Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F43E2_7
(891 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|7503311|pir||T34042 hypothetical protein F43E2.10 - Caenorhab... 287 2e-76
gi|32564474|ref|NP_495541.2| putative nuclear protein family mem... 210 4e-53
gi|32564476|ref|NP_495542.2| putative nuclear protein, with a co... 186 6e-46
gi|7503312|pir||T34044 hypothetical protein F43E2.2 - Caenorhabd... 165 1e-39
gi|7503316|pir||T34043 hypothetical protein F43E2.6 - Caenorhabd... 129 7e-29
gi|17533967|ref|NP_495544.1| RNA polymerase II (2H665) [Caenorha... 124 2e-27
gi|17563202|ref|NP_505987.1| predicted CDS, ATP-dependent protea... 71 3e-11
gi|17559870|ref|NP_507884.1| predicted CDS, putative protein fam... 67 5e-10
gi|17566454|ref|NP_507882.1| ATP-dependent protease family membe... 64 3e-09
gi|15789580|ref|NP_279404.1| lipoate protein ligase; Lon [Haloba... 59 2e-07
gi|41615139|ref|NP_963637.1| NEQ349 [Nanoarchaeum equitans Kin4-... 57 5e-07
gi|45521183|ref|ZP_00172705.1| COG0466: ATP-dependent Lon protea... 57 5e-07
gi|15794311|ref|NP_284133.1| putative ATP-dependent protease [Ne... 54 4e-06
gi|15677103|ref|NP_274255.1| ATP-dependent protease La [Neisseri... 54 5e-06
gi|37525708|ref|NP_929052.1| hypothetical protein [Photorhabdus ... 54 5e-06
gi|45358749|ref|NP_988306.1| Eukaryotic thiol (cysteine) proteas... 54 5e-06
gi|48851991|ref|ZP_00306184.1| COG1067: Predicted ATP-dependent ... 54 5e-06
gi|15594958|ref|NP_212747.1| ATP-dependent protease LA (lon-2) [... 53 8e-06
gi|48764650|ref|ZP_00269201.1| COG0466: ATP-dependent Lon protea... 53 8e-06
gi|14590366|ref|NP_142432.1| ATP-dependent protease La [Pyrococc... 53 1e-05
gi|16082106|ref|NP_394540.1| ATP-dependent proteinase La (Lon) r... 53 1e-05
gi|41689085|ref|ZP_00145620.1| COG0466: ATP-dependent Lon protea... 52 1e-05
gi|28211965|ref|NP_782909.1| ATP-dependent protease La homolog [... 52 1e-05
gi|42629500|ref|ZP_00155046.1| COG1067: Predicted ATP-dependent ... 52 1e-05
gi|7644385|gb|AAF65564.1| protease Lon [Pseudomonas fluorescens] 52 2e-05
gi|48729866|ref|ZP_00263615.1| COG0466: ATP-dependent Lon protea... 52 2e-05
gi|11497976|ref|NP_069200.1| ATP-dependent protease La (lon) [Ar... 52 2e-05
gi|13541325|ref|NP_111013.1| Predicted ATP-dependent protease [T... 52 2e-05
gi|46133510|ref|ZP_00157312.2| COG1067: Predicted ATP-dependent ... 52 2e-05
gi|22532108|gb|AAM97840.1| Lon protease [Pseudomonas syringae] 51 3e-05
gi|28870879|ref|NP_793498.1| ATP-dependent protease La [Pseudomo... 51 3e-05
gi|16273234|ref|NP_439475.1| lon protease [Haemophilus influenza... 51 3e-05
gi|29654074|ref|NP_819766.1| ATP-dependent protease La [Coxiella... 51 3e-05
gi|23469165|ref|ZP_00124500.1| COG0466: ATP-dependent Lon protea... 51 3e-05
gi|46192102|ref|ZP_00007427.2| COG0466: ATP-dependent Lon protea... 51 3e-05
gi|49474141|ref|YP_032183.1| ATP-dependent protease lon [Bartone... 51 3e-05
gi|42526185|ref|NP_971283.1| ATP-dependent protease La [Treponem... 51 4e-05
gi|41720021|ref|ZP_00148860.1| COG1067: Predicted ATP-dependent ... 51 4e-05
gi|14521780|ref|NP_127256.1| ATP-dependent protease La [Pyrococc... 51 4e-05
gi|48867821|ref|ZP_00321253.1| COG1067: Predicted ATP-dependent ... 50 5e-05
gi|23103565|ref|ZP_00090045.1| COG0466: ATP-dependent Lon protea... 50 5e-05
gi|48478307|ref|YP_024013.1| ATP-dependent protease La [Picrophi... 50 5e-05
gi|15669607|ref|NP_248420.1| ATP-dependent protease LA, putative... 50 5e-05
gi|49475382|ref|YP_033423.1| ATP-dependent protease lon [Bartone... 50 5e-05
gi|48727705|gb|AAT46132.1| Lon protease [Bartonella henselae] 50 5e-05
gi|45440717|ref|NP_992256.1| putative Lon protease [Yersinia pes... 50 5e-05
gi|16121710|ref|NP_405023.1| putative Lon protease [Yersinia pes... 50 5e-05
gi|15888590|ref|NP_354271.1| AGR_C_2329p [Agrobacterium tumefaci... 50 9e-05
gi|18976839|ref|NP_578196.1| ATP-dependent protease LA [Pyrococc... 50 9e-05
gi|21241840|ref|NP_641422.1| ATP-dependent serine proteinase La ... 49 1e-04
gi|21623554|dbj|BAC00917.1| ATP-dependent protease Lon [Thermoco... 49 1e-04
gi|23501984|ref|NP_698111.1| ATP-dependent protease La [Brucella... 49 1e-04
gi|48831504|ref|ZP_00288566.1| COG0466: ATP-dependent Lon protea... 49 1e-04
gi|48838604|ref|ZP_00295545.1| COG1067: Predicted ATP-dependent ... 49 1e-04
gi|15602348|ref|NP_245420.1| unknown [Pasteurella multocida Pm70... 49 1e-04
gi|21230441|ref|NP_636358.1| ATP-dependent serine proteinase La ... 49 1e-04
gi|15893747|ref|NP_347096.1| ATP-dependent protease (lonA) [Clos... 49 1e-04
gi|46132214|ref|ZP_00170630.2| COG0466: ATP-dependent Lon protea... 49 1e-04
gi|22124936|ref|NP_668359.1| DNA-binding ATP-dependent protease ... 49 1e-04
gi|49235685|ref|ZP_00329751.1| COG1067: Predicted ATP-dependent ... 49 1e-04
gi|16123317|ref|NP_406630.1| ATP-dependent protease La [Yersinia... 49 1e-04
gi|34498010|ref|NP_902225.1| endopeptidase La [Chromobacterium v... 49 2e-04
gi|48772677|ref|ZP_00277019.1| COG0466: ATP-dependent Lon protea... 49 2e-04
gi|46140509|ref|ZP_00152053.2| COG0466: ATP-dependent Lon protea... 49 2e-04
gi|21226230|ref|NP_632152.1| ATP-dependent protease La [Methanos... 49 2e-04
gi|30248064|ref|NP_840134.1| lon; ATP-dependent protease la prot... 49 2e-04
gi|20092104|ref|NP_618179.1| endopeptidase La [Methanosarcina ac... 48 3e-04
gi|48849861|ref|ZP_00304104.1| COG0466: ATP-dependent Lon protea... 48 3e-04
gi|27904900|ref|NP_778026.1| ATP-dependent protease La [Buchnera... 48 3e-04
gi|15597000|ref|NP_250494.1| Lon protease [Pseudomonas aeruginos... 48 3e-04
gi|21672726|ref|NP_660793.1| ATP-dependent protease LA [Buchnera... 48 3e-04
gi|17987159|ref|NP_539793.1| ATP-DEPENDENT PROTEASE LA [Brucella... 48 3e-04
gi|3913991|sp|O52605|LON_BRUAB ATP-dependent protease La >gnl|BL... 48 3e-04
gi|38257878|sp|Q8YHC6|LON_BRUME ATP-dependent protease La 48 3e-04
gi|15965010|ref|NP_385363.1| PROBABLE ATP-DEPENDENT PROTEASE LA ... 48 3e-04
gi|34558260|ref|NP_908075.1| PUTATIVE ATP-DEPENDENT PROTEASE LA ... 48 3e-04
gi|32041877|ref|ZP_00139460.1| COG0466: ATP-dependent Lon protea... 48 3e-04
gi|48783891|ref|ZP_00280272.1| COG0466: ATP-dependent Lon protea... 47 4e-04
gi|26989026|ref|NP_744451.1| ATP-dependent protease La [Pseudomo... 47 4e-04
gi|15603843|ref|NP_246917.1| Lon [Pasteurella multocida Pm70] >g... 47 4e-04
gi|13476996|ref|NP_108566.1| ATP-dependent protease Lon [Mesorhi... 47 4e-04
gi|1170812|sp|P46067|LON_ERWAM ATP-dependent protease La >gnl|BL... 47 4e-04
gi|15835238|ref|NP_296997.1| protease, Lon family [Chlamydia mur... 47 6e-04
gi|50877810|emb|CAG37650.1| probable ATP-dependent protease La [... 47 6e-04
gi|42520202|ref|NP_966117.1| ATP-dependent protease La [Wolbachi... 47 6e-04
gi|6175841|gb|AAF05300.1| Lon protease [Sinorhizobium meliloti] 47 6e-04
gi|15641922|ref|NP_231554.1| ATP-dependent protease LA [Vibrio c... 47 6e-04
gi|46315401|ref|ZP_00215983.1| COG0466: ATP-dependent Lon protea... 47 6e-04
gi|46156829|ref|ZP_00132081.2| COG1067: Predicted ATP-dependent ... 47 6e-04
gi|21229220|ref|NP_635142.1| ATP-dependent protease La [Methanos... 47 6e-04
gi|23467225|ref|ZP_00122808.1| COG1067: Predicted ATP-dependent ... 47 6e-04
gi|15605067|ref|NP_219851.1| Lon ATP-dependent protease [Chlamyd... 47 7e-04
gi|33596624|ref|NP_884267.1| ATP-dependent protease La [Bordetel... 47 7e-04
gi|33601239|ref|NP_888799.1| ATP-dependent protease La [Bordetel... 47 7e-04
gi|33592844|ref|NP_880488.1| ATP-dependent protease La [Bordetel... 47 7e-04
gi|50120089|ref|YP_049256.1| ATP-dependent protease la [Erwinia ... 47 7e-04
gi|46205293|ref|ZP_00048730.2| COG0466: ATP-dependent Lon protea... 47 7e-04
gi|17546432|ref|NP_519834.1| PROBABLE ATP-DEPENDENT PROTEASE LA ... 47 7e-04
gi|46370656|ref|ZP_00219134.2| COG0466: ATP-dependent Lon protea... 47 7e-04
gi|23467996|ref|ZP_00123570.1| COG0466: ATP-dependent Lon protea... 47 7e-04
gi|46156600|ref|ZP_00132426.2| COG0466: ATP-dependent Lon protea... 47 7e-04
gi|48860706|ref|ZP_00314616.1| COG0466: ATP-dependent Lon protea... 46 0.001
gi|15615613|ref|NP_243917.1| ATP-dependent proteinase La [Bacill... 46 0.001
gi|15639514|ref|NP_218964.1| ATP-dependent protease LA (lon-2) [... 46 0.001
gi|37527727|ref|NP_931072.1| endopeptidase La, DNA-binding, ATP-... 46 0.001
gi|11095432|gb|AAG29872.1| partial ATP-dependent protease Lon [Z... 46 0.001
gi|15895404|ref|NP_348753.1| ATP-dependent serine protease LA/LO... 46 0.001
gi|146642|gb|AAA24078.1| protease La (lon) 46 0.001
gi|15892552|ref|NP_360266.1| ATP-dependent protease La [EC:3.4.2... 46 0.001
gi|146644|gb|AAA24079.1| ATP-dependent proteinase (lon) 46 0.001
gi|23111523|ref|ZP_00097154.1| COG1067: Predicted ATP-dependent ... 46 0.001
gi|3913995|sp|P77810|LON_AZOBR ATP-dependent protease La >gnl|BL... 46 0.001
gi|27365921|ref|NP_761449.1| Predicted ATP-dependent protease [V... 46 0.001
gi|40889706|pdb|1RR9|A Chain A, Catalytic Domain Of E.Coli Lon P... 46 0.001
gi|26246450|ref|NP_752489.1| ATP-dependent protease La [Escheric... 46 0.001
gi|15800169|ref|NP_286181.1| DNA-binding, ATP-dependent protease... 46 0.001
gi|34580457|ref|ZP_00141937.1| ATP-dependent protease La [Ricket... 46 0.001
gi|24111823|ref|NP_706333.1| ATP-dependent protease LA [Shigella... 46 0.001
gi|42453761|ref|ZP_00153668.1| hypothetical protein Rick062401 [... 46 0.001
gi|18311033|ref|NP_562967.1| probable ATP-dependent proteinase [... 46 0.001
gi|30061941|ref|NP_836112.1| DNA-binding, ATP-dependent protease... 46 0.001
gi|16759430|ref|NP_455047.1| Lon protease [Salmonella enterica s... 46 0.001
gi|15829747|ref|NP_308520.1| endopeptidase La [Escherichia coli ... 46 0.001
gi|15604315|ref|NP_220831.1| ATP-DEPENDENT PROTEASE LA (lon) [R... 46 0.001
gi|16128424|ref|NP_414973.1| DNA-binding, ATP-dependent protease... 46 0.001
gi|16763831|ref|NP_459446.1| ATP-dependent protease Lon [Salmone... 46 0.001
gi|28209884|ref|NP_780828.1| ATP-dependent protease LA [Clostrid... 45 0.002
gi|15617075|ref|NP_240288.1| ATP-dependent protease LA [Buchnera... 45 0.002
gi|20090712|ref|NP_616787.1| endopeptidase La [Methanosarcina ac... 45 0.002
gi|46143236|ref|ZP_00135629.2| COG0466: ATP-dependent Lon protea... 45 0.002
gi|33152266|ref|NP_873619.1| ATP-dependent protease LA [Haemophi... 45 0.002
gi|28898364|ref|NP_797969.1| ATP-dependent protease LA-related p... 45 0.002
gi|42543595|pdb|1RRE|A Chain A, Crystal Structure Of E.Coli Lon ... 45 0.002
gi|15806972|ref|NP_295697.1| ATP-dependent protease LA [Deinococ... 45 0.002
gi|304908|gb|AAA16837.1| ATP-dependent protease 45 0.002
gi|28897693|ref|NP_797298.1| ATP-dependent protease LA [Vibrio p... 45 0.003
gi|45915684|ref|ZP_00194398.2| COG0466: ATP-dependent Lon protea... 45 0.003
gi|50875019|emb|CAG34859.1| probable ATP-dependent protease La [... 45 0.003
gi|48868634|ref|ZP_00321944.1| COG0466: ATP-dependent Lon protea... 44 0.004
gi|1655939|gb|AAC44747.1| lon protease [Vibrio parahaemolyticus] 44 0.004
gi|48838047|ref|ZP_00294997.1| COG0466: ATP-dependent Lon protea... 44 0.004
gi|23509368|ref|NP_702035.1| ATP-dependent protease, putative [P... 44 0.004
gi|49236837|ref|ZP_00330893.1| COG0466: ATP-dependent Lon protea... 44 0.004
gi|23474552|ref|ZP_00129845.1| COG0466: ATP-dependent Lon protea... 44 0.005
gi|37679290|ref|NP_933899.1| ATP-dependent Lon protease, bacteri... 44 0.005
gi|15617951|ref|NP_224235.1| Lon ATP-dependent Protease [Chlamyd... 44 0.005
gi|15896947|ref|NP_350296.1| Lon-like ATP-dependent protease [Cl... 44 0.005
gi|32408273|ref|XP_324618.1| hypothetical protein [Neurospora cr... 44 0.005
gi|42630758|ref|ZP_00156297.1| COG0466: ATP-dependent Lon protea... 44 0.005
gi|42629917|ref|ZP_00155462.1| COG0466: ATP-dependent Lon protea... 44 0.005
gi|16272410|ref|NP_438623.1| ATP-dependent proteinase [Haemophil... 44 0.005
gi|24373422|ref|NP_717465.1| hypothetical ATP-dependent protease... 44 0.005
gi|15594598|ref|NP_212387.1| ATP-dependent protease LA (lon-1) [... 44 0.006
gi|46202361|ref|ZP_00053340.2| COG0466: ATP-dependent Lon protea... 44 0.006
gi|15895896|ref|NP_349245.1| Lon-like ATP-dependent protease [Cl... 44 0.006
gi|23113693|ref|ZP_00099048.1| COG0466: ATP-dependent Lon protea... 44 0.006
gi|47575024|ref|ZP_00245059.1| COG0466: ATP-dependent Lon protea... 43 0.008
gi|17537985|ref|NP_496538.1| predicted CDS, putative membrane pr... 43 0.008
gi|15678809|ref|NP_275926.1| ATP-dependent protease LA [Methanot... 43 0.008
gi|23509035|ref|NP_701703.1| hypothetical protein [Plasmodium fa... 43 0.008
gi|547865|sp|P36772|LON_BRECH ATP-dependent protease La >gnl|BL_... 43 0.011
gi|15641491|ref|NP_231123.1| ATP-dependent protease LA-related p... 43 0.011
gi|22972994|ref|ZP_00019842.1| hypothetical protein [Chloroflexu... 43 0.011
gi|29840084|ref|NP_829190.1| ATP-dependent protease La [Chlamydo... 43 0.011
gi|6322824|ref|NP_012897.1| TFIIE large subunit, involved in rec... 43 0.011
gi|1667399|gb|AAB18765.1| lon protease [Caulobacter crescentus] 43 0.011
gi|16126203|ref|NP_420767.1| ATP-dependent protease LA [Caulobac... 43 0.011
gi|27363509|ref|NP_759037.1| ATP-dependent Lon protease, bacteri... 43 0.011
gi|50877425|emb|CAG37265.1| probable ATP-dependent protease La [... 42 0.014
gi|46308165|ref|ZP_00210360.1| COG0466: ATP-dependent Lon protea... 42 0.014
gi|20807121|ref|NP_622292.1| ATP-dependent Lon protease, bacteri... 42 0.014
gi|24112367|ref|NP_706877.1| putative ATP-dependent protease [Sh... 42 0.018
gi|454438|gb|AAA53625.1| LON gene of S. cerevisiae is downstream... 42 0.018
gi|30062492|ref|NP_836663.1| putative ATP-dependent protease [Sh... 42 0.018
gi|6319449|ref|NP_009531.1| mitochondrial ATP-dependent protease... 42 0.018
gi|17542534|ref|NP_502646.1| ATP-dependent protease LA like fami... 42 0.018
gi|50365222|ref|YP_053647.1| class III heat shock DNA-binding AT... 42 0.018
gi|50120682|ref|YP_049849.1| conserved hypothetical protein [Erw... 42 0.018
gi|46198726|ref|YP_004393.1| ATP-dependent protease La [Thermus ... 42 0.018
gi|22969996|ref|ZP_00017173.1| hypothetical protein [Chloroflexu... 42 0.024
gi|46136419|ref|XP_389901.1| hypothetical protein FG09725.1 [Gib... 42 0.024
gi|50085324|ref|YP_046834.1| putative ATP-dependent protease [Ac... 41 0.031
gi|22994399|ref|ZP_00038904.1| COG0466: ATP-dependent Lon protea... 41 0.031
gi|28198388|ref|NP_778702.1| ATP-dependent serine proteinase La ... 41 0.031
gi|22996221|ref|ZP_00040486.1| COG0466: ATP-dependent Lon protea... 41 0.031
gi|547861|sp|P36774|LON2_MYXXA ATP-dependent protease La 2 >gnl|... 41 0.031
gi|23485550|gb|EAA20470.1| DOMINO B-related [Plasmodium yoelii y... 41 0.031
gi|28211964|ref|NP_782908.1| ATP-dependent protease La [Clostrid... 41 0.031
gi|50084309|ref|YP_045819.1| DNA-binding ATP-dependent protease ... 41 0.031
gi|32266344|ref|NP_860376.1| ATP-dependent protease LA [Helicoba... 41 0.031
gi|15837791|ref|NP_298479.1| ATP-dependent serine proteinase La ... 41 0.031
gi|2959335|emb|CAA12120.1| Lon-protease [Acinetobacter sp. ADP1] 41 0.031
gi|46446096|ref|YP_007461.1| putative endopeptidase (ATP-depende... 41 0.031
gi|23474160|ref|ZP_00129455.1| COG0466: ATP-dependent Lon protea... 41 0.041
gi|16759949|ref|NP_455566.1| conserved hypothetical protein [Sal... 41 0.041
gi|16764427|ref|NP_460042.1| putative protease [Salmonella typhi... 41 0.041
gi|42541823|gb|AAS19619.1| LON1 protease [Triticum aestivum] 41 0.041
gi|39936024|ref|NP_948300.1| ATP-dependent protease Lon [Rhodops... 41 0.041
gi|19113947|ref|NP_593035.1| mitochondrial lon protease homolog ... 41 0.041
gi|46915465|emb|CAG22237.1| putative ATP-dependent protease LA-r... 41 0.041
gi|46914234|emb|CAG21014.1| putative ATP-dependent protease LA [... 41 0.041
gi|24373362|ref|NP_717405.1| ATP-dependent protease La [Shewanel... 41 0.041
gi|19705310|ref|NP_602805.1| ATP-dependent protease La [Fusobact... 41 0.041
gi|49097740|ref|XP_410330.1| hypothetical protein AN6193.2 [Aspe... 41 0.041
gi|18311617|ref|NP_563551.1| probable ATP-dependent proteinase L... 41 0.041
gi|15800814|ref|NP_286830.1| putative ATP-dependent protease [Es... 40 0.053
gi|26246976|ref|NP_753016.1| Putative protease La homolog [Esche... 40 0.053
gi|16128922|ref|NP_415475.1| putative ATP-dependent protease [Es... 40 0.053
gi|23099531|ref|NP_692997.1| ATP-dependent proteinase La 1 [Ocea... 40 0.053
gi|4062521|dbj|BAA35713.1| Lon protease (lon) homolog [Escherich... 40 0.053
gi|49078944|ref|XP_403173.1| hypothetical protein UM05558.1 [Ust... 40 0.053
gi|50308831|ref|XP_454420.1| unnamed protein product [Kluyveromy... 40 0.053
gi|39996889|ref|NP_952840.1| ATP-dependent protease La [Geobacte... 40 0.053
gi|3914005|sp|P93647|LON1_MAIZE Lon protease homolog 1, mitochon... 40 0.053
gi|31544578|ref|NP_853156.1| Lon [Mycoplasma gallisepticum R] >g... 40 0.053
gi|33519763|ref|NP_878595.1| Lon protease [Candidatus Blochmanni... 40 0.053
gi|16079873|ref|NP_390699.1| Lon-like ATP-dependent protease [Ba... 40 0.070
gi|28569594|gb|AAO43974.1| Lon protease [Brevibacillus thermoruber] 40 0.070
gi|39998283|ref|NP_954234.1| ATP-dependent protease La [Geobacte... 40 0.070
gi|42523611|ref|NP_968991.1| ATP-dependent protease LA [Bdellovi... 40 0.070
gi|32417062|ref|XP_329009.1| hypothetical protein [Neurospora cr... 40 0.070
gi|14423366|gb|AAK62365.1| Lon protease [Dichanthelium lanuginosum] 40 0.070
gi|23613424|ref|NP_703268.1| hypothetical protein [Plasmodium fa... 40 0.070
gi|48833362|ref|ZP_00290382.1| COG0466: ATP-dependent Lon protea... 40 0.091
gi|18310373|ref|NP_562307.1| Lon-like ATP-dependent protease [Cl... 40 0.091
gi|15599772|ref|NP_253266.1| probable ATP-dependent protease [Ps... 40 0.091
gi|46165027|ref|ZP_00138128.2| COG1067: Predicted ATP-dependent ... 40 0.091
gi|23105562|ref|ZP_00092018.1| COG1067: Predicted ATP-dependent ... 40 0.091
gi|27461708|gb|AAM95459.1| Lon protease [Oryza sativa (indica cu... 40 0.091
gi|15605788|ref|NP_213165.1| Lon protease [Aquifex aeolicus VF5]... 40 0.091
gi|50725794|dbj|BAD33324.1| putative Lon protease [Oryza sativa ... 40 0.091
gi|46913393|emb|CAG20181.1| Hypothetical ATP-dependent protease ... 40 0.091
gi|49236838|ref|ZP_00330894.1| COG1067: Predicted ATP-dependent ... 40 0.091
gi|45656506|ref|YP_000592.1| ATP-dependent protease La [Leptospi... 39 0.12
gi|24216295|ref|NP_713776.1| ATP-dependent Lon protease [Leptosp... 39 0.12
gi|15228859|ref|NP_188918.1| kinase interacting family protein [... 39 0.12
gi|41689526|ref|ZP_00146059.1| COG1067: Predicted ATP-dependent ... 39 0.12
gi|30248066|ref|NP_840136.1| putative ATP-dependent protease LA,... 39 0.12
gi|547860|sp|P36773|LON1_MYXXA ATP-dependent protease La 1 >gnl|... 39 0.12
gi|49084060|ref|XP_404259.1| hypothetical protein AN0122.2 [Aspe... 39 0.12
gi|20808190|ref|NP_623361.1| predicted ATP-dependent protease [T... 39 0.12
gi|33151430|ref|NP_872783.1| lon protease [Haemophilus ducreyi 3... 39 0.12
gi|15644612|ref|NP_229665.1| ATP-dependent protease LA, putative... 39 0.12
gi|9279697|dbj|BAB01254.1| centromere protein [Arabidopsis thali... 39 0.12
gi|48858837|ref|ZP_00312782.1| COG1067: Predicted ATP-dependent ... 39 0.12
gi|28871352|ref|NP_793971.1| ATP-dependent protease La [Pseudomo... 39 0.15
gi|23471258|ref|ZP_00126589.1| COG0466: ATP-dependent Lon protea... 39 0.15
gi|48846392|ref|ZP_00300655.1| COG0466: ATP-dependent Lon protea... 39 0.15
gi|38488737|ref|NP_942112.1| starmaker [Danio rerio] >gnl|BL_ORD... 39 0.15
gi|11094131|gb|AAG29566.1| p235 rhoptry protein [Plasmodium yoel... 39 0.15
gi|32490902|ref|NP_871156.1| lon [Wigglesworthia glossinidia end... 39 0.15
gi|27380053|ref|NP_771582.1| ATP-dependent protease LA [Bradyrhi... 39 0.15
gi|23509364|ref|NP_702031.1| hypothetical protein [Plasmodium fa... 39 0.15
gi|23613089|ref|NP_703411.1| hypothetical protein [Plasmodium fa... 39 0.15
gi|46441098|gb|EAL00398.1| hypothetical protein CaO19.13055 [Can... 39 0.15
gi|15895895|ref|NP_349244.1| ATP-dependent Lon protease [Clostri... 39 0.15
gi|46440978|gb|EAL00279.1| hypothetical protein CaO19.5612 [Cand... 39 0.20
gi|29829508|ref|NP_824142.1| putative lon class III heat-shock A... 39 0.20
gi|23486663|gb|EAA20861.1| strong similarity to unknown protein-... 39 0.20
gi|23482060|gb|EAA18154.1| rhoptry protein [Plasmodium yoelii yo... 39 0.20
gi|46199052|ref|YP_004719.1| ATP-dependent protease La [Thermus ... 39 0.20
gi|7458799|gb|AAB41263.3| rhoptry protein [Plasmodium yoelii] 39 0.20
gi|7494466|pir||T28676 rhoptry protein - Plasmodium yoelii (frag... 39 0.20
gi|23113695|ref|ZP_00099050.1| COG1067: Predicted ATP-dependent ... 39 0.20
gi|50425367|ref|XP_461277.1| unnamed protein product [Debaryomyc... 39 0.20
gi|160648|gb|AAA29749.1| rhoptry protein 39 0.20
gi|38111150|gb|EAA56768.1| hypothetical protein MG07123.4 [Magna... 38 0.26
gi|23507937|ref|NP_700607.1| hypothetical protein [Plasmodium fa... 38 0.26
gi|37676916|ref|NP_937312.1| predicted ATP-dependent protease [V... 38 0.26
gi|46437526|gb|EAK96871.1| hypothetical protein CaO19.448 [Candi... 38 0.26
gi|50290931|ref|XP_447898.1| unnamed protein product [Candida gl... 38 0.26
gi|46437578|gb|EAK96922.1| hypothetical protein CaO19.8078 [Cand... 38 0.26
gi|23618975|ref|NP_704937.1| hypothetical protein [Plasmodium fa... 38 0.26
gi|29346246|ref|NP_809749.1| ATP-dependent protease [Bacteroides... 38 0.26
gi|26987416|ref|NP_742841.1| ATP-dependent protease, putative [P... 38 0.26
gi|23508113|ref|NP_700783.1| hypothetical protein [Plasmodium fa... 38 0.26
gi|16805190|ref|NP_473218.1| hypothetical protein [Plasmodium fa... 38 0.26
gi|23508065|ref|NP_700735.1| hypothetical protein [Plasmodium fa... 38 0.26
gi|48844356|ref|ZP_00298672.1| COG0466: ATP-dependent Lon protea... 38 0.35
gi|50303359|ref|XP_451621.1| unnamed protein product [Kluyveromy... 38 0.35
gi|48728834|ref|ZP_00262588.1| COG1067: Predicted ATP-dependent ... 38 0.35
gi|46580302|ref|YP_011110.1| ATP-dependent protease, putative [D... 38 0.35
gi|28829612|gb|AAO52129.1| similar to Mus musculus (Mouse). Adul... 38 0.35
gi|42525197|ref|NP_970577.1| ATP-dependent protease La [Bdellovi... 38 0.35
gi|50260845|gb|EAL23495.1| hypothetical protein CNBA1420 [Crypto... 38 0.35
gi|28211304|ref|NP_782248.1| ATP-dependent protease La [Clostrid... 38 0.35
gi|45546867|ref|ZP_00186933.1| COG1067: Predicted ATP-dependent ... 38 0.35
gi|23509704|ref|NP_702371.1| hypothetical protein, conserved [Pl... 38 0.35
gi|15963374|emb|CAC88796.1| putative coat protein [Nicotiana tab... 37 0.45
gi|28871717|ref|NP_794336.1| ATP-dependent protease, putative [P... 37 0.45
gi|42560989|ref|NP_975440.1| endopeptidase La [Mycoplasma mycoid... 37 0.45
gi|45198327|ref|NP_985356.1| AFL194Wp [Eremothecium gossypii] >g... 37 0.45
gi|15963366|emb|CAC88790.1| putative coat protein [Nicotiana tab... 37 0.45
gi|48844757|ref|ZP_00299055.1| COG0466: ATP-dependent Lon protea... 37 0.45
gi|15963357|emb|CAC88783.1| putative coat protein [Nicotiana tab... 37 0.45
gi|4775494|emb|CAB42620.1| putative coat protein [Nicotiana taba... 37 0.45
gi|48096232|ref|XP_392415.1| similar to ENSANGP00000021340 [Apis... 37 0.45
gi|3114756|emb|CAA76672.1| protease La [Campylobacter jejuni] 37 0.45
gi|15792398|ref|NP_282221.1| ATP-dependent protease La [Campylob... 37 0.45
gi|21402517|ref|NP_658502.1| AAA, ATPase family associated with ... 37 0.45
gi|30022559|ref|NP_834190.1| ATP-dependent protease La [Bacillus... 37 0.45
gi|32034243|ref|ZP_00134454.1| COG1067: Predicted ATP-dependent ... 37 0.45
gi|50427959|ref|XP_462592.1| unnamed protein product [Debaryomyc... 37 0.45
gi|23619085|ref|NP_705047.1| hypothetical protein [Plasmodium fa... 37 0.45
gi|13508071|ref|NP_110020.1| ATP-dependent protease Lon [Mycopla... 37 0.45
gi|46444457|gb|EAL03732.1| hypothetical protein CaO19.9151 [Cand... 37 0.45
gi|23510186|ref|NP_702852.1| hypothetical protein [Plasmodium fa... 37 0.45
gi|47566661|ref|ZP_00237483.1| ATP-dependent protease La [Bacill... 37 0.45
gi|42783608|ref|NP_980855.1| ATP-dependent protease LA [Bacillus... 37 0.45
gi|30264539|ref|NP_846916.1| ATP-dependent protease LA [Bacillus... 37 0.45
gi|23470878|ref|ZP_00126210.1| COG1067: Predicted ATP-dependent ... 37 0.59
gi|27596796|gb|AAO20877.1| merozoite surface protein 3 alpha [Pl... 37 0.59
gi|30385552|gb|AAP24052.1| merozoite surface protein-3a [Plasmod... 37 0.59
gi|23509548|ref|NP_702215.1| hypothetical protein [Plasmodium fa... 37 0.59
gi|46579602|ref|YP_010410.1| ATP-dependent protease La, putative... 37 0.59
gi|30385554|gb|AAP24054.1| merozoite surface protein-3a [Plasmod... 37 0.59
gi|49068784|ref|XP_398681.1| hypothetical protein UM01066.1 [Ust... 37 0.59
gi|21223651|ref|NP_629430.1| ATP-dependent protease [Streptomyce... 37 0.59
gi|48730255|ref|ZP_00264003.1| COG0466: ATP-dependent Lon protea... 37 0.59
gi|23509537|ref|NP_702204.1| hypothetical protein [Plasmodium fa... 37 0.59
gi|23509944|ref|NP_702611.1| hypothetical protein [Plasmodium fa... 37 0.59
gi|13195256|gb|AAK15625.1| 235 kDa rhoptry protein [Plasmodium y... 37 0.59
gi|23489763|gb|EAA21695.1| ring-infested erythrocyte surface ant... 37 0.77
gi|15963382|emb|CAC88802.1| putative coat protein [Nicotiana tab... 37 0.77
gi|13195258|gb|AAK15626.1| 235 kDa rhoptry protein [Plasmodium y... 37 0.77
gi|23509831|ref|NP_702498.1| hypothetical protein [Plasmodium fa... 37 0.77
gi|7494465|pir||T28677 rhoptry protein - Plasmodium yoelii >gnl|... 37 0.77
gi|11094129|gb|AAG29565.1| p235 rhoptry protein [Plasmodium yoel... 37 0.77
gi|23480265|gb|EAA16872.1| 235 kDa rhoptry protein [Plasmodium y... 37 0.77
gi|23487197|gb|EAA20995.1| hypothetical protein [Plasmodium yoel... 37 0.77
gi|42525077|ref|NP_970457.1| ATP-dependent protease LA [Bdellovi... 37 0.77
gi|39938934|ref|NP_950700.1| ATP-dependent Lon protease [Onion y... 37 0.77
gi|2326803|emb|CAA72066.1| 235kDa rhoptry protein [Plasmodium yo... 37 0.77
gi|23488974|gb|EAA21451.1| rhoptry protein-related [Plasmodium y... 37 0.77
gi|50556978|ref|XP_505897.1| hypothetical protein [Yarrowia lipo... 37 0.77
gi|160652|gb|AAA29751.1| rhoptry protein 37 0.77
gi|16805032|ref|NP_473061.1| Ser/Thr protein kinase, putative [P... 37 0.77
gi|46436135|gb|EAK95503.1| hypothetical protein CaO19.1384 [Cand... 37 0.77
gi|23612619|ref|NP_704180.1| hypothetical protein [Plasmodium fa... 37 0.77
gi|15828990|ref|NP_326350.1| HEAT SHOCK ATP-DEPENDENT PROTEASE [... 37 0.77
gi|48763820|ref|ZP_00268373.1| COG1067: Predicted ATP-dependent ... 37 0.77
gi|22970380|ref|ZP_00017472.1| hypothetical protein [Chloroflexu... 37 0.77
gi|50258500|gb|EAL21187.1| hypothetical protein CNBD2440 [Crypto... 37 0.77
gi|23509723|ref|NP_702390.1| hypothetical protein [Plasmodium fa... 36 1.0
gi|47216221|emb|CAG01255.1| unnamed protein product [Tetraodon n... 36 1.0
gi|45198531|ref|NP_985560.1| AFR013Cp [Eremothecium gossypii] >g... 36 1.0
gi|27596815|gb|AAO20886.1| merozoite surface protein 3 alpha [Pl... 36 1.0
gi|27596823|gb|AAO20890.1| merozoite surface protein 3 alpha [Pl... 36 1.0
gi|27381285|ref|NP_772814.1| ATP-dependent protease LA [Bradyrhi... 36 1.0
gi|27596821|gb|AAO20889.1| merozoite surface protein 3 alpha [Pl... 36 1.0
gi|50305575|ref|XP_452748.1| unnamed protein product [Kluyveromy... 36 1.0
gi|11094139|gb|AAG29570.1| p235 rhoptry protein [Plasmodium yoel... 36 1.0
gi|6648932|gb|AAF21294.1| lipase [Staphylococcus haemolyticus] 36 1.0
gi|39587456|emb|CAE75110.1| Hypothetical protein CBG23035 [Caeno... 36 1.0
gi|17505831|ref|NP_492796.1| mitochondrial ATP-dependent proteas... 36 1.0
gi|2326801|emb|CAA72065.1| 235kDa rhoptry protein [Plasmodium yo... 36 1.0
gi|27596825|gb|AAO20891.1| merozoite surface protein 3 alpha [Pl... 36 1.0
gi|27596819|gb|AAO20888.1| merozoite surface protein 3 alpha [Pl... 36 1.0
gi|19745146|ref|NP_034211.1| dystonin isoform e; bullous pemphig... 36 1.3
gi|33944807|ref|XP_340551.1| hypothetical protein Tb927.2.4520 [... 36 1.3
gi|27596798|gb|AAO20878.1| merozoite surface protein 3 alpha [Pl... 36 1.3
gi|23509769|ref|NP_702436.1| hypothetical protein [Plasmodium fa... 36 1.3
gi|27596804|gb|AAO20881.1| merozoite surface protein 3 alpha [Pl... 36 1.3
gi|24653847|ref|NP_725458.1| CG8174-PA [Drosophila melanogaster]... 36 1.3
gi|23509683|ref|NP_702350.1| hypothetical protein [Plasmodium fa... 36 1.3
gi|10242347|gb|AAG15387.1| SR protein kinase 1 [Drosophila melan... 36 1.3
gi|15929245|gb|AAH15068.1| Ap3b1 protein [Mus musculus] 36 1.3
gi|15612358|ref|NP_224011.1| ATP-DEPENDENT PROTEASE LA [Helicoba... 36 1.3
gi|27596813|gb|AAO20885.1| merozoite surface protein 3 alpha [Pl... 36 1.3
gi|33859616|ref|NP_035394.1| REV3-like, catalytic subunit of DNA... 36 1.3
gi|27596827|gb|AAO20892.1| merozoite surface protein 3 alpha [Pl... 36 1.3
gi|41056139|ref|NP_956968.1| hypothetical protein MGC63779 [Dani... 36 1.3
gi|23479217|gb|EAA16105.1| hypothetical protein [Plasmodium yoel... 36 1.3
gi|24653851|ref|NP_725459.1| CG8174-PC [Drosophila melanogaster]... 36 1.3
gi|23619482|ref|NP_705444.1| hypothetical protein [Plasmodium fa... 35 1.7
gi|4507525|ref|NP_003253.1| translocation protein 1; Dtrp1 prote... 35 1.7
gi|23508769|ref|NP_701437.1| hypothetical protein [Plasmodium fa... 35 1.7
gi|23612672|ref|NP_704233.1| hypothetical protein [Plasmodium fa... 35 1.7
gi|26554145|ref|NP_758079.1| ATP-dependent protease La [Mycoplas... 35 1.7
gi|20089637|ref|NP_615712.1| conserved hypothetical protein [Met... 35 1.7
gi|23509250|ref|NP_701917.1| hypothetical protein [Plasmodium fa... 35 1.7
gi|32040793|ref|ZP_00138376.1| COG0466: ATP-dependent Lon protea... 35 1.7
gi|28901348|ref|NP_801003.1| ATP-dependent protease LA-related p... 35 1.7
gi|15221142|ref|NP_175263.1| expressed protein [Arabidopsis thal... 35 1.7
gi|24666442|ref|NP_649060.1| CG14073-PB [Drosophila melanogaster... 35 1.7
gi|48853586|ref|ZP_00307754.1| COG0466: ATP-dependent Lon protea... 35 1.7
gi|46126075|ref|XP_387591.1| hypothetical protein FG07415.1 [Gib... 35 1.7
gi|12045094|ref|NP_072905.1| ATP-dependent protease La (lon) [My... 35 1.7
gi|38089907|ref|XP_134917.5| similar to senescence downregulated... 35 1.7
gi|6322762|ref|NP_012835.1| Protein required for cell viability;... 35 1.7
gi|46579748|ref|YP_010556.1| ATP-dependent protease La [Desulfov... 35 1.7
gi|23613402|ref|NP_703246.1| hypothetical protein [Plasmodium fa... 35 1.7
gi|46431856|gb|EAK91379.1| hypothetical protein CaO19.7818 [Cand... 35 2.2
gi|23508379|ref|NP_701048.1| heat shock protein 90, putative [Pl... 35 2.2
gi|23613858|ref|NP_704879.1| hypothetical protein [Plasmodium fa... 35 2.2
gi|23612323|ref|NP_703903.1| iswi protein homologue [Plasmodium ... 35 2.2
gi|23509729|ref|NP_702396.1| hypothetical protein [Plasmodium fa... 35 2.2
gi|23508711|ref|NP_701379.1| hypothetical protein [Plasmodium fa... 35 2.2
gi|50546725|ref|XP_500832.1| hypothetical protein [Yarrowia lipo... 35 2.2
gi|24643074|ref|NP_573311.1| CG15040-PA [Drosophila melanogaster... 35 2.2
gi|23613276|ref|NP_703598.1| hypothetical protein [Plasmodium fa... 35 2.2
gi|23612921|ref|NP_704460.1| hypothetical protein [Plasmodium fa... 35 2.2
gi|15601728|ref|NP_233359.1| ATP-dependent protease LA-related p... 35 2.2
gi|23509419|ref|NP_702086.1| glycine -- tRNA ligase, putative [P... 35 2.2
gi|17552054|ref|NP_498895.1| kurz (3J700) [Caenorhabditis elegan... 35 2.2
gi|23509023|ref|NP_701691.1| hypothetical protein [Plasmodium fa... 35 2.2
gi|18397363|ref|NP_566258.1| Lon protease, putative [Arabidopsis... 35 2.2
gi|4666311|dbj|BAA77218.1| LON protease homologue [Lithospermum ... 35 2.2
gi|25511605|pir||H88533 probable ATP-dependent RNA helicase C06E... 35 2.2
gi|23613003|ref|NP_704542.1| erythrocyte membrane protein 1 (PfE... 35 2.2
gi|23507987|ref|NP_700657.1| hypothetical protein [Plasmodium fa... 35 2.9
gi|39595837|emb|CAE67340.1| Hypothetical protein CBG12802 [Caeno... 35 2.9
gi|18654372|gb|AAL77612.1| troponin T fast skeletal muscle isofo... 35 2.9
gi|23479892|gb|EAA16603.1| hypothetical protein [Plasmodium yoel... 35 2.9
gi|23510031|ref|NP_702697.1| hypothetical protein [Plasmodium fa... 35 2.9
gi|23619064|ref|NP_705026.1| hypothetical protein [Plasmodium fa... 35 2.9
gi|23613190|ref|NP_703512.1| hypothetical protein [Plasmodium fa... 35 2.9
gi|22095166|emb|CAD42910.1| putative Na+/H+ antiporter [Pichia f... 35 2.9
gi|50303347|ref|XP_451615.1| unnamed protein product [Kluyveromy... 35 2.9
gi|38082728|ref|XP_128721.2| protease, serine, 15 [Mus musculus] 35 2.9
gi|26984237|gb|AAN85210.1| mitochondrial ATP-dependent protease ... 35 2.9
gi|12836291|dbj|BAB23591.1| unnamed protein product [Mus musculus] 35 2.9
gi|18310372|ref|NP_562306.1| ATP-dependent protease La [Clostrid... 35 2.9
gi|50289993|ref|XP_447428.1| unnamed protein product [Candida gl... 35 2.9
gi|17380486|sp|Q61493|DPOZ_MOUSE DNA polymerase zeta catalytic s... 35 2.9
gi|23508319|ref|NP_700988.1| hypothetical protein [Plasmodium fa... 35 2.9
gi|46227737|gb|EAK88657.1| Pfa MAL6P1.309 like protein [Cryptosp... 35 2.9
gi|6323135|ref|NP_013207.1| Midasin, pseudo-hexameric assembly o... 35 2.9
gi|23509074|ref|NP_701742.1| hypothetical protein [Plasmodium fa... 35 2.9
gi|50760871|ref|XP_418170.1| PREDICTED: similar to SWI/SNF-relat... 35 2.9
gi|14588840|emb|CAC43016.1| HrpO protein [Pantoea agglomerans] 35 2.9
gi|18422747|ref|NP_568675.1| Lon protease homolog 1, mitochondri... 35 2.9
gi|50556774|ref|XP_505795.1| hypothetical protein [Yarrowia lipo... 35 2.9
gi|15925629|ref|NP_373163.1| conserved hypothetical protein [Sta... 35 2.9
gi|50745330|ref|XP_426222.1| PREDICTED: similar to retinitis pig... 35 2.9
gi|15645989|ref|NP_208170.1| ATP-dependent protease (lon) [Helic... 35 2.9
gi|27311537|gb|AAO00734.1| Lon protease homolog 1 precursor [Ara... 35 2.9
gi|23481827|gb|EAA17988.1| Plasmodium vivax PV1H14210_P [Plasmod... 34 3.8
gi|46436237|gb|EAK95603.1| hypothetical protein CaO19.8963 [Cand... 34 3.8
gi|23483366|gb|EAA19060.1| hypothetical protein [Plasmodium yoel... 34 3.8
gi|23508016|ref|NP_700686.1| 10b antigen, putative [Plasmodium f... 34 3.8
gi|23612386|ref|NP_703966.1| DEAD/DEAH box ATP-dependent RNA hel... 34 3.8
gi|19173766|ref|NP_596895.1| protease, serine, 15 [Rattus norveg... 34 3.8
gi|23482734|gb|EAA18628.1| ubiquitin-activating enzyme e1 1 [Pla... 34 3.8
gi|37526731|ref|NP_930075.1| ribonuclease E (RNase E) [Photorhab... 34 3.8
gi|30022558|ref|NP_834189.1| ATP-dependent protease La [Bacillus... 34 3.8
gi|49478648|ref|YP_038520.1| endopeptidase La (ATP-dependent pro... 34 3.8
gi|21402516|ref|NP_658501.1| LON, ATP-dependent protease La (LON... 34 3.8
gi|23480676|gb|EAA17170.1| hypothetical protein [Plasmodium yoel... 34 3.8
gi|23510023|ref|NP_702689.1| hypothetical protein [Plasmodium fa... 34 3.8
gi|23619284|ref|NP_705246.1| hypothetical protein [Plasmodium fa... 34 3.8
gi|42783607|ref|NP_980854.1| ATP-dependent protease La 1 [Bacill... 34 3.8
gi|30264538|ref|NP_846915.1| ATP-dependent protease La 1 [Bacill... 34 3.8
gi|47566660|ref|ZP_00237482.1| ATP-dependent protease La [Bacill... 34 3.8
gi|15595976|ref|NP_249470.1| probable ATP-dependent protease [Ps... 34 3.8
gi|16805041|ref|NP_473070.1| hypothetical protein [Plasmodium fa... 34 3.8
gi|46431839|gb|EAK91363.1| hypothetical protein CaO19.187 [Candi... 34 3.8
gi|23475210|ref|ZP_00130499.1| COG1067: Predicted ATP-dependent ... 34 3.8
gi|23508608|ref|NP_701277.1| hypothetical protein [Plasmodium fa... 34 3.8
gi|23490438|gb|EAA22215.1| Kinesin motor domain, putative [Plasm... 34 3.8
gi|23490473|gb|EAA22241.1| hypothetical protein [Plasmodium yoel... 34 3.8
gi|23482722|gb|EAA18621.1| hypothetical protein [Plasmodium yoel... 34 3.8
gi|15639010|ref|NP_218456.1| ATP-dependent protease LA (lon-1) [... 34 5.0
gi|3913996|sp|O04979|LON1_SPIOL Lon protease homolog 1, mitochon... 34 5.0
gi|26988176|ref|NP_743601.1| ATP-dependent protease La [Pseudomo... 34 5.0
gi|34900102|ref|NP_911397.1| hypothetical protein [Oryza sativa ... 34 5.0
gi|23508123|ref|NP_700793.1| hypothetical protein [Plasmodium fa... 34 5.0
gi|23612913|ref|NP_704452.1| hypothetical protein [Plasmodium fa... 34 5.0
gi|21228015|ref|NP_633937.1| ATP-dependent protease La [Methanos... 34 5.0
gi|27596975|gb|AAM68124.1| merozoite surface protein 3 alpha [Pl... 34 5.0
gi|15644381|ref|NP_229433.1| ATP-dependent protease LA [Thermoto... 34 5.0
gi|23508081|ref|NP_700751.1| hypothetical protein, conserved [Pl... 34 5.0
gi|23481443|gb|EAA17720.1| ring-infested erythrocyte surface ant... 34 5.0
gi|23484285|gb|EAA19671.1| Ran-binding protein [Plasmodium yoeli... 34 5.0
gi|46438461|gb|EAK97791.1| hypothetical protein CaO19.939 [Candi... 34 5.0
gi|48840468|ref|ZP_00297395.1| COG1750: Archaeal serine protease... 34 5.0
gi|24374902|ref|NP_718945.1| ATP-dependent protease, putative [S... 34 5.0
gi|23509069|ref|NP_701737.1| hypothetical protein [Plasmodium fa... 34 5.0
gi|23490401|gb|EAA22190.1| HECT-domain, putative [Plasmodium yoe... 34 5.0
gi|23508643|ref|NP_701312.1| hypothetical protein [Plasmodium fa... 34 5.0
gi|22553078|emb|CAD44992.1| GPI transamidase 8 [Toxoplasma gondii] 34 5.0
gi|15131992|emb|CAC49971.1| dJ276E15.1 (DIPB protein) [Homo sapi... 33 6.5
gi|23478204|gb|EAA15355.1| chloroquine resistance marker protein... 33 6.5
gi|23613490|ref|NP_703334.1| hypothetical protein [Plasmodium fa... 33 6.5
gi|23479148|gb|EAA16056.1| hypothetical protein [Plasmodium yoel... 33 6.5
gi|50545257|ref|XP_500166.1| hypothetical protein [Yarrowia lipo... 33 6.5
gi|48130462|ref|XP_396665.1| similar to hypothetical protein [Ap... 33 6.5
gi|42570671|ref|NP_973409.1| myb family transcription factor / E... 33 6.5
gi|15227651|ref|NP_178446.1| myb family transcription factor / E... 33 6.5
gi|48857387|ref|ZP_00311396.1| COG1067: Predicted ATP-dependent ... 33 6.5
gi|34540426|ref|NP_904905.1| ATP-dependent protease La [Porphyro... 33 6.5
gi|31205097|ref|XP_311497.1| ENSANGP00000013687 [Anopheles gambi... 33 6.5
gi|6467503|gb|AAF13168.1| granule bound starch synthase II precu... 33 6.5
gi|50731564|ref|XP_418278.1| PREDICTED: similar to ring finger p... 33 6.5
gi|6688177|emb|CAB65108.1| DIPB protein [Homo sapiens] 33 6.5
gi|19310963|gb|AAL86697.1| histone deacetylase-like protein HDO2... 33 6.5
gi|21361639|ref|NP_060053.2| DIPB protein [Homo sapiens] >gnl|BL... 33 6.5
gi|6320845|ref|NP_010924.1| Non-essential subunit of the exocyst... 33 6.5
gi|17531573|ref|NP_496001.1| ATP-dependent lon protease like fam... 33 6.5
gi|48116491|ref|XP_396404.1| similar to Zinc finger protein 214 ... 33 6.5
>gi|7503311|pir||T34042 hypothetical protein F43E2.10 -
Caenorhabditis elegans
Length = 162
Score = 287 bits (735), Expect = 2e-76
Identities = 144/159 (90%), Positives = 145/159 (90%)
Frame = -1
Query: 480 SKCRYEISNEHSFEVHSQGEMGPEIERKSHLAYQVARFEAVAMGFPVQYRQVVVEFYYHG 301
+KCRYEISNEHSFEVHSQGEMGPEIERKSHLAYQVARFEAVAMGFPVQYRQVVVEFYYHG
Sbjct: 4 AKCRYEISNEHSFEVHSQGEMGPEIERKSHLAYQVARFEAVAMGFPVQYRQVVVEFYYHG 63
Query: 300 RLDGSSXXXXXXXXXXXXXXGVKISPRFAITGSLDVFGFVYEVGGILDKVQAAIDGLYEA 121
RLDGSS GVKISPRFAITGSLDVFGFVYEVGGILDKVQAAIDGLYEA
Sbjct: 64 RLDGSSGTLATAVGLLALFTGVKISPRFAITGSLDVFGFVYEVGGILDKVQAAIDGLYEA 123
Query: 120 VIVPDSNYSMIPDSMKTKIQVHPVWHVQEALKIVTENKK 4
VIVPDSNYSMIPDSMKTKIQVHPVWHVQEALKIVTENKK
Sbjct: 124 VIVPDSNYSMIPDSMKTKIQVHPVWHVQEALKIVTENKK 162