| multidomain presynaptic cytomatrix pro... 44 0.009
gi|45510358|ref|ZP_00162690.1| hypothetical protein Avar020574 [... 43 0.015
gi|16767359|ref|NP_462974.1| essential cell division protein [Sa... 43 0.015
gi|38103443|gb|EAA50140.1| hypothetical protein MG03899.4 [Magna... 43 0.015
gi|17158265|ref|NP_477683.1| wsv161 [shrimp white spot syndrome ... 43 0.015
gi|45516529|ref|ZP_00168081.1| COG0810: Periplasmic protein TonB... 43 0.015
gi|50762630|ref|XP_422873.1| PREDICTED: similar to RIKEN cDNA A8... 43 0.015
gi|38105982|gb|EAA52344.1| hypothetical protein MG05036.4 [Magna... 43 0.020
gi|50423773|ref|XP_460471.1| unnamed protein product [Debaryomyc... 43 0.020
gi|15228481|ref|NP_189521.1| expressed protein [Arabidopsis thal... 43 0.020
gi|39584984|emb|CAE64408.1| Hypothetical protein CBG09100 [Caeno... 43 0.020
gi|15292463|gb|AAK93500.1| SD03094p [Drosophila melanogaster] 43 0.020
gi|47221630|emb|CAF97895.1| unnamed protein product [Tetraodon n... 43 0.020
gi|20128875|ref|NP_569927.1| CG14796-PA [Drosophila melanogaster... 43 0.020
gi|17987231|ref|NP_539865.1| Hypothetical Protein BMEI0948 [Bruc... 43 0.020
gi|38455896|gb|AAR20917.1| A12 protein [Pneumocystis carinii f. ... 43 0.020
gi|38073487|ref|XP_355243.1| similar to This gene is isolated by... 43 0.020
gi|25029366|ref|NP_739420.1| conserved hypothetical protein [Cor... 42 0.026
gi|42571215|ref|NP_973681.1| calmodulin-binding family protein [... 42 0.026
gi|25367167|pir||B84869 probable SF16 protein (Helianthus annuus... 42 0.026
gi|17506341|ref|NP_491200.1| son protein (89.7 kD) (1E257) [Caen... 42 0.026
gi|50258939|gb|EAL21620.1| hypothetical protein CNBC6560 [Crypto... 42 0.026
gi|2134574|pir||I51920 mucin - rhesus macaque (fragment) >gnl|BL... 42 0.026
gi|30689461|ref|NP_850399.1| calmodulin-binding family protein [... 42 0.026
gi|13506761|gb|AAK28322.1| tight junction protein ZO-1 [Hydra vu... 42 0.026
gi|409156|gb|AAA18837.1| ADG2 42 0.026
gi|23104851|ref|ZP_00091311.1| COG3087: Cell division protein [A... 42 0.026
gi|15229798|ref|NP_190627.1| proline-rich family protein [Arabid... 42 0.034
gi|5031925|ref|NP_005798.1| proteoglycan 4; megakaryocyte stimul... 42 0.034
gi|45549344|ref|NP_572487.3| CG11219-PA [Drosophila melanogaster... 42 0.034
gi|17827224|dbj|BAB79331.1| ORF4 [TT virus] 42 0.044
gi|6754038|ref|NP_034456.1| glycoprotein 1b, alpha polypeptide [... 42 0.044
gi|49094882|ref|XP_408902.1| hypothetical protein AN4765.2 [Aspe... 42 0.044
gi|46321597|ref|ZP_00221973.1| COG0457: FOG: TPR repeat [Burkhol... 42 0.044
gi|7507924|pir||T29695 hypothetical protein T18H9.1 - Caenorhabd... 42 0.044
gi|37515218|gb|AAA83334.3| Groundhog (hedgehog-like family) prot... 42 0.044
gi|9627834|ref|NP_054121.1| AcOrf-91 peptide [Autographa califor... 42 0.044
gi|37532210|ref|NP_920407.1| unknown protein [Oryza sativa (japo... 42 0.044
gi|25148379|ref|NP_505389.2| GRounDhog, hedgehog-like (grd-6) [C... 42 0.044
gi|50285809|ref|XP_445333.1| unnamed protein product [Candida gl... 42 0.044
gi|17530530|gb|AAL40834.1| BPLF1 [Human herpesvirus 4] 41 0.058
gi|39596931|emb|CAE59158.1| Hypothetical protein CBG02464 [Caeno... 41 0.058
gi|38344479|emb|CAE05494.2| OSJNBa0022H21.14 [Oryza sativa (japo... 41 0.058
gi|684940|gb|AAB54078.1| unknown 41 0.058
gi|9625599|ref|NP_039850.1| Tegument protein [Human herpesvirus ... 41 0.058
gi|1076802|pir||S49915 extensin-like protein - maize >gnl|BL_ORD... 41 0.058
gi|2081630|gb|AAB54079.1| unknown [Dictyostelium discoideum] 41 0.058
gi|37651399|ref|NP_932693.1| unknown [Choristoneura fumiferana d... 41 0.058
gi|2576286|emb|CAA75361.1| HepB protein [Cylindrotheca fusiformis] 41 0.058
gi|24664316|ref|NP_648722.2| CG9311-PA [Drosophila melanogaster]... 41 0.058
gi|18025476|gb|AAK95420.1| BPLF1 [cercopithicine herpesvirus 15] 41 0.058
gi|48858653|ref|ZP_00312602.1| COG2730: Endoglucanase [Clostridi... 41 0.058
gi|38234817|ref|NP_940584.1| Conserved hypothetical protein [Cor... 41 0.058
gi|49079892|ref|XP_403537.1| hypothetical protein UM05922.1 [Ust... 41 0.076
gi|38105202|gb|EAA51658.1| hypothetical protein MG03253.4 [Magna... 41 0.076
gi|29570780|ref|NP_055726.2| AP2 associated kinase 1; adaptor-as... 41 0.076
gi|50551659|ref|XP_503304.1| hypothetical protein [Yarrowia lipo... 41 0.076
gi|28856212|gb|AAH48067.1| Unknown (protein for IMAGE:3818911) [... 41 0.076
gi|6324379|ref|NP_014449.1| protein of unknown function; Bre5p [... 41 0.076
gi|47226278|emb|CAG09246.1| unnamed protein product [Tetraodon n... 41 0.076
gi|28830022|gb|AAO52512.1| similar to Streptococcus pneumoniae. ... 41 0.076
gi|46127271|ref|XP_388189.1| hypothetical protein FG08013.1 [Gib... 41 0.076
gi|40789031|dbj|BAA83000.2| KIAA1048 protein [Homo sapiens] 41 0.076
gi|32414841|ref|XP_327900.1| hypothetical protein [Neurospora cr... 40 0.099
gi|25056007|gb|AAD55980.2| extensin-like protein [Zea mays] 40 0.099
gi|33592511|ref|NP_880155.1| conserved hypothetical protein [Bor... 40 0.099
gi|17976864|emb|CAD19801.1| microtubule-associated protein EB1 [... 40 0.099
gi|48860364|ref|ZP_00314289.1| hypothetical protein Chte02000088... 40 0.099
gi|27573362|gb|AAO20080.1| unknown protein [Oryza sativa (japoni... 40 0.099
gi|48894823|ref|ZP_00327932.1| COG2340: Uncharacterized protein ... 40 0.099
gi|28829783|gb|AAO52285.1| similar to Leishmania major. Ppg3 [Di... 40 0.099
gi|99694|pir||S21961 proline-rich protein APG - Arabidopsis thal... 40 0.099
gi|9802525|gb|AAF99727.1| F17L21.7 [Arabidopsis thaliana] 40 0.099
gi|18266041|gb|AAL67433.1| anther-specific proline-rich protein ... 40 0.099
gi|21627826|emb|CAD37158.1| hypothetical protein [Aspergillus fu... 40 0.099
gi|28829697|gb|AAO52213.1| hypothetical protein [Dictyostelium d... 40 0.099
gi|7511753|pir||T28657 blackjack protein, microtubule associated... 40 0.099
gi|46133229|ref|ZP_00156849.2| COG3468: Type V secretory pathway... 40 0.099
gi|1718187|sp|Q07284|VGP3_EBVA8 Envelope glycoprotein GP340 (Mem... 40 0.099
gi|46107324|ref|XP_380721.1| hypothetical protein FG00545.1 [Gib... 40 0.099
gi|48890981|ref|ZP_00324572.1| COG3210: Large exoproteins involv... 40 0.099
gi|50756601|ref|XP_415235.1| PREDICTED: hypothetical protein XP_... 40 0.099
gi|32405570|ref|XP_323398.1| predicted protein [Neurospora crass... 40 0.099
gi|50760180|ref|XP_417923.1| PREDICTED: similar to B-cell CLL/ly... 40 0.099
gi|21219450|ref|NP_625229.1| putative secreted proline-rich prot... 40 0.13
gi|50545878|ref|XP_500477.1| hypothetical protein [Yarrowia lipo... 40 0.13
gi|46104668|ref|XP_380316.1| hypothetical protein FG00140.1 [Gib... 40 0.13
gi|21431729|sp|P40602|APG_ARATH Anter-specific proline-rich prot... 40 0.13
gi|50553152|ref|XP_503986.1| hypothetical protein [Yarrowia lipo... 40 0.13
gi|50543532|ref|XP_499932.1| hypothetical protein [Yarrowia lipo... 40 0.13
gi|9719456|gb|AAF97810.1| transposase [Cryphonectria parasitica] 40 0.13
gi|15223790|ref|NP_173441.1| family II extracellular lipase, put... 40 0.13
gi|26325146|dbj|BAC26327.1| unnamed protein product [Mus musculus] 40 0.13
gi|25511649|pir||A86335 T20H2.9 protein - Arabidopsis thaliana >... 40 0.13
gi|13559026|emb|CAC36090.1| bG174L6.2 (MSF: megakaryocyte stimul... 40 0.13
gi|41018603|gb|AAR98211.1| ORF116 hypothetical protein [Orf virus] 40 0.13
gi|32490475|dbj|BAC79158.1| putative protein kinase [Oryza sativ... 40 0.13
gi|47214436|emb|CAF95771.1| unnamed protein product [Tetraodon n... 40 0.13
gi|15320736|ref|NP_203248.1| unknown [Epiphyas postvittana nucle... 40 0.13
gi|50254741|gb|EAL17487.1| hypothetical protein CNBM1790 [Crypto... 40 0.13
gi|41055654|ref|NP_956490.1| hypothetical protein MGC56116 [Dani... 40 0.13
gi|49087208|ref|XP_405568.1| hypothetical protein AN1431.2 [Aspe... 40 0.13
gi|119712|sp|P14918|EXTN_MAIZE Extensin precursor (Proline-rich ... 40 0.17
gi|45507398|ref|ZP_00159742.1| COG3409: Putative peptidoglycan-b... 40 0.17
gi|38110499|gb|EAA56207.1| predicted protein [Magnaporthe grisea... 40 0.17
gi|168457|gb|AAA33456.1| cell wall protein (put.); putative 40 0.17
gi|39595816|emb|CAE67319.1| Hypothetical protein CBG12780 [Caeno... 40 0.17
gi|100864|pir||S08315 cell wall protein - maize (fragment) >gnl|... 40 0.17
gi|21428982|gb|AAM50210.1| GH28840p [Drosophila melanogaster] 40 0.17
gi|44889999|emb|CAF32117.1| hypothetical protein [Aspergillus fu... 40 0.17
gi|49095762|ref|XP_409342.1| hypothetical protein AN5205.2 [Aspe... 40 0.17
gi|29831038|ref|NP_825672.1| hypothetical protein SAV4495 [Strep... 40 0.17
gi|227614|prf||1707318A Thr rich extensin 40 0.17
gi|5802483|gb|AAD51697.1| major outer envelope glycoprotein gp35... 40 0.17
gi|33601575|ref|NP_889135.1| conserved hypothetical protein [Bor... 40 0.17
gi|33596167|ref|NP_883810.1| conserved hypothetical protein [Bor... 40 0.17
gi|9630030|ref|NP_046248.1| unknown [Orgyia pseudotsugata multic... 40 0.17
gi|82698|pir||JQ0985 hydroxyproline-rich glycoprotein precursor ... 40 0.17
gi|50256658|gb|EAL19381.1| hypothetical protein CNBH0740 [Crypto... 40 0.17
gi|22788859|ref|NP_690573.1| hypothetical protein HZV_154 [Helio... 40 0.17
gi|32411655|ref|XP_326308.1| predicted protein [Neurospora crass... 40 0.17
gi|50420479|ref|XP_458776.1| unnamed protein product [Debaryomyc... 40 0.17
gi|45549358|ref|NP_572685.2| CG11122-PA [Drosophila melanogaster... 40 0.17
gi|22971890|ref|ZP_00018805.1| hypothetical protein [Chloroflexu... 40 0.17
gi|34852925|ref|XP_220113.2| similar to expressed sequence AI481... 40 0.17
gi|46123947|ref|XP_386527.1| hypothetical protein FG06351.1 [Gib... 40 0.17
gi|228937|prf||1814452B Hyp-rich glycoprotein 40 0.17
gi|34874109|ref|XP_237808.2| similar to mKIAA0054 protein [Rattu... 40 0.17
gi|26346793|dbj|BAC37045.1| unnamed protein product [Mus musculus] 40 0.17
gi|22788712|ref|NP_690420.1| histone h3, h4 [Heliothis zea virus... 40 0.17
gi|49074872|ref|XP_401539.1| hypothetical protein UM03924.1 [Ust... 40 0.17
gi|33866833|ref|NP_898392.1| conserved hypothetical protein [Syn... 40 0.17
gi|50414757|gb|AAH77771.1| Unknown (protein for IMAGE:4885186) [... 39 0.22
gi|46434499|gb|EAK93907.1| hypothetical protein CaO19.1166 [Cand... 39 0.22
gi|5689551|dbj|BAA83059.1| KIAA1107 protein [Homo sapiens] 39 0.22
gi|50545303|ref|XP_500189.1| hypothetical protein [Yarrowia lipo... 39 0.22
gi|33468989|ref|NP_080653.1| RIKEN cDNA 6330577E15 [Mus musculus... 39 0.22
gi|17505713|ref|NP_492684.1| dauer or Aging adult Overexpression... 39 0.22
gi|32127786|dbj|BAC78176.1| homologue to Drosophila photorecepto... 39 0.22
gi|9965482|gb|AAG02256.1| mucin [Mus musculus] 39 0.22
gi|49035180|gb|AAK31493.2| Hypothetical protein F13H8.5 [Caenorh... 39 0.22
gi|49088074|ref|XP_405902.1| hypothetical protein AN1765.2 [Aspe... 39 0.22
gi|2129478|pir||S51939 chitinase (EC 3.2.1.14) precursor - beet ... 39 0.22
gi|32417148|ref|XP_329052.1| hypothetical protein [Neurospora cr... 39 0.22
gi|38107576|gb|EAA53727.1| hypothetical protein MG09477.4 [Magna... 39 0.22
gi|49087732|ref|XP_405769.1| hypothetical protein AN1632.2 [Aspe... 39 0.22
gi|18093104|ref|NP_542421.1| cask-interacting protein 1 [Rattus ... 39 0.22
gi|30424862|ref|NP_780438.1| serine/arginine repetitive matrix 2... 39 0.22
gi|28972153|dbj|BAC65530.1| mKIAA0324 protein [Mus musculus] 39 0.22
gi|38345447|emb|CAE01616.2| OSJNBa0042L16.2 [Oryza sativa (japon... 39 0.22
gi|17557095|ref|NP_499698.1| polycystic kidney disease 1-like 3 ... 39 0.22
gi|37359744|dbj|BAC97850.1| mKIAA0035 protein [Mus musculus] 39 0.22
gi|28850409|gb|AAO53177.1| similar to Dictyostelium discoideum (... 39 0.22
gi|7511987|pir||T13065 PIP82 protein - fruit fly (Drosophila mel... 39 0.22
gi|45185971|ref|NP_983687.1| ACR285Cp [Eremothecium gossypii] >g... 39 0.22
gi|20808084|ref|NP_623255.1| hypothetical protein [Thermoanaerob... 39 0.22
gi|39933290|ref|NP_945566.1| possible OmpA family member [Rhodop... 39 0.22
gi|10834955|ref|NP_066916.1| ICP4 protein [Gallid herpesvirus 3]... 39 0.22
gi|10834942|ref|NP_066903.1| ICP4 protein [Gallid herpesvirus 3]... 39 0.22
gi|50257986|gb|EAL20680.1| hypothetical protein CNBE0450 [Crypto... 39 0.22
gi|22208462|gb|AAM94291.1| hypothetical protein [Sorghum bicolor] 39 0.22
gi|20138131|sp|Q9FPQ6|GP1_CHLRE Vegetative cell wall protein gp1... 39 0.22
gi|50288747|ref|XP_446803.1| unnamed protein product [Candida gl... 39 0.22
gi|50255862|gb|EAL18593.1| hypothetical protein CNBJ0190 [Crypto... 39 0.22
gi|37546740|ref|XP_034086.2| KIAA1107 protein [Homo sapiens] 39 0.22
gi|2429362|gb|AAB70928.1| proline rich protein [Santalum album] 39 0.22
gi|12854679|dbj|BAB30105.1| unnamed protein product [Mus musculu... 39 0.22
gi|12847716|dbj|BAB27680.1| unnamed protein product [Mus musculus] 39 0.22
gi|24639232|ref|NP_726782.1| CG32805-PA [Drosophila melanogaster... 39 0.22
gi|34868816|ref|XP_220207.2| similar to splicing coactivator sub... 39 0.22
gi|28829856|gb|AAO52358.1| similar to Mus musculus (Mouse). 13 d... 39 0.22
gi|17540794|ref|NP_502196.1| methionyl tRNA Synthetase (101.7 kD... 39 0.22
gi|17543234|ref|NP_501173.1| putative protein (4I100) [Caenorhab... 39 0.22
gi|50260421|gb|EAL23078.1| hypothetical protein CNBA6030 [Crypto... 39 0.29
gi|15240947|ref|NP_198672.1| protein kinase family protein [Arab... 39 0.29
gi|46437856|gb|EAK97196.1| hypothetical protein CaO19.13800 [Can... 39 0.29
gi|44921606|ref|NP_003886.2| synaptojanin 1 isoform a; inositol ... 39 0.29
gi|28828844|gb|AAO51439.1| similar to Homo sapiens (Human). Muci... 39 0.29
gi|4885377|ref|NP_005311.1| H1 histone family, member 3; histone... 39 0.29
gi|46108154|ref|XP_381135.1| hypothetical protein FG00959.1 [Gib... 39 0.29
gi|40788270|dbj|BAA32315.2| KIAA0470 protein [Homo sapiens] 39 0.29
gi|46111355|ref|XP_382735.1| hypothetical protein FG02559.1 [Gib... 39 0.29
gi|2120302|pir||S60546 envelope polyprotein gp41 - human immunod... 39 0.29
gi|48844267|ref|ZP_00298589.1| hypothetical protein Gmet02003255... 39 0.29
gi|7662142|ref|NP_055627.1| KARP-1-binding protein [Homo sapiens... 39 0.29
gi|15145803|gb|AAK83527.1| hydroxyproline-rich glycoprotein VSP4... 39 0.29
gi|8134730|sp|O43426|SYJ1_HUMAN Synaptojanin 1 (Synaptic inosito... 39 0.29
gi|25019697|gb|AAN71783.1| unknown [Synechococcus sp. PCC 7942] 39 0.29
gi|629892|pir||JC2301 hypothetical 47.8K protein - Pneumocystis ... 39 0.29
gi|15640777|ref|NP_230407.1| conserved hypothetical protein [Vib... 39 0.29
gi|27372319|dbj|BAC53724.1| Piccolo [Mus musculus] 39 0.29
gi|22970264|ref|ZP_00017376.1| hypothetical protein [Chloroflexu... 39 0.29
gi|41409898|ref|NP_962734.1| hypothetical protein MAP3800 [Mycob... 39 0.29
gi|6578849|gb|AAF18101.1| FrgA [Myxococcus xanthus] 39 0.29
gi|2702321|gb|AAC51921.1| synaptojanin [Homo sapiens] 39 0.29
gi|7512995|pir||T00095 hypothetical protein KIAA0470 - human >gn... 39 0.29
gi|17555582|ref|NP_497450.1| predicted CDS, tyrosine specific pr... 39 0.29
gi|48763011|ref|ZP_00267568.1| COG1426: Uncharacterized protein ... 39 0.29
gi|32407831|ref|XP_324413.1| predicted protein [Neurospora crass... 39 0.29
gi|28828948|gb|AAO51532.1| similar to Orgyia pseudotsugata multi... 39 0.29
gi|22299765|ref|NP_683012.1| serine/threonine protein kinase [Th... 39 0.29
gi|47213005|emb|CAF95397.1| unnamed protein product [Tetraodon n... 39 0.29
gi|5734603|dbj|BAA83379.1| KARP-1-binding protein 2 (KAB2) [Homo... 39 0.29
gi|33089391|gb|AAP93663.1| MRE-binding transcription factor-1La ... 39 0.29
gi|27372317|dbj|BAC53723.1| Piccolo [Mus musculus] 39 0.29
gi|12018149|gb|AAG45421.1| gamete-specific hydroxyproline-rich g... 39 0.29
gi|21744257|gb|AAM76187.1| LD18893p [Drosophila melanogaster] 39 0.38
gi|46110623|ref|XP_382369.1| hypothetical protein FG02193.1 [Gib... 39 0.38
gi|1711406|sp|P51531|SN22_HUMAN Possible global transcription ac... 39 0.38
gi|1711527|sp|P52172|SRP_DROME Box A-binding factor (ABF) (Serpe... 39 0.38
gi|40788894|dbj|BAA11487.2| KIAA0170 [Homo sapiens] 39 0.38
gi|15277229|dbj|BAB63322.1| Homologue to Drosophila photorecepto... 39 0.38
gi|34525762|gb|AAQ73927.1| erythrocyte membrane protein 1 [Plasm... 39 0.38
gi|45506069|ref|ZP_00158431.1| COG3420: Nitrous oxidase accessor... 39 0.38
gi|46227966|gb|EAK88886.1| hypothetical protein with 6 transmemb... 39 0.38
gi|32411673|ref|XP_326317.1| predicted protein [Neurospora crass... 39 0.38
gi|41400384|gb|AAS07044.1| plus agglutinin [Chlamydomonas reinha... 39 0.38
gi|48892282|ref|ZP_00325680.1| COG3210: Large exoproteins involv... 39 0.38
gi|39584835|emb|CAE67730.1| Hypothetical protein CBG13305 [Caeno... 39 0.38
gi|24286648|gb|AAN46875.1| nucleotide exchange factor RasGEF F [... 39 0.38
gi|50257257|gb|EAL19966.1| hypothetical protein CNBF2930 [Crypto... 39 0.38
gi|6752401|gb|AAF27711.1| PspA [Streptococcus pneumoniae] 39 0.38
gi|32407022|ref|XP_324114.1| predicted protein [Neurospora crass... 39 0.38
gi|33592375|ref|NP_880019.1| translation initiation factor IF-2 ... 39 0.38
gi|9631626|ref|NP_048405.1| contains Pro-rich Px motifs: SPKPP (... 39 0.38
gi|28828404|gb|AAM09323.2| similar to ATP-dependent RNA helicase... 39 0.38
gi|17229582|ref|NP_486130.1| unknown protein [Nostoc sp. PCC 712... 39 0.38
gi|228938|prf||1814452C Hyp-rich glycoprotein 39 0.38
gi|24663470|ref|NP_648601.1| CG10967-PA [Drosophila melanogaster... 39 0.38
gi|42657611|ref|XP_376479.1| mediator of DNA damage checkpoint 1... 39 0.38
gi|27544394|dbj|BAC54931.1| homologue to Drosophila photorecepto... 39 0.38
gi|46227727|gb|EAK88647.1| possible FH2 formin homology domain [... 39 0.38
gi|15419013|gb|AAK94670.1| subtilisin-like protein [Toxoplasma g... 39 0.38
gi|283032|pir||S22456 hydroxyproline-rich glycoprotein - perenni... 39 0.38
gi|32264966|gb|AAP78905.1| type IB DNA topoisomerase small subun... 39 0.38
gi|46249987|gb|AAH68430.1| Unknown (protein for IMAGE:6963377) [... 39 0.38
gi|32416182|ref|XP_328569.1| hypothetical protein [Neurospora cr... 38 0.49
gi|14017853|dbj|BAB47447.1| KIAA1818 protein [Homo sapiens] 38 0.49
gi|24642109|ref|NP_573006.1| CG9095-PA [Drosophila melanogaster]... 38 0.49
gi|34935394|ref|XP_234443.2| similar to Expressed sequence AI324... 38 0.49
gi|15887518|ref|NP_353199.1| AGR_C_267p [Agrobacterium tumefacie... 38 0.49
gi|49093020|ref|XP_407971.1| hypothetical protein AN3834.2 [Aspe... 38 0.49
gi|23956252|ref|NP_536705.1| mucin 4 [Mus musculus] >gnl|BL_ORD_... 38 0.49
gi|32413637|ref|XP_327298.1| hypothetical protein [Neurospora cr... 38 0.49
gi|9759455|dbj|BAB10371.1| unnamed protein product [Arabidopsis ... 38 0.49
gi|2769560|emb|CAA67558.1| gp340 [Human herpesvirus 4] 38 0.49
gi|15805014|ref|NP_056224.1| E1A binding protein p400; p400 SWI2... 38 0.49
gi|48890429|ref|ZP_00324119.1| COG3210: Large exoproteins involv... 38 0.49
gi|16803145|ref|NP_464630.1| highly similar to TN916 ORF15 [List... 38 0.49
gi|47085799|ref|NP_998238.1| zgc:55839 [Danio rerio] >gnl|BL_ORD... 38 0.49
gi|34394212|dbj|BAC84664.1| unknown protein [Oryza sativa (japon... 38 0.49
gi|33239375|ref|NP_778198.1| similar to selenoprotein W [Mus mus... 38 0.49
gi|38110219|gb|EAA55974.1| hypothetical protein MG01625.4 [Magna... 38 0.49
gi|7499984|pir||T29532 hypothetical protein F27C1.11 - Caenorhab... 38 0.49
gi|46442924|gb|EAL02210.1| hypothetical protein CaO19.906 [Candi... 38 0.49
gi|27374359|gb|AAO01099.1| CG10967-PA [Drosophila virilis] 38 0.49
gi|50730113|ref|XP_416776.1| PREDICTED: similar to cofactor requ... 38 0.49
gi|46432590|gb|EAK92065.1| hypothetical protein CaO19.6598 [Cand... 38 0.49
gi|48729907|ref|ZP_00263656.1| COG0810: Periplasmic protein TonB... 38 0.49
gi|7019229|emb|CAB75732.1| bone sialoprotein-binding protein [St... 38 0.49
gi|7595307|gb|AAF64406.1| opioid growth factor receptor [Homo sa... 38 0.49
gi|2565061|gb|AAB91441.1| CAGH32 [Homo sapiens] 38 0.49
gi|34859099|ref|XP_342553.1| nuclear receptor coactivator 6 [Rat... 38 0.49
gi|15238868|ref|NP_200198.1| plastocyanin-like domain-containing... 38 0.49
gi|6752389|gb|AAF27705.1| PspA [Streptococcus pneumoniae] 38 0.49
gi|32406244|ref|XP_323735.1| hypothetical protein [Neurospora cr... 38 0.49
gi|37730126|gb|AAO62015.1| envelope glycoprotein precursor [Crim... 38 0.49
gi|37590277|gb|AAH59298.1| MGC68897 protein [Xenopus laevis] 38 0.49
gi|17540434|ref|NP_501809.1| putative nuclear protein family mem... 38 0.49
gi|25144087|ref|NP_491599.2| doublecortin and IQ calmodulin-bind... 38 0.49
gi|49068798|ref|XP_398688.1| hypothetical protein UM01073.1 [Ust... 38 0.49
gi|15239513|ref|NP_200917.1| proline-rich family protein [Arabid... 38 0.49
gi|49088936|ref|XP_406238.1| hypothetical protein AN2101.2 [Aspe... 38 0.49
gi|28829971|gb|AAO52461.1| similar to Plasmodium falciparum. Hyp... 38 0.49
gi|50120005|ref|YP_049172.1| hypothetical protein ECA1065 [Erwin... 38 0.49
gi|9629306|ref|NP_044506.1| very large tegument protein [Human h... 38 0.49
gi|28379116|ref|NP_786008.1| cell surface protein precursor [Lac... 38 0.49
gi|27380359|ref|NP_771888.1| bll5248 [Bradyrhizobium japonicum U... 38 0.49
gi|38102662|gb|EAA49475.1| hypothetical protein MG01133.4 [Magna... 38 0.49
gi|17566088|ref|NP_507521.1| putative protein (5S487) [Caenorhab... 38 0.49
gi|50080244|gb|AAT69579.1| hypothetical protein [Oryza sativa (j... 38 0.64
gi|34540100|ref|NP_904579.1| translation initiation factor IF-2 ... 38 0.64
gi|50553612|ref|XP_504217.1| hypothetical protein [Yarrowia lipo... 38 0.64
gi|2120304|pir||S60548 envelope polyprotein gp41 - human immunod... 38 0.64
gi|49095328|ref|XP_409125.1| hypothetical protein AN4988.2 [Aspe... 38 0.64
gi|31543259|ref|NP_034943.2| max binding protein [Mus musculus] ... 38 0.64
gi|1841930|emb|CAA68878.1| ROX protein [Mus musculus] >gnl|BL_OR... 38 0.64
gi|26991766|ref|NP_747191.1| conserved hypothetical protein [Pse... 38 0.64
gi|22538461|ref|NP_006302.2| nuclear receptor co-repressor 1; th... 38 0.64
gi|50759930|ref|XP_425775.1| PREDICTED: similar to Ser/Arg-relat... 38 0.64
gi|9635070|ref|NP_057795.1| major tegument protein [Gallid herpe... 38 0.64
gi|506466|emb|CAA84293.1| dystroglycan [Mus musculus] 38 0.64
gi|3510603|gb|AAC33550.1| nuclear receptor co-repressor N-CoR [H... 38 0.64
gi|2120303|pir||S60547 envelope polyprotein gp41 - human immunod... 38 0.64
gi|41400381|gb|AAS07042.1| minus agglutinin [Chlamydomonas reinh... 38 0.64
gi|7512967|pir||T02345 hypothetical protein KIAA0324 - human (fr... 38 0.64
gi|1170155|sp|P43277|H13_MOUSE Histone H1.3 (H1 VAR.4) (H1D) >gn... 38 0.64
gi|50255758|gb|EAL18490.1| hypothetical protein CNBJ1320 [Crypto... 38 0.64
gi|31239605|ref|XP_320216.1| ENSANGP00000009012 [Anopheles gambi... 38 0.64
gi|12851999|dbj|BAB29232.1| unnamed protein product [Mus musculus] 38 0.64
gi|6649242|gb|AAF21439.1| splicing coactivator subunit SRm300 [H... 38 0.64
gi|46576017|gb|AAT01378.1| unknown protein [Oryza sativa (japoni... 38 0.64
gi|30387315|ref|NP_848394.1| unknown [Choristoneura fumiferana M... 38 0.64
gi|28828697|gb|AAO51294.1| similar to Dictyostelium discoideum (... 38 0.64
gi|477072|pir||A48018 mucin 7 precursor, salivary - human 38 0.64
gi|38605837|emb|CAE02917.3| OSJNBb0108J11.9 [Oryza sativa (japon... 38 0.64
gi|22748665|ref|NP_689504.1| mucin 7, salivary [Homo sapiens] >g... 38 0.64
gi|5821151|dbj|BAA83717.1| RNA binding protein [Homo sapiens] 38 0.64
gi|462387|sp|P33479|IE18_PRVKA IMMEDIATE-EARLY PROTEIN IE180 >gn... 38 0.64
gi|26991660|ref|NP_747085.1| flavin-containing monamine oxidase ... 38 0.64
gi|6634015|dbj|BAA20782.2| KIAA0324 protein [Homo sapiens] 38 0.64
gi|15921063|ref|NP_376732.1| 238aa long hypothetical protein [Su... 38 0.64
gi|37546166|ref|XP_291345.2| KIAA0522 protein [Homo sapiens] 38 0.64
gi|33089393|gb|AAP93664.1| MRE-binding transcription factor-1Lb ... 38 0.64
gi|544262|sp|Q03211|EXLP_TOBAC Pistil-specific extensin-like pro... 38 0.64
gi|18495771|emb|CAC87571.1| surface protein [Theileria annulata]... 38 0.64
gi|19923466|ref|NP_057417.2| splicing coactivator subunit SRm300... 38 0.64
gi|34559252|gb|AAQ75382.1| global transcription activator Swi1p ... 38 0.64
gi|46432987|gb|EAK92446.1| hypothetical protein CaO19.8926 [Cand... 38 0.64
gi|24649699|ref|NP_651268.1| CG6631-PA [Drosophila melanogaster]... 38 0.64
gi|37533816|ref|NP_921210.1| putative polyprotein [Oryza sativa ... 38 0.64
gi|46402167|ref|NP_997086.1| hypothetical protein LOC73072 [Mus ... 38 0.64
gi|50732002|ref|XP_418453.1| PREDICTED: similar to two AAA domai... 38 0.64
gi|17539572|ref|NP_501786.1| dauer Up-Regulated DUR-1, dur135 li... 37 0.84
gi|4691407|emb|CAA91079.2| SPAC22F3.14c [Schizosaccharomyces pombe] 37 0.84
gi|50258428|gb|EAL21117.1| hypothetical protein CNBD4930 [Crypto... 37 0.84
gi|7446484|pir||T05717 probable extensin - barley (fragment) >gn... 37 0.84
gi|4322022|gb|AAD15922.1| myosin light chain kinase isoform 3A [... 37 0.84
gi|45506783|ref|ZP_00159133.1| hypothetical protein Avar407601 [... 37 0.84
gi|15277340|ref|NP_036125.2| piccolo (presynaptic cytomatrix pro... 37 0.84
gi|17539574|ref|NP_501787.1| dauer Up-Regulated DUR-1, dur135 li... 37 0.84
gi|20137581|sp|Q9Y3L3|3BP1_HUMAN SH3-domain binding protein 1 (3... 37 0.84
gi|50259467|gb|EAL22140.1| hypothetical protein CNBC2780 [Crypto... 37 0.84
gi|13702294|dbj|BAB43865.1| Nadrin E2 [Rattus norvegicus] 37 0.84
gi|40018515|ref|NP_954552.1| BERF4 frame, homology with BERF1 an... 37 0.84
gi|34328647|gb|AAO83650.1| putative protein Roco5 [Dictyostelium... 37 0.84
gi|38173919|gb|AAH60981.1| Txndc2 protein [Mus musculus] 37 0.84
gi|41057179|ref|NP_957893.1| ORF116 hypothetical protein [Orf vi... 37 0.84
gi|42525075|ref|NP_970455.1| hypothetical protein Bd3745 [Bdello... 37 0.84
gi|32422547|ref|XP_331717.1| hypothetical protein [Neurospora cr... 37 0.84
gi|1483568|emb|CAA56309.1| substrate of the proteinase [Pseudora... 37 0.84
gi|21686698|ref|NP_663198.1| occlusion derived virus envelope pr... 37 0.84
gi|15222149|ref|NP_175372.1| leucine-rich repeat family protein ... 37 0.84
gi|48103082|ref|XP_392839.1| similar to ENSANGP00000009824 [Apis... 37 0.84
gi|24212084|sp|Q9QYX7|PCLO_MOUSE Piccolo protein (Presynaptic cy... 37 0.84
gi|17569987|ref|NP_510852.1| bile lipase like (XS293) [Caenorhab... 37 0.84
gi|21214752|emb|CAD32253.1| gag-pol polyprotein precursor; hypot... 37 0.84
gi|26006099|dbj|BAC41393.1| mKIAA0054 protein [Mus musculus] 37 0.84
gi|46366848|ref|ZP_00199396.2| hypothetical protein Krad06000092... 37 0.84
gi|17569989|ref|NP_510854.1| carboxyl ester lipase like (XS293) ... 37 0.84
gi|23506315|gb|AAN37735.1| PspA [Streptococcus pneumoniae] 37 0.84
gi|26328823|dbj|BAC28150.1| unnamed protein product [Mus musculus] 37 0.84
gi|11360278|pir||T46916 hypothetical protein DKFZp762E117.1 - hu... 37 0.84
gi|19862882|sp|Q09779|YATE_SCHPO Hypothetical protein C1D4.14 in... 37 0.84
gi|27881767|gb|AAH44677.1| Crebbp-A protein [Xenopus laevis] 37 0.84
gi|50309575|ref|XP_454799.1| unnamed protein product [Kluyveromy... 37 0.84
gi|49087738|ref|XP_405771.1| hypothetical protein AN1634.2 [Aspe... 37 0.84
gi|6958206|gb|AAF32493.1| kexin-like protease KEX1 [Pneumocystis... 37 0.84
gi|27924223|gb|AAH45038.1| Similar to ribosome binding protein 1... 37 0.84
gi|34364492|emb|CAA93286.2| Hypothetical protein F25H8.5b [Caeno... 37 0.84
>gi|1053155|gb|AAA80686.1| TAU-1a
Length = 431
Score = 615 bits (1586), Expect = e-175
Identities = 311/311 (100%), Positives = 311/311 (100%)
Frame = +1
Query: 427 IPDAPTMEDIAPRELESLNFSETSGTSDQQADRIMQNNENERVEEKKQMSPTPSQPQHKT 606
IPDAPTMEDIAPRELESLNFSETSGTSDQQADRIMQNNENERVEEKKQMSPTPSQPQHKT
Sbjct: 121 IPDAPTMEDIAPRELESLNFSETSGTSDQQADRIMQNNENERVEEKKQMSPTPSQPQHKT 180
Query: 607 PQRSGIRPPTAILRQPKPIPASLPRPATATPSSQRAISTPRQTASTAPSPRPISKMSRER 786
PQRSGIRPPTAILRQPKPIPASLPRPATATPSSQRAISTPRQTASTAPSPRPISKMSRER
Sbjct: 181 PQRSGIRPPTAILRQPKPIPASLPRPATATPSSQRAISTPRQTASTAPSPRPISKMSRER 240
Query: 787 SDVQKSTSTRSIDNVGRMTPKVNAKFVNVKSKVGSVTNHKAGGGNVEIFSEKRLYNAQSK 966
SDVQKSTSTRSIDNVGRMTPKVNAKFVNVKSKVGSVTNHKAGGGNVEIFSEKRLYNAQSK
Sbjct: 241 SDVQKSTSTRSIDNVGRMTPKVNAKFVNVKSKVGSVTNHKAGGGNVEIFSEKRLYNAQSK 300
Query: 967 VGSLKNATHVAGGGNVQIENRKLDFSAASPKVGSKTNYQPAKSDVKIVSEKLTWQAKSKV 1146
VGSLKNATHVAGGGNVQIENRKLDFSAASPKVGSKTNYQPAKSDVKIVSEKLTWQAKSKV
Sbjct: 301 VGSLKNATHVAGGGNVQIENRKLDFSAASPKVGSKTNYQPAKSDVKIVSEKLTWQAKSKV 360
Query: 1147 GSMDNAAHKPAGGNVQILSQKLNWKAESKVGSKDNMNHRPGGGNVQIFDEKIRYVSTDSS 1326
GSMDNAAHKPAGGNVQILSQKLNWKAESKVGSKDNMNHRPGGGNVQIFDEKIRYVSTDSS
Sbjct: 361 GSMDNAAHKPAGGNVQILSQKLNWKAESKVGSKDNMNHRPGGGNVQIFDEKIRYVSTDSS 420
Query: 1327 RNHSTLDISSL 1359
RNHSTLDISSL
Sbjct: 421 RNHSTLDISSL 431
>gi|25151496|ref|NP_497253.2| protein with Tau-Like repeats,
Microtubule-associated (49.4 kD) (ptl-1) [Caenorhabditis
elegans]
gi|1698712|gb|AAB97090.1| PTL-1A protein [Caenorhabditis elegans]
gi|14589809|gb|AAK70645.1| Protein with tau-like repeats protein 1,
isoform a [Caenorhabditis elegans]
Length = 453
Score = 615 bits (1586), Expect = e-175
Identities = 311/311 (100%), Positives = 311/311 (100%)
Frame = +1
Query: 427 IPDAPTMEDIAPRELESLNFSETSGTSDQQADRIMQNNENERVEEKKQMSPTPSQPQHKT 606
IPDAPTMEDIAPRELESLNFSETSGTSDQQADRIMQNNENERVEEKKQMSPTPSQPQHKT
Sbjct: 143 IPDAPTMEDIAPRELESLNFSETSGTSDQQADRIMQNNENERVEEKKQMSPTPSQPQHKT 202
Query: 607 PQRSGIRPPTAILRQPKPIPASLPRPATATPSSQRAISTPRQTASTAPSPRPISKMSRER 786
PQRSGIRPPTAILRQPKPIPASLPRPATATPSSQRAISTPRQTASTAPSPRPISKMSRER
Sbjct: 203 PQRSGIRPPTAILRQPKPIPASLPRPATATPSSQRAISTPRQTASTAPSPRPISKMSRER 262
Query: 787 SDVQKSTSTRSIDNVGRMTPKVNAKFVNVKSKVGSVTNHKAGGGNVEIFSEKRLYNAQSK 966
SDVQKSTSTRSIDNVGRMTPKVNAKFVNVKSKVGSVTNHKAGGGNVEIFSEKRLYNAQSK
Sbjct: 263 SDVQKSTSTRSIDNVGRMTPKVNAKFVNVKSKVGSVTNHKAGGGNVEIFSEKRLYNAQSK 322
Query: 967 VGSLKNATHVAGGGNVQIENRKLDFSAASPKVGSKTNYQPAKSDVKIVSEKLTWQAKSKV 1146
VGSLKNATHVAGGGNVQIENRKLDFSAASPKVGSKTNYQPAKSDVKIVSEKLTWQAKSKV
Sbjct: 323 VGSLKNATHVAGGGNVQIENRKLDFSAASPKVGSKTNYQPAKSDVKIVSEKLTWQAKSKV 382
Query: 1147 GSMDNAAHKPAGGNVQILSQKLNWKAESKVGSKDNMNHRPGGGNVQIFDEKIRYVSTDSS 1326
GSMDNAAHKPAGGNVQILSQKLNWKAESKVGSKDNMNHRPGGGNVQIFDEKIRYVSTDSS
Sbjct: 383 GSMDNAAHKPAGGNVQILSQKLNWKAESKVGSKDNMNHRPGGGNVQIFDEKIRYVSTDSS 442
Query: 1327 RNHSTLDISSL 1359
RNHSTLDISSL
Sbjct: 443 RNHSTLDISSL 453