Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= F43C11_3
         (1020 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17533957|ref|NP_494246.1| putative nuclear protein (38.9 kD) ...   636   0.0
gi|17563676|ref|NP_506693.1| putative nuclear protein (34.6 kD) ...    58   4e-07
gi|17570009|ref|NP_510421.1| putative cytoplasmic protein (XP163...    57   5e-07
gi|39583361|emb|CAE66335.1| Hypothetical protein CBG11586 [Caeno...    52   2e-05
gi|21464474|gb|AAM52040.1| SD04710p [Drosophila melanogaster]          41   0.050
gi|18497296|ref|NP_569729.1| CG6562-PB [Drosophila melanogaster]...    40   0.11
gi|29561816|emb|CAD87782.1| SI:dZ25N23.1 (novel gene similar to ...    39   0.15
gi|1749842|emb|CAB02634.1| cell wall protein [Yarrowia lipolytica]     39   0.15
gi|27370088|ref|NP_766331.1| RIKEN cDNA A430081P20 [Mus musculus...    39   0.15
gi|27884106|emb|CAD61238.1| SI:dZ39L02.2 (novel protein similar ...    39   0.15
gi|7715569|gb|AAF68096.1| PspA [Streptococcus pneumoniae]              39   0.19
gi|15679883|ref|NP_277001.1| unknown [Methanothermobacter therma...    39   0.19
gi|21751020|dbj|BAC03887.1| unnamed protein product [Homo sapiens]     39   0.19
gi|50425207|ref|XP_461195.1| unnamed protein product [Debaryomyc...    39   0.19
gi|23510323|ref|NP_055917.1| nephroretinin; nephrocystin 4; Seni...    39   0.25
gi|7715547|gb|AAF68091.1| PspA [Streptococcus pneumoniae]              39   0.25
gi|7513060|pir||T00364 hypothetical protein KIAA0673 - human (fr...    39   0.25
gi|7715553|gb|AAF68094.1| PspA [Streptococcus pneumoniae]              39   0.25
gi|26251987|gb|AAH40520.1| NPHP4 protein [Homo sapiens]                39   0.25
gi|30959104|gb|AAP12670.1| nervous system adducin [Aplysia calif...    39   0.25
gi|30696750|ref|NP_176463.2| invertase/pectin methylesterase inh...    38   0.32
gi|7512967|pir||T02345 hypothetical protein KIAA0324 - human (fr...    38   0.42
gi|46119199|ref|ZP_00176221.2| COG0532: Translation initiation f...    38   0.42
gi|42519237|ref|NP_965167.1| hypothetical protein LJ1313 [Lactob...    38   0.42
gi|23474366|ref|ZP_00129660.1| COG0438: Glycosyltransferase [Des...    38   0.42
gi|49130367|ref|XP_412967.1| hypothetical protein AN8830.2 [Aspe...    37   0.55
gi|23471160|ref|ZP_00126491.1| COG0553: Superfamily II DNA/RNA h...    37   0.55
gi|15679866|ref|NP_276984.1| heterodisulfide reductase, subunit ...    37   0.55
gi|463250|emb|CAA83229.1| Neurofilament protein, high molecular ...    37   0.55
gi|41581244|emb|CAE47893.1| basic proline-rich protein [Aspergil...    37   0.55
gi|19923466|ref|NP_057417.2| splicing coactivator subunit SRm300...    37   0.55
gi|46275814|ref|NP_035034.1| neurofilament, heavy polypeptide [M...    37   0.55
gi|31239093|ref|XP_319960.1| ENSANGP00000016740 [Anopheles gambi...    37   0.55
gi|30424862|ref|NP_780438.1| serine/arginine repetitive matrix 2...    37   0.72
gi|34871032|ref|XP_238415.2| similar to CDNA sequence BC019977 [...    37   0.72
gi|14290570|gb|AAH09062.1| Unknown (protein for IMAGE:3875076) [...    37   0.72
gi|17569989|ref|NP_510854.1| carboxyl ester lipase like (XS293) ...    37   0.72
gi|17569991|ref|NP_510853.1| bile lipase like (XS293) [Caenorhab...    37   0.72
gi|5821151|dbj|BAA83717.1| RNA binding protein [Homo sapiens]          37   0.72
gi|49096134|ref|XP_409527.1| hypothetical protein AN5390.2 [Aspe...    37   0.72
gi|28871246|ref|NP_793865.1| ATP-dependent helicase hepA , putat...    37   0.72
gi|39597770|emb|CAE68462.1| Hypothetical protein CBG14255 [Caeno...    37   0.72
gi|17569987|ref|NP_510852.1| bile lipase like (XS293) [Caenorhab...    37   0.72
gi|32418726|ref|XP_329841.1| predicted protein [Neurospora crass...    37   0.72
gi|28972153|dbj|BAC65530.1| mKIAA0324 protein [Mus musculus]           37   0.72
gi|7715573|gb|AAF68098.1| PspA [Streptococcus pneumoniae]              37   0.72
gi|13540403|gb|AAK29455.1| histone H1 [Lens culinaris]                 37   0.72
gi|6634015|dbj|BAA20782.2| KIAA0324 protein [Homo sapiens]             37   0.72
gi|23487022|gb|EAA20943.1| hypothetical protein [Plasmodium yoel...    37   0.72
gi|25152945|ref|NP_741957.1| carboxyl ester lipase like (XS293) ...    37   0.72
gi|34868816|ref|XP_220207.2| similar to splicing coactivator sub...    37   0.72
gi|7715577|gb|AAF68100.1| PspA [Streptococcus pneumoniae]              37   0.72
gi|7715579|gb|AAF68101.1| PspA [Streptococcus pneumoniae]              37   0.72
gi|7715571|gb|AAF68097.1| PspA [Streptococcus pneumoniae]              37   0.72
gi|28972433|dbj|BAC65670.1| mKIAA0845 protein [Mus musculus]           37   0.94
gi|13592175|gb|AAK31375.1| ppg3 [Leishmania major]                     37   0.94
gi|28278291|gb|AAH46260.1| Dag1-prov protein [Xenopus laevis]          37   0.94
gi|50257600|gb|EAL20305.1| hypothetical protein CNBF1170 [Crypto...    37   0.94
gi|128127|sp|P19246|NFH_MOUSE Neurofilament triplet H protein (2...    37   0.94
gi|31207249|ref|XP_312591.1| ENSANGP00000014306 [Anopheles gambi...    37   0.94
gi|48831847|ref|ZP_00288897.1| COG0515: Serine/threonine protein...    37   0.94
gi|15222149|ref|NP_175372.1| leucine-rich repeat family protein ...    36   1.2
gi|32474662|ref|NP_867656.1| conserved hypothetical protein [Pir...    36   1.2
gi|6958206|gb|AAF32493.1| kexin-like protease KEX1 [Pneumocystis...    36   1.2
gi|7800654|gb|AAF70098.1| PspA [Streptococcus pneumoniae]              36   1.2
gi|31202189|ref|XP_310043.1| ENSANGP00000015192 [Anopheles gambi...    36   1.2
gi|49078940|ref|XP_403171.1| hypothetical protein UM05556.1 [Ust...    36   1.2
gi|30685162|ref|NP_188532.2| leucine-rich repeat family protein ...    36   1.2
gi|38348332|ref|NP_940910.1| FLJ44186 protein [Homo sapiens] >gn...    36   1.2
gi|13540405|gb|AAK29456.1| histone H1 [Lens culinaris]                 36   1.2
gi|20259488|gb|AAM13864.1| unknown protein [Arabidopsis thaliana]      36   1.2
gi|10764250|gb|AAG22622.1| mutated NS5A [synthetic construct]          36   1.2
gi|10644142|gb|AAG21144.1| polyprotein [Hepatitis C virus type 1a]     36   1.2
gi|10644126|gb|AAG21136.1| polyprotein [Hepatitis C virus type 1...    36   1.2
gi|10644140|gb|AAG21143.1| polyprotein [Hepatitis C virus type 1a]     36   1.2
gi|50553702|ref|XP_504262.1| hypothetical protein [Yarrowia lipo...    36   1.2
gi|14423637|sp|Q9UKF5|AD29_HUMAN ADAM 29 precursor (A disintegri...    36   1.6
gi|11497601|ref|NP_055084.2| a disintegrin and metalloproteinase...    36   1.6
gi|19548141|gb|AAL90445.1| surface protein PspC [Streptococcus p...    36   1.6
gi|477072|pir||A48018 mucin 7 precursor, salivary - human              36   1.6
gi|21465093|gb|AAM54670.1| histone H1 [Lathyrus aphaca]                36   1.6
gi|37359876|dbj|BAC97916.1| mKIAA0262 protein [Mus musculus]           36   1.6
gi|14599404|emb|CAC43457.1| protease 1 [Pneumocystis carinii]          36   1.6
gi|28573658|ref|NP_726306.2| CG30416-PA [Drosophila melanogaster...    36   1.6
gi|18308026|gb|AAL67804.1| pneumococcal surface protein A [Strep...    36   1.6
gi|22972215|ref|ZP_00019107.1| hypothetical protein [Chloroflexu...    36   1.6
gi|4210366|emb|CAA10317.1| APC2 protein [Homo sapiens]                 36   1.6
gi|8163662|gb|AAF73789.1| surface protein PspC [Streptococcus pn...    36   1.6
gi|7682773|gb|AAF67356.1| PspA [Streptococcus pneumoniae]              36   1.6
gi|34853091|ref|XP_342392.1| inositol polyphosphate 5-phosphatas...    36   1.6
gi|47213750|emb|CAF96415.1| unnamed protein product [Tetraodon n...    36   1.6
gi|5031587|ref|NP_005874.1| adenomatosis polyposis coli 2; adeno...    36   1.6
gi|15888686|ref|NP_354367.1| AGR_C_2517p [Agrobacterium tumefaci...    35   2.1
gi|50258466|gb|EAL21155.1| hypothetical protein CNBD5310 [Crypto...    35   2.1
gi|13540401|gb|AAK29454.1| histone H1 [Lens culinaris]                 35   2.1
gi|15677912|ref|NP_275080.1| hypothetical protein NMB2092 [Neiss...    35   2.1
gi|6752405|gb|AAF27713.1| PspA [Streptococcus pneumoniae]              35   2.1
gi|50291435|ref|XP_448150.1| unnamed protein product [Candida gl...    35   2.1
gi|10334767|gb|AAG16729.1| factor H-binding inhibitor of complem...    35   2.1
gi|17935260|ref|NP_532050.1| conserved hypothetical protein [Agr...    35   2.1
gi|8163689|gb|AAF73803.1| surface protein PspC [Streptococcus pn...    35   2.1
gi|32418768|ref|XP_329862.1| hypothetical protein [Neurospora cr...    35   2.1
gi|37534228|ref|NP_921416.1| hypothetical protein [Oryza sativa ...    35   2.1
gi|31213063|ref|XP_315475.1| ENSANGP00000021721 [Anopheles gambi...    35   2.1
gi|49126478|ref|XP_412728.1| hypothetical protein AN8591.2 [Aspe...    35   2.1
gi|38105982|gb|EAA52344.1| hypothetical protein MG05036.4 [Magna...    35   2.1
gi|39587394|emb|CAE75048.1| Hypothetical protein CBG22961 [Caeno...    35   2.1
gi|28829800|gb|AAO52302.1| similar to Homo sapiens (Human). Dent...    35   2.1
gi|38105585|gb|EAA51996.1| predicted protein [Magnaporthe grisea...    35   2.1
gi|21429606|gb|AAM49796.1| heavy neurofilament NF-H [Rattus norv...    35   2.7
gi|205680|gb|AAA41692.1| high molecular weight neurofilament           35   2.7
gi|50258870|gb|EAL21553.1| hypothetical protein CNBD0210 [Crypto...    35   2.7
gi|462702|sp|P16884|NFH_RAT Neurofilament triplet H protein (200...    35   2.7
gi|46124911|ref|XP_387009.1| hypothetical protein FG06833.1 [Gib...    35   2.7
gi|6649857|gb|AAF21601.1| kexin-like serine endoprotease [Pneumo...    35   2.7
gi|39585211|emb|CAE57454.1| Hypothetical protein CBG00418 [Caeno...    35   2.7
gi|46125285|ref|XP_387196.1| hypothetical protein FG07020.1 [Gib...    35   2.7
gi|48104706|ref|XP_392964.1| similar to ENSANGP00000012035 [Apis...    35   2.7
gi|48732872|ref|ZP_00266615.1| COG0553: Superfamily II DNA/RNA h...    35   2.7
gi|12018149|gb|AAG45421.1| gamete-specific hydroxyproline-rich g...    35   2.7
gi|50255234|gb|EAL17970.1| hypothetical protein CNBK3210 [Crypto...    35   2.7
gi|92538|pir||S02003 neurofilament triplet H protein - rat (frag...    35   2.7
gi|48143112|ref|XP_397408.1| similar to chloroquine resistance m...    35   2.7
gi|31213391|ref|XP_315639.1| ENSANGP00000021845 [Anopheles gambi...    35   2.7
gi|50763966|ref|XP_422925.1| PREDICTED: similar to C10ORF6, part...    35   2.7
gi|1354683|gb|AAB53537.1| non-structural 5a protein                    35   2.7
gi|1100971|gb|AAC44099.1| SspA                                         35   2.7
gi|17939907|emb|CAD19511.1| UL36 protein [Suid herpesvirus 1 str...    35   2.7
gi|50254734|gb|EAL17480.1| hypothetical protein CNBM1720 [Crypto...    35   2.7
gi|46124527|ref|XP_386817.1| hypothetical protein FG06641.1 [Gib...    35   2.7
gi|50258945|gb|EAL21626.1| hypothetical protein CNBC6620 [Crypto...    35   2.7
gi|47060309|gb|AAT09768.1| titin [Homo sapiens]                        35   2.7
gi|29789026|ref|NP_036739.1| neurofilament, heavy polypeptide [R...    35   2.7
gi|205686|gb|AAA41695.1| heavy neurofilament subunit                   35   2.7
gi|4996367|dbj|BAA78426.1| polyprotein [Arabidopsis thaliana]          35   2.7
gi|8163724|gb|AAF73826.1| surface protein PcpC [Streptococcus pn...    35   3.6
gi|1841853|gb|AAB47539.1| chitinase protein [Hyphantria cunea]         35   3.6
gi|47215942|emb|CAF96344.1| unnamed protein product [Tetraodon n...    35   3.6
gi|50749422|ref|XP_421630.1| PREDICTED: similar to nucleolus-cyt...    35   3.6
gi|39590935|emb|CAE58715.1| Hypothetical protein CBG01900 [Caeno...    35   3.6
gi|50508930|dbj|BAD31835.1| putative high-affinity potassium tra...    35   3.6
gi|24668401|ref|NP_730693.1| CG7421-PB [Drosophila melanogaster]...    35   3.6
gi|19548143|gb|AAL90446.1| surface protein PspC [Streptococcus p...    35   3.6
gi|8163649|gb|AAF73782.1| surface protein PspC [Streptococcus pn...    35   3.6
gi|50546945|ref|XP_500942.1| hypothetical protein [Yarrowia lipo...    35   3.6
gi|25990270|gb|AAC44101.3| streptococcal surface protein A precu...    35   3.6
gi|39586313|emb|CAE66724.1| Hypothetical protein CBG12070 [Caeno...    35   3.6
gi|32421297|ref|XP_331092.1| predicted protein [Neurospora crass...    35   3.6
gi|24943078|gb|AAF68853.2| Nopp140-like nucleolar protein [Droso...    35   3.6
gi|8163718|gb|AAF73821.1| surface protein PspC [Streptococcus pn...    35   3.6
gi|45551819|ref|NP_730694.2| CG7421-PA [Drosophila melanogaster]...    35   3.6
gi|50293285|ref|XP_449054.1| unnamed protein product [Candida gl...    35   3.6
gi|47848387|dbj|BAD22246.1| hydroxyproline-rich glycoprotein-lik...    35   3.6
gi|9630970|ref|NP_047640.1| mucin-like protein [Lymantria dispar...    35   3.6
gi|47123082|gb|AAH70750.1| MGC83760 protein [Xenopus laevis]           35   3.6
gi|5420387|emb|CAB46679.1| proteophosphoglycan [Leishmania major]      35   3.6
gi|10764328|gb|AAG22661.1| mutated NS5A [synthetic construct] >g...    35   3.6
gi|10764332|gb|AAG22663.1| mutated NS5A [synthetic construct]          35   3.6
gi|2134123|pir||I51618 nucleolar phosphoprotein - African clawed...    35   3.6
gi|15644709|ref|NP_206879.1| outer membrane protein (omp3) [Heli...    34   4.7
gi|50551141|ref|XP_503044.1| hypothetical protein [Yarrowia lipo...    34   4.7
gi|19746910|ref|NP_608046.1| C5A peptidase precursor [Streptococ...    34   4.7
gi|15600724|ref|NP_254218.1| TonB protein [Pseudomonas aeruginos...    34   4.7
gi|1666536|gb|AAB18654.1| TonB [Pseudomonas aeruginosa]                34   4.7
gi|8163651|gb|AAF73783.1| surface protein PspC [Streptococcus pn...    34   4.7
gi|47208228|emb|CAF96470.1| unnamed protein product [Tetraodon n...    34   4.7
gi|8163670|gb|AAF73793.1| surface protein PspC [Streptococcus pn...    34   4.7
gi|25055226|gb|AAC44102.3| streptococcal surface protein B precu...    34   4.7
gi|18043435|gb|AAH19977.1| BC019977 protein [Mus musculus]             34   4.7
gi|46321608|ref|ZP_00221984.1| hypothetical protein Bucepa020034...    34   4.7
gi|50254707|gb|EAL17453.1| hypothetical protein CNBM1460 [Crypto...    34   4.7
gi|1351100|sp|P21979|SPAA_STRDO Cell surface antigen I/II precur...    34   4.7
gi|31213393|ref|XP_315640.1| ENSANGP00000023487 [Anopheles gambi...    34   4.7
gi|29248573|gb|EAA40103.1| GLP_80_3824_4984 [Giardia lamblia ATC...    34   4.7
gi|283442|pir||A40215 TcD antigen - Trypanosoma cruzi                  34   4.7
gi|17375734|sp|O14976|GAK_HUMAN Cyclin G-associated kinase             34   4.7
gi|4885251|ref|NP_005246.1| cyclin G associated kinase [Homo sap...    34   4.7
gi|32406198|ref|XP_323712.1| hypothetical protein [Neurospora cr...    34   4.7
gi|22788859|ref|NP_690573.1| hypothetical protein HZV_154 [Helio...    34   4.7
gi|25404764|pir||D96711 hypothetical protein F24J5.8 [imported] ...    34   4.7
gi|42569297|ref|NP_180077.3| formin homology 2 domain-containing...    34   4.7
gi|19549234|gb|AAL90887.1| Tcc1j12.1 [Trypanosoma cruzi]               34   4.7
gi|17505593|ref|NP_493082.1| putative nuclear protein (1M803) [C...    34   4.7
gi|37574595|gb|AAQ93074.1| putative TIR-NBS type R protein 4 [Ma...    34   4.7
gi|17544468|ref|NP_503037.1| intersectin 2 (4S71) [Caenorhabditi...    34   4.7
gi|39104508|dbj|BAC65744.3| mKIAA1187 protein [Mus musculus]           34   4.7
gi|38566922|emb|CAE76225.1| related to putative cytoplasmic stru...    34   4.7
gi|31542192|ref|NP_659190.2| cDNA sequence BC019977 [Mus musculu...    34   4.7
gi|8163634|gb|AAF73774.1| surface protein PspC [Streptococcus pn...    34   4.7
gi|25412275|pir||F84643 hypothetical protein At2g25050 [imported...    34   4.7
gi|46109630|ref|XP_381873.1| hypothetical protein FG01697.1 [Gib...    34   4.7
gi|28849875|ref|NP_789826.1| septin-like protein; E-septin [Ratt...    34   4.7
gi|24650617|ref|NP_651560.1| CG6599-PA [Drosophila melanogaster]...    34   4.7
gi|32419136|ref|XP_330046.1| hypothetical protein [Neurospora cr...    34   4.7
gi|34913568|ref|NP_918131.1| OSJNBa0086A10.14 [Oryza sativa (jap...    34   4.7
gi|47940064|gb|AAH71556.1| TTBK2 protein [Homo sapiens]                34   6.1
gi|50757953|ref|XP_425375.1| PREDICTED: similar to KIAA1917 prot...    34   6.1
gi|47077205|dbj|BAD18523.1| unnamed protein product [Homo sapiens]     34   6.1
gi|7493779|pir||T03276 GAG protein - yeast (Candida albicans) re...    34   6.1
gi|9629749|ref|NP_045241.1| 24 [Equine herpesvirus 4] >gnl|BL_OR...    34   6.1
gi|29841477|gb|AAP06509.1| similar to GenBank Accession Number U...    34   6.1
gi|49079612|ref|XP_403432.1| hypothetical protein UM05817.1 [Ust...    34   6.1
gi|7497997|pir||T29187 hypothetical protein C55C3.3 - Caenorhabd...    34   6.1
gi|8163672|gb|AAF73794.1| surface protein PspC [Streptococcus pn...    34   6.1
gi|50549423|ref|XP_502182.1| hypothetical protein [Yarrowia lipo...    34   6.1
gi|50257987|gb|EAL20681.1| hypothetical protein CNBE0460 [Crypto...    34   6.1
gi|34863265|ref|XP_236194.2| similar to All-1 protein +GTE form ...    34   6.1
gi|22748665|ref|NP_689504.1| mucin 7, salivary [Homo sapiens] >g...    34   6.1
gi|1575515|gb|AAC47461.1| thrombospondin-related anonymous prote...    34   6.1
gi|32411157|ref|XP_326059.1| predicted protein [Neurospora crass...    34   6.1
gi|1354739|gb|AAB53565.1| non-structural 5a protein                    34   6.1
gi|39597796|emb|CAE68488.1| Hypothetical protein CBG14291 [Caeno...    34   6.1
gi|13540395|gb|AAK29451.1| histone H1 [Pisum sativum]                  34   6.1
gi|25144817|ref|NP_500847.2| putative nuclear protein (55.4 kD) ...    34   6.1
gi|46433099|gb|EAK92553.1| hypothetical protein CaO19.702 [Candi...    34   6.1
gi|45552413|ref|NP_995729.1| CG33316-PA [Drosophila melanogaster...    34   6.1
gi|15425681|dbj|BAB64297.1| I-connectin [Procambarus clarkii]          34   6.1
gi|28466991|ref|NP_775771.2| tau tubulin kinase 2; tau-tubulin k...    34   6.1
gi|49022852|dbj|BAC65697.2| mKIAA0991 protein [Mus musculus]           34   6.1
gi|629892|pir||JC2301 hypothetical 47.8K protein - Pneumocystis ...    34   6.1
gi|46227969|gb|EAK88889.1| very low complexity large protein, po...    34   6.1
gi|39590923|emb|CAE58703.1| Hypothetical protein CBG01887 [Caeno...    34   6.1
gi|46226797|gb|EAK87763.1| domain similar to KOG0260, KOG1984, K...    34   6.1
gi|37574599|gb|AAQ93076.1| putative TIR-NBS type R protein 4 [Ma...    34   6.1
gi|28204888|gb|AAH46524.1| Sept9 protein [Mus musculus]                34   6.1
gi|1098357|prf||2115409A shk1 gene                                     34   6.1
gi|38105170|gb|EAA51628.1| hypothetical protein MG03223.4 [Magna...    34   6.1
gi|22956856|ref|ZP_00004589.1| COG0206: Cell division GTPase [Rh...    34   6.1
gi|10764234|gb|AAG22614.1| mutated NS5A [synthetic construct]          34   6.1
gi|4240183|dbj|BAA74870.1| KIAA0847 protein [Homo sapiens]             34   6.1
gi|21483204|gb|AAM52577.1| AT07927p [Drosophila melanogaster]          34   6.1
gi|10644267|gb|AAG21206.1| polyprotein [Hepatitis C virus type 1a]     34   6.1
gi|45552415|ref|NP_995730.1| CG33316-PB [Drosophila melanogaster...    34   6.1
gi|2130467|pir||S60170 protein kinase Pak1 - fission yeast (Schi...    34   6.1
gi|19113418|ref|NP_596626.1| serine-threonine protein kinase pak...    34   6.1
gi|49119281|gb|AAH73328.1| XNopp180 protein [Xenopus laevis]           33   8.0
gi|24655474|ref|NP_647640.1| CG7967-PA [Drosophila melanogaster]...    33   8.0
gi|32566087|ref|NP_502685.2| putative protein family member, wit...    33   8.0
gi|7715551|gb|AAF68093.1| PspA [Streptococcus pneumoniae]              33   8.0
gi|16078238|ref|NP_389055.1| yjbX [Bacillus subtilis subsp. subt...    33   8.0
gi|2764670|emb|CAA04971.1| pbp2 [Streptomyces clavuligerus]            33   8.0
gi|3220006|sp|P16952|SSP5_STRGN Agglutinin receptor precursor (S...    33   8.0
gi|46121439|ref|XP_385274.1| hypothetical protein FG05098.1 [Gib...    33   8.0
gi|46134181|ref|XP_389406.1| hypothetical protein FG09230.1 [Gib...    33   8.0
gi|6469855|gb|AAF13460.1| unknown [Streptococcus pneumoniae]           33   8.0
gi|6651073|gb|AAF22163.1| disintegrin and metalloproteinase doma...    33   8.0
gi|45642961|gb|AAS72375.1| acyl-CoA:cholesterol acyltransferase ...    33   8.0
gi|21999512|gb|AAM81600.1| fibronectin-binding protein precursor...    33   8.0
gi|15900059|ref|NP_344663.1| pneumococcal surface protein A [Str...    33   8.0
gi|97885|pir||A35186 salivary agglutinin receptor precursor - St...    33   8.0
gi|37522221|ref|NP_925598.1| translation initiation factor IF-2 ...    33   8.0
gi|25056007|gb|AAD55980.2| extensin-like protein [Zea mays]            33   8.0
gi|15925493|ref|NP_373027.1| fibronectin-binding protein homolog...    33   8.0
gi|46434071|gb|EAK93492.1| hypothetical protein CaO19.2375 [Cand...    33   8.0
gi|32469503|ref|NP_862904.1| epidermodysplasia verruciformis 2; ...    33   8.0
gi|33355709|gb|AAP69879.1| transmembrane channel-like protein 8 ...    33   8.0
gi|31088272|gb|AAP44166.1| bifuntional autolysin precursor [Stap...    33   8.0
gi|15612481|ref|NP_224134.1| putative [Helicobacter pylori J99] ...    33   8.0
gi|50730496|ref|XP_416932.1| PREDICTED: similar to KIAA1802 prot...    33   8.0
gi|47218736|emb|CAG05708.1| unnamed protein product [Tetraodon n...    33   8.0
gi|32421237|ref|XP_331062.1| predicted protein [Neurospora crass...    33   8.0
gi|48851146|ref|ZP_00305388.1| hypothetical protein Saro02001182...    33   8.0
gi|41054677|ref|NP_955846.1| Unknown (protein for MGC:65861); wu...    33   8.0
gi|39936144|ref|NP_948420.1| unknown protein [Rhodopseudomonas p...    33   8.0
gi|15924043|ref|NP_371577.1| autolysin [Staphylococcus aureus su...    33   8.0
gi|27370871|gb|AAH41236.1| XNopp180 protein [Xenopus laevis]           33   8.0
gi|23127731|ref|ZP_00109594.1| COG0532: Translation initiation f...    33   8.0
gi|46128185|ref|XP_388646.1| hypothetical protein FG08470.1 [Gib...    33   8.0
gi|30354146|gb|AAH52061.1| Laf4 protein [Mus musculus]                 33   8.0
gi|15926639|ref|NP_374172.1| autolysin [Staphylococcus aureus su...    33   8.0
gi|38074254|ref|XP_283603.2| lymphoid nuclear protein related to...    33   8.0
gi|15228870|ref|NP_191184.1| expressed protein [Arabidopsis thal...    33   8.0
gi|6752403|gb|AAF27712.1| PspA [Streptococcus pneumoniae]              33   8.0
gi|32398991|emb|CAD98456.1| formin-related protein, possible [Cr...    33   8.0
gi|45917291|ref|ZP_00196477.2| COG0206: Cell division GTPase [Me...    33   8.0
gi|50252361|dbj|BAD28468.1| BRI1-KD interacting protein 103 [Ory...    33   8.0
gi|42733462|dbj|BAD11328.1| BRI1-KD interacting protein 103 [Ory...    33   8.0
gi|10644128|gb|AAG21137.1| polyprotein [Hepatitis C virus type 1a]     33   8.0
gi|46106486|ref|ZP_00200007.1| COG0739: Membrane proteins relate...    33   8.0
gi|13473125|ref|NP_104692.1| unknown protein [Mesorhizobium loti...    33   8.0
gi|46127797|ref|XP_388452.1| hypothetical protein FG08276.1 [Gib...    33   8.0
gi|46127271|ref|XP_388189.1| hypothetical protein FG08013.1 [Gib...    33   8.0


>gi|17533957|ref|NP_494246.1| putative nuclear protein (38.9 kD)
            (2C628) [Caenorhabditis elegans]
 gi|6554020|gb|AAF16619.1| Hypothetical protein F43C11.9
            [Caenorhabditis elegans]
          Length = 339

 Score =  636 bits (1640), Expect = 0.0
 Identities = 320/339 (94%), Positives = 320/339 (94%)
 Frame = -1

Query: 1020 MKIAKFTRINAHQVQNCNNEKIAHERKMEKVFEFLAEDKKTFEASNSFERTLIFCKHDKS 841
            MKIAKFTRINAHQVQNCNNEKIAHERKMEKVFEFLAEDKKTFEASNSFERTLIFCKHDKS
Sbjct: 1    MKIAKFTRINAHQVQNCNNEKIAHERKMEKVFEFLAEDKKTFEASNSFERTLIFCKHDKS 60

Query: 840  AMAALLTLYDSKTIFGTFSEYLITNDKTVLERERVQVNNGEKMLAICNMDFMDDFQLGLA 661
            AMAALLTLYDSKTIFGTFSEYLITNDKTVLERERVQVNNGEKMLAICNMDFMDDFQLGLA
Sbjct: 61   AMAALLTLYDSKTIFGTFSEYLITNDKTVLERERVQVNNGEKMLAICNMDFMDDFQLGLA 120

Query: 660  KHYIFLDFPLKIIGIKKMLDRLNTMAQQSEQVIDIDFLTTNMDARIYQEALNMEMTMRGS 481
            KHYIFLDFPLKIIGIKKMLDRLNTMAQQSEQVIDIDFLTTNMDARIYQEALNMEMTMRGS
Sbjct: 121  KHYIFLDFPLKIIGIKKMLDRLNTMAQQSEQVIDIDFLTTNMDARIYQEALNMEMTMRGS 180

Query: 480  QVPKWLTELVNGSSELPEDPDVIFVRTCKPDLEPLTAKPAKLPSPRQPESKPSNEASSSQ 301
            QVPKWLTELVNGSSELPEDPDVIFVRTCKPDLEPLTAKPAKLPSPRQPESKPSNEASSSQ
Sbjct: 181  QVPKWLTELVNGSSELPEDPDVIFVRTCKPDLEPLTAKPAKLPSPRQPESKPSNEASSSQ 240

Query: 300  LEPTSASQPPSRVDQILKSRSGLPTKDADSSSEVAPRKRKPKSPAFDIYNMKRQPDGTFL 121
            LEPTSASQPPSRVDQILKSRSGLPTKDADSSSEVAPRKRKPKSPAFDIYNMKRQPDGTFL
Sbjct: 241  LEPTSASQPPSRVDQILKSRSGLPTKDADSSSEVAPRKRKPKSPAFDIYNMKRQPDGTFL 300

Query: 120  IPSHVMGFCNXXXXXXXXXXXXXXXXXXXYNWMYKLDVW 4
            IPSHVMGFCN                   YNWMYKLDVW
Sbjct: 301  IPSHVMGFCNEDLSEDDEEPDPEYDSEEEYNWMYKLDVW 339




[DB home][top]