Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F43G6_12
(792 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17534001|ref|NP_496523.1| ADP-ribosylation factor domain prot... 513 e-144
gi|39591330|emb|CAE73383.1| Hypothetical protein CBG20823 [Caeno... 96 9e-19
gi|39591329|emb|CAE73382.1| Hypothetical protein CBG20822 [Caeno... 96 1e-18
gi|17536885|ref|NP_496525.1| ADP-ribosylation factor domain prot... 85 2e-15
gi|39595761|emb|CAE67264.1| Hypothetical protein CBG12711 [Caeno... 79 1e-13
gi|39591348|emb|CAE73401.1| Hypothetical protein CBG20842 [Caeno... 77 3e-13
gi|17561342|ref|NP_507996.1| protein factor like family member (... 76 9e-13
gi|39591333|emb|CAE73386.1| Hypothetical protein CBG20826 [Caeno... 74 3e-12
gi|39591331|emb|CAE73384.1| Hypothetical protein CBG20824 [Caeno... 74 4e-12
gi|17533927|ref|NP_494271.1| major sperm protein domain and Zn-... 73 6e-12
gi|39591345|emb|CAE73398.1| Hypothetical protein CBG20839 [Caeno... 72 1e-11
gi|39591332|emb|CAE73385.1| Hypothetical protein CBG20825 [Caeno... 71 3e-11
gi|32564316|ref|NP_494241.2| zn-finger, RING and Zn-finger, B-bo... 70 7e-11
gi|25395435|pir||B88072 protein ZK1240.2 [imported] - Caenorhabd... 70 7e-11
gi|32564312|ref|NP_494243.2| zn-finger, RING and Zn-finger, B-bo... 67 3e-10
gi|25395437|pir||D88072 protein ZK1240.1 [imported] - Caenorhabd... 67 3e-10
gi|17505791|ref|NP_491223.1| ADP-ribosylation factor domain prot... 66 7e-10
gi|39591346|emb|CAE73399.1| Hypothetical protein CBG20840 [Caeno... 66 1e-09
gi|39591328|emb|CAE73381.1| Hypothetical protein CBG20821 [Caeno... 64 3e-09
gi|17549986|ref|NP_509564.1| membrane-associated nucleic acid bi... 64 3e-09
gi|17533955|ref|NP_494244.1| b-box zinc finger containing protei... 64 5e-09
gi|39587801|emb|CAE67819.1| Hypothetical protein CBG13399 [Caeno... 63 6e-09
gi|39591347|emb|CAE73400.1| Hypothetical protein CBG20841 [Caeno... 63 8e-09
gi|17535019|ref|NP_494227.1| RING zinc finger containing protein... 62 1e-08
gi|39591327|emb|CAE73380.1| Hypothetical protein CBG20820 [Caeno... 62 2e-08
gi|32564318|ref|NP_494239.2| zn-finger, RING and Zn-finger, B-bo... 61 2e-08
gi|17531269|ref|NP_494234.1| predicted CDS, RING zinc finger con... 60 5e-08
gi|39591326|emb|CAE73379.1| Hypothetical protein CBG20819 [Caeno... 60 7e-08
gi|17531261|ref|NP_494232.1| zn-finger, RING and Zn-finger, B-bo... 59 9e-08
gi|543840|sp|P36407|ARD1_RAT GTP-binding protein ARD-1 (ADP-ribo... 58 2e-07
gi|29789263|ref|NP_109656.1| tripartite motif protein 23; tripar... 58 3e-07
gi|15208641|ref|NP_150230.1| ADP-ribosylation factor domain prot... 58 3e-07
gi|34853747|ref|XP_342184.1| ADP-ribosylation factor domain prot... 58 3e-07
gi|26354048|dbj|BAC40654.1| unnamed protein product [Mus musculus] 58 3e-07
gi|34921712|sp|Q8BGX0|ARD1_MOUSE GTP-binding protein ARD-1 (ADP-... 58 3e-07
gi|4502197|ref|NP_001647.1| ADP-ribosylation factor domain prote... 58 3e-07
gi|26326825|dbj|BAC27156.1| unnamed protein product [Mus musculus] 58 3e-07
gi|422756|pir||A46054 GTP-binding protein ARD 1 - human 58 3e-07
gi|15208643|ref|NP_150231.1| ADP-ribosylation factor domain prot... 58 3e-07
gi|50761533|ref|XP_424752.1| PREDICTED: similar to GTP-binding p... 57 4e-07
gi|39586085|emb|CAE69161.1| Hypothetical protein CBG15192 [Caeno... 57 4e-07
gi|50415349|gb|AAH77512.1| Unknown (protein for MGC:82681) [Xeno... 57 4e-07
gi|47228454|emb|CAG05274.1| unnamed protein product [Tetraodon n... 57 4e-07
gi|47218690|emb|CAG12414.1| unnamed protein product [Tetraodon n... 56 8e-07
gi|20178303|sp|Q13049|HT2A_HUMAN Zinc-finger protein HT2A (72 kD... 56 1e-06
gi|27477053|ref|NP_444314.1| tripartite motif protein 32 [Mus mu... 56 1e-06
gi|21706608|gb|AAH34104.1| Tripartite motif protein 32 [Mus musc... 56 1e-06
gi|27714689|ref|XP_233039.1| similar to tripartite motif protein... 56 1e-06
gi|17538073|ref|NP_494238.1| ADP-ribosylation factor domain prot... 55 1e-06
gi|25395432|pir||H88071 protein ZK1240.3 [imported] - Caenorhabd... 55 1e-06
gi|20094208|ref|NP_614055.1| Uncharacterized protein [Methanopyr... 55 1e-06
gi|6912426|ref|NP_036342.1| TAT-interactive protein, 72-KD; trip... 54 5e-06
gi|17538071|ref|NP_494242.1| zn-finger, RING and Zn-finger, B-bo... 53 8e-06
gi|17543450|ref|NP_502624.1| ADP-ribosylation factor domain prot... 53 8e-06
gi|39585253|emb|CAE57496.1| Hypothetical protein CBG00468 [Caeno... 52 1e-05
gi|17533953|ref|NP_494245.1| RING zinc finger containing protein... 52 1e-05
gi|23485476|gb|EAA20445.1| hypothetical protein [Plasmodium yoel... 52 2e-05
gi|17543448|ref|NP_502615.1| ADP-ribosylation factor domain prot... 52 2e-05
gi|25395612|pir||A88284 protein ZK945.5 [imported] - Caenorhabdi... 50 4e-05
gi|17538007|ref|NP_496180.1| ADP-ribosylation factor domain prot... 50 4e-05
gi|11037008|gb|AAG27458.1| latent nuclear antigen [Human herpesv... 50 5e-05
gi|17540438|ref|NP_501814.1| predicted CDS, putative nuclear pro... 50 5e-05
gi|13936996|gb|AAK50002.1| ORF73 [Human herpesvirus 8] 50 5e-05
gi|39579379|emb|CAE74739.1| Hypothetical protein CBG22559 [Caeno... 50 5e-05
gi|15219056|ref|NP_173584.1| preprotein translocase secA family ... 50 7e-05
gi|24580684|ref|NP_608540.1| CG2839-PA [Drosophila melanogaster]... 50 7e-05
gi|25518647|pir||F86349 hypothetical protein F8K7.7 [imported] -... 50 7e-05
gi|17529236|gb|AAL38845.1| putative SecA-type chloroplast protei... 50 7e-05
gi|17538069|ref|NP_494240.1| predicted CDS, ADP-ribosylation fac... 49 9e-05
gi|2246532|gb|AAB62657.1| ORF 73, contains large complex repeat ... 49 9e-05
gi|12045072|ref|NP_072883.1| cytadherence accessory protein (hmw... 49 9e-05
gi|50423079|ref|XP_460118.1| unnamed protein product [Debaryomyc... 49 2e-04
gi|39584984|emb|CAE64408.1| Hypothetical protein CBG09100 [Caeno... 49 2e-04
gi|50507507|emb|CAA92606.2| Hypothetical protein F44D12.10 [Caen... 48 2e-04
gi|34190553|gb|AAH35003.2| C6orf97 protein [Homo sapiens] 48 2e-04
gi|17553362|ref|NP_497169.1| predicted CDS, tripartite motif pro... 48 3e-04
gi|39594727|emb|CAE70595.1| Hypothetical protein CBG17264 [Caeno... 48 3e-04
gi|47220555|emb|CAG05581.1| unnamed protein product [Tetraodon n... 48 3e-04
gi|17539210|ref|NP_500203.1| tripartite motif protein 50 like (6... 47 4e-04
gi|41235779|ref|NP_958761.1| similar to tripartite motif-contain... 47 4e-04
gi|28278996|gb|AAH45615.1| A130009K11Rik protein [Mus musculus] 47 4e-04
gi|15221848|ref|NP_175858.1| myosin, putative [Arabidopsis thali... 47 4e-04
gi|25295724|pir||F96587 hypothetical protein T22H22.1 [imported]... 47 4e-04
gi|39590419|emb|CAE66158.1| Hypothetical protein CBG11389 [Caeno... 47 4e-04
gi|17505905|ref|NP_492366.1| SecA-type chloroplast protein trans... 47 4e-04
gi|18857955|ref|NP_572242.1| CG4119-PA [Drosophila melanogaster]... 47 5e-04
gi|17509103|ref|NP_491267.1| SecA-type chloroplast protein trans... 47 5e-04
gi|39586244|emb|CAE66655.1| Hypothetical protein CBG11992 [Caeno... 47 5e-04
gi|17556196|ref|NP_497528.1| predicted CDS, tripartite motif pro... 47 5e-04
gi|23613070|ref|NP_703392.1| hypothetical protein [Plasmodium fa... 47 6e-04
gi|30425030|ref|NP_780549.1| malin [Mus musculus] >gnl|BL_ORD_ID... 47 6e-04
gi|39597154|emb|CAE59381.1| Hypothetical protein CBG02734 [Caeno... 47 6e-04
gi|7496652|pir||T15689 hypothetical protein C28G1.3 - Caenorhabd... 47 6e-04
gi|181608|gb|AAA35766.1| desmoplakin 46 8e-04
gi|4758200|ref|NP_004406.1| desmoplakin; desmoplakin (DPI, DPII)... 46 8e-04
gi|15242952|ref|NP_200041.1| protein transport protein-related [... 46 8e-04
gi|25153296|ref|NP_741866.1| ring finger family member (XJ448) [... 46 8e-04
gi|23480318|gb|EAA16908.1| Drosophila melanogaster CG8797 gene p... 46 8e-04
gi|48859553|ref|ZP_00313486.1| COG1196: Chromosome segregation A... 46 8e-04
gi|48863086|ref|ZP_00316980.1| COG0419: ATPase involved in DNA r... 46 8e-04
gi|7494129|pir||T18296 myosin heavy chain - Entamoeba histolytic... 46 8e-04
gi|586120|sp|Q07283|TRHY_HUMAN Trichohyalin >gnl|BL_ORD_ID|13043... 46 8e-04
gi|2134996|pir||A38194 desmoplakin I - human 46 8e-04
gi|49088512|ref|XP_406072.1| hypothetical protein AN1935.2 [Aspe... 46 8e-04
gi|39586215|emb|CAE66626.1| Hypothetical protein CBG11962 [Caeno... 46 8e-04
gi|23508760|ref|NP_701428.1| hypothetical protein [Plasmodium fa... 46 0.001
gi|17553358|ref|NP_497167.1| predicted CDS, zinc-finger protein ... 46 0.001
gi|23480825|gb|EAA17280.1| hypothetical protein [Plasmodium yoel... 46 0.001
gi|50293455|ref|XP_449139.1| unnamed protein product [Candida gl... 46 0.001
gi|4886294|emb|CAB43342.1| Lamin [Astropecten brasiliensis] 46 0.001
gi|50260034|gb|EAL22697.1| hypothetical protein CNBB1460 [Crypto... 46 0.001
gi|31746687|gb|AAB52442.2| Ring finger protein protein 1 [Caenor... 45 0.001
gi|39582166|emb|CAE71498.1| Hypothetical protein CBG18425 [Caeno... 45 0.001
gi|49117816|gb|AAH72732.1| Unknown (protein for MGC:79078) [Xeno... 45 0.001
gi|49903336|gb|AAH76671.1| Unknown (protein for MGC:79623) [Xeno... 45 0.001
gi|47124939|gb|AAH70806.1| MGC83879 protein [Xenopus laevis] 45 0.001
gi|47219280|emb|CAG11742.1| unnamed protein product [Tetraodon n... 45 0.001
gi|17505506|ref|NP_491738.1| RiNg Finger protein (rnf-1) [Caenor... 45 0.001
gi|40385887|ref|NP_954706.1| malin; NHL repeat containing 1 [Rat... 45 0.002
gi|34883226|ref|XP_347343.1| similar to CG15105-PA [Rattus norve... 45 0.002
gi|38080936|ref|XP_358863.1| similar to Cas-Br-M (murine) ectrop... 45 0.002
gi|38570058|ref|NP_079335.2| hypothetical protein FLJ23305 [Homo... 45 0.002
gi|39589263|emb|CAE57996.1| Hypothetical protein CBG01059 [Caeno... 45 0.002
gi|862409|gb|AAB09292.1| cbl-b truncated form 1 45 0.002
gi|9886896|gb|AAG01636.1| Orf73 [Human herpesvirus 8] 45 0.002
gi|10439942|dbj|BAB15602.1| unnamed protein product [Homo sapiens] 45 0.002
gi|38511966|gb|AAH60803.1| Hypothetical protein FLJ23305 [Homo s... 45 0.002
gi|8928017|sp|Q13191|CBLB_HUMAN Signal transduction protein CBL-... 45 0.002
gi|29366808|ref|NP_733762.1| Cas-Br-M (murine) ecotropic retrovi... 45 0.002
gi|31203957|ref|XP_310927.1| ENSANGP00000012723 [Anopheles gambi... 45 0.002
gi|29789319|ref|NP_598285.1| Cas-Br-M (murine) ectropic retrovir... 45 0.002
gi|50729698|ref|XP_416621.1| PREDICTED: similar to Cas-Br-M (mur... 45 0.002
gi|27884106|emb|CAD61238.1| SI:dZ39L02.2 (novel protein similar ... 45 0.002
gi|38079820|ref|XP_156257.3| similar to Cas-Br-M (murine) ectrop... 45 0.002
gi|17542872|ref|NP_500811.1| predicted CDS, ankyrin-repeat conta... 45 0.002
gi|33469244|gb|AAQ19671.1| malin [Homo sapiens] 45 0.002
gi|40255283|ref|NP_940988.2| malin [Homo sapiens] >gnl|BL_ORD_ID... 45 0.002
gi|29561816|emb|CAD87782.1| SI:dZ25N23.1 (novel gene similar to ... 45 0.002
gi|48859547|ref|ZP_00313480.1| COG0419: ATPase involved in DNA r... 45 0.002
gi|39598079|emb|CAE68771.1| Hypothetical protein CBG14711 [Caeno... 45 0.002
gi|4502781|ref|NP_001804.1| centromere protein E; Centromere aut... 45 0.002
gi|382658|prf||1819485A CENP-E protein 45 0.002
gi|5669894|gb|AAD46501.1| latent nuclear antigen [Human herpesvi... 45 0.002
gi|862411|gb|AAB09293.1| cbl-b truncated form 2 45 0.002
gi|32403428|ref|XP_322327.1| predicted protein [Neurospora crass... 45 0.002
gi|48101591|ref|XP_392690.1| similar to GTP-binding protein ARD-... 45 0.002
gi|47224421|emb|CAG08671.1| unnamed protein product [Tetraodon n... 45 0.002
gi|25153293|ref|NP_509495.2| RING zinc finger containing protein... 45 0.002
gi|42569129|ref|NP_179444.2| cupin family protein [Arabidopsis t... 45 0.002
gi|34853284|ref|XP_345328.1| similar to hypothetical protein [Ra... 45 0.002
gi|33333845|gb|AAQ12016.1| tropomyosin [Heterodera glycines] 45 0.002
gi|47220874|emb|CAG03081.1| unnamed protein product [Tetraodon n... 45 0.002
gi|34858177|ref|XP_227373.2| similar to trichohyalin [Rattus nor... 45 0.002
gi|25411878|pir||E84565 hypothetical protein At2g18540 [imported... 45 0.002
gi|34875216|ref|XP_225259.2| similar to Desmoplakin (DP) (250/21... 45 0.002
gi|34495238|gb|AAQ73469.1| erythrocyte binding protein 3 [Plasmo... 44 0.003
gi|34495237|gb|AAQ73468.1| erythrocyte binding protein 2 [Plasmo... 44 0.003
gi|25151349|ref|NP_496089.2| ARF-related in C-term, ARD family, ... 44 0.003
gi|39586523|emb|CAE73650.1| Hypothetical protein CBG21151 [Caeno... 44 0.003
gi|9629493|ref|NP_044724.1| hypothetical protein DaV1gp27 [Duck ... 44 0.003
gi|23508673|ref|NP_701342.1| MAEBL, putative [Plasmodium falcipa... 44 0.003
gi|6752399|gb|AAF27710.1| PspA [Streptococcus pneumoniae] 44 0.003
gi|39589729|emb|CAE66964.1| Hypothetical protein CBG12358 [Caeno... 44 0.003
gi|7510990|pir||T27752 hypothetical protein ZK1320.6 - Caenorhab... 44 0.003
gi|39580127|emb|CAE56798.1| Hypothetical protein CBG24610 [Caeno... 44 0.003
gi|39592202|emb|CAE75423.1| Hypothetical protein CBG23416 [Caeno... 44 0.003
gi|38605691|sp|P22682|CBL_MOUSE CBL E3 ubiquitin protein ligase ... 44 0.004
gi|23612612|ref|NP_704173.1| hypothetical protein [Plasmodium fa... 44 0.004
gi|4885117|ref|NP_005179.1| Cas-Br-M (murine) ecotropic retrovir... 44 0.004
gi|25151067|ref|NP_740796.1| tripartite motif protein 32 like fa... 44 0.004
gi|10120668|pdb|1FBV|A Chain A, Structure Of A Cbl-Ubch7 Complex... 44 0.004
gi|19115480|ref|NP_594568.1| hypothetical coiled-coil protein; t... 44 0.004
gi|50748027|ref|XP_421078.1| PREDICTED: similar to golgi-associa... 44 0.004
gi|7248892|gb|AAF43710.1| Cbl proto-oncogene protein [Xenopus la... 44 0.004
gi|38074631|ref|XP_130233.3| membrane-associated nucleic acid bi... 44 0.005
gi|27881691|gb|AAH44642.1| Unknown (protein for MGC:52176) [Homo... 44 0.005
gi|47228165|emb|CAF97794.1| unnamed protein product [Tetraodon n... 44 0.005
gi|50757133|ref|XP_415394.1| PREDICTED: similar to membrane-asso... 44 0.005
gi|34853881|ref|XP_231249.2| similar to CG16807-PA [Rattus norve... 44 0.005
gi|39598081|emb|CAE68773.1| Hypothetical protein CBG14715 [Caeno... 44 0.005
gi|39589109|emb|CAE57841.1| Hypothetical protein CBG00870 [Caeno... 44 0.005
gi|10803429|emb|CAC13135.1| lamin [Styela clava] 44 0.005
gi|9837125|gb|AAG00432.1| membrane-associated nucleic acid bindi... 44 0.005
gi|45383704|ref|NP_989539.1| Cas-Br-M (murine) ecotropic retrovi... 44 0.005
gi|50552886|ref|XP_503853.1| hypothetical protein [Yarrowia lipo... 43 0.007
gi|17505504|ref|NP_491737.1| RING zinc finger containing protein... 43 0.007
gi|18846043|ref|NP_572129.1| ORF 73; extensive acidic domains, p... 43 0.007
gi|47212248|emb|CAF93161.1| unnamed protein product [Tetraodon n... 43 0.007
gi|27436877|ref|NP_775107.1| tripartite motif-containing 59; mou... 43 0.007
gi|48130462|ref|XP_396665.1| similar to hypothetical protein [Ap... 43 0.007
gi|33944747|ref|XP_340521.1| NUP-1 protein, putative [Trypanosom... 43 0.007
gi|111999|pir||S21801 myosin heavy chain, neuronal [similarity] ... 43 0.007
gi|31874062|emb|CAD97947.1| hypothetical protein [Homo sapiens] 43 0.007
gi|48102864|ref|XP_395448.1| similar to Cas-Br-M (murine) ectrop... 43 0.007
gi|46250250|gb|AAH68444.1| Unknown (protein for MGC:86976) [Homo... 43 0.007
gi|28316334|dbj|BAC56950.1| hair follicle protein AHF [Mus muscu... 43 0.007
gi|18652658|gb|AAD28718.2| myosin heavy chain A [Schmidtea medit... 43 0.007
gi|24899188|dbj|BAC23108.1| KIAA2012 protein [Homo sapiens] 43 0.007
gi|29732252|ref|XP_291020.1| similar to KIAA2012 protein [Homo s... 43 0.007
gi|38108884|gb|EAA54831.1| hypothetical protein MG05622.4 [Magna... 43 0.009
gi|47224831|emb|CAG06401.1| unnamed protein product [Tetraodon n... 43 0.009
gi|50256244|gb|EAL18971.1| hypothetical protein CNBI2320 [Crypto... 43 0.009
gi|127774|sp|P08799|MYS2_DICDI Myosin II heavy chain, non muscle... 43 0.009
gi|586121|sp|P37709|TRHY_RABIT Trichohyalin >gnl|BL_ORD_ID|29628... 43 0.009
gi|11384448|pir||S02771 myosin heavy chain A [similarity] - Caen... 43 0.009
gi|50760148|ref|XP_417909.1| PREDICTED: similar to KIAA1052 prot... 43 0.009
gi|50258420|gb|EAL21109.1| hypothetical protein CNBD4850 [Crypto... 43 0.009
gi|9858781|gb|AAG01128.1| BAC19.13 [Lycopersicon esculentum] 43 0.009
gi|32566139|ref|NP_506065.2| MYOsin heavy chain structural gene,... 43 0.009
gi|48475186|gb|AAT44255.1| unknown protein [Oryza sativa (japoni... 43 0.009
gi|17509101|ref|NP_491266.1| tripartite motif protein TRIM2 (88.... 42 0.011
gi|19401863|gb|AAL87694.1| non-transporter ABC protein AbcF4 [Di... 42 0.011
gi|46110767|ref|XP_382441.1| hypothetical protein FG02265.1 [Gib... 42 0.011
gi|47940004|gb|AAH72370.1| MGC84499 protein [Xenopus laevis] 42 0.011
gi|39580051|emb|CAE71577.1| Hypothetical protein CBG18531 [Caeno... 42 0.011
gi|17532853|ref|NP_495155.1| endocytosis protein EPS15 Homolog (... 42 0.011
gi|41615162|ref|NP_963660.1| NEQ371 [Nanoarchaeum equitans Kin4-... 42 0.011
gi|39588856|emb|CAE69486.1| Hypothetical protein CBG15689 [Caeno... 42 0.011
gi|34785442|gb|AAH57524.1| LOC402861 protein [Danio rerio] 42 0.011
gi|13195157|gb|AAK13051.1| EHS-1 [Caenorhabditis elegans] 42 0.011
gi|24418242|gb|AAN60507.1| Eps15 (endocytosis protein) homologou... 42 0.011
gi|31242063|ref|XP_321462.1| ENSANGP00000017369 [Anopheles gambi... 42 0.011
gi|7508073|pir||T29211 hypothetical protein T20F5.6 - Caenorhabd... 42 0.011
gi|47223807|emb|CAF98577.1| unnamed protein product [Tetraodon n... 42 0.011
gi|39587535|emb|CAE58473.1| Hypothetical protein CBG01613 [Caeno... 42 0.011
gi|39580294|emb|CAE73081.1| Hypothetical protein CBG20457 [Caeno... 42 0.015
gi|47218063|emb|CAG09935.1| unnamed protein product [Tetraodon n... 42 0.015
gi|156072|gb|AAA27858.1| filarial antigen 42 0.015
gi|23482863|gb|EAA18721.1| glutamine-asparagine rich protein [Pl... 42 0.015
gi|22477623|gb|AAH37132.1| D030060O14Rik protein [Mus musculus] ... 42 0.015
gi|12844086|dbj|BAB26231.1| unnamed protein product [Mus musculu... 42 0.015
gi|34880785|ref|XP_222801.2| similar to KIAA2025 protein [Rattus... 42 0.015
gi|20978622|sp|Q96YR5|RA50_SULTO DNA double-strand break repair ... 42 0.015
gi|17569707|ref|NP_508057.1| zinc-finger protein ht2a like famil... 42 0.015
gi|50507835|emb|CAB07413.2| Hypothetical protein T08D2.4 [Caenor... 42 0.015
gi|50256992|gb|EAL19710.1| hypothetical protein CNBG3380 [Crypto... 42 0.015
gi|7494144|pir||T18372 repeat organellar protein - Plasmodium ch... 42 0.015
gi|24644332|ref|NP_730971.1| CG31551-PA [Drosophila melanogaster... 42 0.015
gi|31227042|ref|XP_317815.1| ENSANGP00000004820 [Anopheles gambi... 42 0.015
gi|30851505|gb|AAH52414.1| Inner centromere protein [Mus musculus] 42 0.015
gi|26349413|dbj|BAC38346.1| unnamed protein product [Mus musculu... 42 0.015
gi|7710040|ref|NP_057901.1| inner centromere protein [Mus muscul... 42 0.015
gi|15220369|ref|NP_176892.1| expressed protein [Arabidopsis thal... 42 0.015
gi|9828634|gb|AAG00257.1| F1N21.5 [Arabidopsis thaliana] 42 0.015
gi|32698944|ref|NP_872367.1| hypothetical protein FLJ36144 [Homo... 42 0.015
gi|26006197|dbj|BAC41441.1| mKIAA0665 protein [Mus musculus] 42 0.015
gi|37547504|ref|XP_086409.5| KIAA2025 protein [Homo sapiens] 42 0.015
gi|1041968|gb|AAB35044.1| filarial antigen [Brugia malayi] 42 0.015
gi|50751154|ref|XP_422281.1| PREDICTED: similar to KIAA2025 prot... 42 0.015
gi|46250192|gb|AAH68669.1| MGC81061 protein [Xenopus laevis] 42 0.015
gi|49091278|ref|XP_407100.1| hypothetical protein AN2963.2 [Aspe... 42 0.015
gi|50511255|dbj|BAD32613.1| mKIAA2025 protein [Mus musculus] 42 0.015
gi|17221648|dbj|BAB78478.1| preproMP73 [Cucurbita maxima] 42 0.015
gi|15922434|ref|NP_378103.1| 882aa long hypothetical purine NTPa... 42 0.015
gi|46124783|ref|XP_386945.1| hypothetical protein FG06769.1 [Gib... 42 0.020
gi|17933532|ref|NP_525053.1| CG8590-PA [Drosophila melanogaster]... 42 0.020
gi|17569919|ref|NP_508948.1| arginase/agmatinase/formiminoglutam... 42 0.020
gi|27467947|ref|NP_764584.1| exonuclease SbcC [Staphylococcus ep... 42 0.020
gi|1096747|prf||2112301A kinesin-like protein 42 0.020
gi|31981243|ref|NP_075713.2| Casitas B-lineage lymphoma c [Mus m... 42 0.020
gi|27802760|emb|CAD60849.1| SI:zC14A17.12.1 (novel protein simil... 42 0.020
gi|47228275|emb|CAG07670.1| unnamed protein product [Tetraodon n... 42 0.020
gi|27734873|ref|NP_775828.1| ring finger protein 152 [Homo sapie... 42 0.020
gi|30520249|ref|NP_848894.1| RIKEN cDNA A930029B02 gene [Mus mus... 42 0.020
gi|27680501|ref|XP_219409.1| similar to hypothetical protein FLJ... 42 0.020
gi|39588890|emb|CAE69520.1| Hypothetical protein CBG15729 [Caeno... 42 0.020
gi|437192|gb|AAA50855.1| Enn5.8193 protein 42 0.020
gi|50302181|ref|XP_451024.1| unnamed protein product [Kluyveromy... 42 0.020
gi|40789293|ref|NP_776123.2| centromere protein E; kinesin 10; k... 42 0.020
gi|50745756|ref|XP_420230.1| PREDICTED: similar to Mtap7 protein... 42 0.020
gi|47211556|emb|CAF92350.1| unnamed protein product [Tetraodon n... 42 0.020
gi|34853282|ref|XP_345327.1| similar to RiNg Finger protein (rnf... 42 0.020
gi|22749455|ref|NP_689950.1| hypothetical protein MGC33993 [Homo... 42 0.020
gi|21748764|dbj|BAC03481.1| unnamed protein product [Homo sapiens] 42 0.020
gi|23619332|ref|NP_705294.1| hypothetical protein [Plasmodium fa... 42 0.020
gi|34860597|ref|XP_342346.1| similar to CENTROMERIC PROTEIN E (C... 42 0.020
gi|34147266|ref|NP_899027.1| hypothetical protein C630023L15 [Mu... 42 0.020
gi|23484564|gb|EAA19855.1| hypothetical protein [Plasmodium yoel... 42 0.020
gi|48101992|ref|XP_392730.1| similar to NHL domain containing (n... 42 0.020
gi|23612670|ref|NP_704231.1| hypothetical protein [Plasmodium fa... 42 0.020
gi|32698688|ref|NP_009105.1| citron; rho-interacting, serine/thr... 41 0.026
gi|50759253|ref|XP_417589.1| PREDICTED: similar to hypothetical ... 41 0.026
gi|23612116|ref|NP_703696.1| hypothetical protein [Plasmodium fa... 41 0.026
gi|48103749|ref|XP_395638.1| similar to putative scaffolding pro... 41 0.026
gi|27227576|emb|CAD59405.1| SMC3 protein [Anopheles gambiae] 41 0.026
gi|24582308|ref|NP_609067.2| CG11199-PA [Drosophila melanogaster... 41 0.026
gi|39588050|emb|CAE57282.1| Hypothetical protein CBG00187 [Caeno... 41 0.026
gi|4050087|gb|AAC97961.1| S164 [Homo sapiens] 41 0.026
gi|41203740|ref|XP_027330.7| RNA-binding region (RNP1, RRM) cont... 41 0.026
gi|28374186|gb|AAH46337.1| Casitas B-lineage lymphoma c [Mus mus... 41 0.026
gi|48106337|ref|XP_396089.1| similar to CG5020-PB [Apis mellifera] 41 0.026
gi|1495818|emb|CAA65728.1| myosin-like protein [Taenia saginata] 41 0.026
gi|33469071|ref|NP_031734.1| citron; citron kinase [Mus musculus... 41 0.026
gi|14600971|ref|NP_147497.1| hypothetical protein APE0790 [Aerop... 41 0.026
gi|45190479|ref|NP_984733.1| AEL128Cp [Eremothecium gossypii] >g... 41 0.026
gi|31209753|ref|XP_313843.1| ENSANGP00000011728 [Anopheles gambi... 41 0.026
gi|7715575|gb|AAF68099.1| PspA [Streptococcus pneumoniae] 41 0.026
gi|23271812|gb|AAH23775.1| Cit protein [Mus musculus] >gnl|BL_OR... 41 0.026
gi|14423976|sp|Q9NAS5|TPM_ANISI Tropomyosin (Allergen Ani s 3) >... 41 0.026
gi|7682769|gb|AAF67354.1| PspA [Streptococcus pneumoniae] 41 0.026
gi|1842453|gb|AAC47487.1| D-cbl [Drosophila melanogaster] 41 0.026
gi|1345860|sp|P49025|CTRO_MOUSE Citron protein (Rho-interacting,... 41 0.026
gi|24660931|ref|NP_729382.1| CG7037-PA [Drosophila melanogaster]... 41 0.026
gi|24660927|ref|NP_648224.1| CG7037-PB [Drosophila melanogaster]... 41 0.026
gi|28484764|ref|XP_283711.1| similar to RIKEN cDNA 9130020G10 [M... 41 0.026
gi|28829943|gb|AAO52434.1| similar to Arabidopsis thaliana (Mous... 41 0.026
gi|3360514|gb|AAC27933.1| Citron-K kinase [Mus musculus] 41 0.026
gi|31217421|ref|XP_316422.1| ENSANGP00000020478 [Anopheles gambi... 41 0.026
gi|46442063|gb|EAL01355.1| hypothetical protein CaO19.10199 [Can... 41 0.026
gi|6225217|sp|O14578|CTRO_HUMAN Citron protein (Rho-interacting,... 41 0.026
gi|6624128|gb|AAF19255.1|AC004858_3 U1 small ribonucleoprotein 1... 41 0.026
gi|48096459|ref|XP_392462.1| similar to CG18255-PA [Apis mellifera] 41 0.026
gi|13929120|ref|NP_113978.1| postsynaptic density protein (citro... 41 0.026
gi|21751638|dbj|BAC04004.1| unnamed protein product [Homo sapiens] 41 0.033
gi|39589375|emb|CAE74404.1| Hypothetical protein CBG22136 [Caeno... 41 0.033
gi|32699406|gb|AAP86641.1| huntingtin interacting protein 1-rela... 41 0.033
gi|29744338|ref|XP_290592.1| huntingtin interacting protein-1-re... 41 0.033
gi|547983|sp|Q99105|MYSU_RABIT Myosin heavy chain, embryonic smo... 41 0.033
gi|33877724|gb|AAH11882.1| TRIM56 protein [Homo sapiens] 41 0.033
gi|39586289|emb|CAE66700.1| Hypothetical protein CBG12045 [Caeno... 41 0.033
gi|25140983|ref|NP_740768.1| cytomatrix protein p110 [Rattus nor... 41 0.033
gi|34860826|ref|XP_221884.2| similar to Interferon-induced guany... 41 0.033
gi|3721836|dbj|BAA33713.1| HIP1R [Homo sapiens] 41 0.033
gi|30794216|ref|NP_112223.1| tripartite motif-containing 56 [Hom... 41 0.033
gi|45501047|gb|AAH67085.1| HIP1R protein [Homo sapiens] 41 0.033
gi|12848905|dbj|BAB28131.1| unnamed protein product [Mus musculus] 41 0.033
gi|20094127|ref|NP_613974.1| SMC1-family ATPase involved in DNA ... 41 0.033
gi|42733836|gb|AAS38754.1| hypothetical protein [Dictyostelium d... 41 0.033
gi|3327124|dbj|BAA31630.1| KIAA0655 protein [Homo sapiens] 41 0.033
gi|586122|sp|P22793|TRHY_SHEEP Trichohyalin >gnl|BL_ORD_ID|21738... 41 0.033
gi|34857519|ref|XP_345222.1| similar to RIKEN cDNA 2310035M22 [R... 41 0.033
gi|29648307|ref|NP_080139.2| mouse RING finger 1; tumor suppress... 41 0.033
gi|6782401|emb|CAB70614.1| M protein [Streptococcus dysgalactiae... 41 0.033
gi|23613492|ref|NP_703336.1| P. falciparum RESA-like protein wit... 41 0.033
gi|17550052|ref|NP_508635.1| M protein repeat containing protein... 41 0.033
gi|27803037|emb|CAD60740.1| unnamed protein product [Podospora a... 41 0.033
gi|17563664|ref|NP_506687.1| membrane-associated nucleic acid bi... 41 0.033
gi|33869766|gb|AAH05847.2| TRIM56 protein [Homo sapiens] 41 0.033
gi|11499153|ref|NP_070387.1| chromosome segregation protein (smc... 41 0.033
gi|31233842|ref|XP_318960.1| ENSANGP00000015084 [Anopheles gambi... 41 0.033
gi|47578103|ref|NP_689763.2| SH3 domain containing ring finger 2... 40 0.044
gi|15239036|ref|NP_196140.1| nucleolar matrix protein-related [A... 40 0.044
gi|50756691|ref|XP_415277.1| PREDICTED: similar to citron; rho-i... 40 0.044
gi|47195169|emb|CAF94043.1| unnamed protein product [Tetraodon n... 40 0.044
gi|23508069|ref|NP_700739.1| hypothetical protein [Plasmodium fa... 40 0.044
gi|15902165|ref|NP_357715.1| Surface protein pspA precursor [Str... 40 0.044
gi|17563724|ref|NP_506726.1| predicted CDS, SecA-type chloroplas... 40 0.044
gi|18676781|dbj|BAB85025.1| unnamed protein product [Homo sapiens] 40 0.044
gi|9294658|dbj|BAB03007.1| unnamed protein product [Arabidopsis ... 40 0.044
gi|6752375|gb|AAF27698.1| PspA [Streptococcus pneumoniae] 40 0.044
gi|23510167|ref|NP_702833.1| hypothetical protein [Plasmodium fa... 40 0.044
gi|9843651|emb|CAC03679.1| SRM102 [Arabidopsis thaliana] 40 0.044
gi|50730849|ref|XP_417045.1| PREDICTED: similar to KIAA0853 prot... 40 0.044
gi|30687254|ref|NP_189032.2| RNA recognition motif (RRM)-contain... 40 0.044
gi|47217784|emb|CAG06006.1| unnamed protein product [Tetraodon n... 40 0.044
gi|30684163|ref|NP_180484.2| splicing factor PWI domain-containi... 40 0.044
gi|281007|pir||B43817 transforming protein (cbl) - mouse 40 0.044
gi|6680858|ref|NP_031645.1| Casitas B-lineage lymphoma [Mus musc... 40 0.044
gi|50758577|ref|XP_417323.1| PREDICTED: similar to centrosomal p... 40 0.044
gi|47550679|ref|NP_999848.1| scaffold attachment factor B; wu:fb... 40 0.044
gi|25408026|pir||G84693 probable proline-rich protein [imported]... 40 0.044
gi|33416921|gb|AAH55628.1| Zgc:66386 protein [Danio rerio] 40 0.044
gi|39587112|emb|CAE57579.1| Hypothetical protein CBG00558 [Caeno... 40 0.044
gi|23478145|gb|EAA15312.1| hypothetical protein [Plasmodium yoel... 40 0.044
gi|23612232|ref|NP_703812.1| hypothetical protein [Plasmodium fa... 40 0.057
gi|12667788|ref|NP_002464.1| myosin, heavy polypeptide 9, non-mu... 40 0.057
gi|50413697|ref|XP_457303.1| unnamed protein product [Debaryomyc... 40 0.057
gi|31199157|ref|XP_308526.1| ENSANGP00000009538 [Anopheles gambi... 40 0.057
gi|24663110|ref|NP_648541.1| CG6793-PA [Drosophila melanogaster]... 40 0.057
gi|27370480|ref|NP_766554.1| SH3 domain containing ring finger 2... 40 0.057
gi|34596297|gb|AAQ76828.1| GRINL1A complex protein Gcom5 precurs... 40 0.057
gi|16080533|ref|NP_391360.1| yvcE [Bacillus subtilis subsp. subt... 40 0.057
gi|5825477|gb|AAD53262.1| hard-surface inducible protein [Glomer... 40 0.057
gi|42661764|ref|XP_377554.1| similar to hypothetical protein MGC... 40 0.057
gi|26329287|dbj|BAC28382.1| unnamed protein product [Mus musculus] 40 0.057
gi|12667358|gb|AAK01405.1| CBLC protein [Mus musculus] 40 0.057
gi|39586290|emb|CAE66701.1| Hypothetical protein CBG12046 [Caeno... 40 0.057
gi|24647351|ref|NP_732111.1| CG31045-PD [Drosophila melanogaster... 40 0.057
gi|15899022|ref|NP_343627.1| Purine NTPase [Sulfolobus solfatari... 40 0.057
gi|24647349|ref|NP_732110.1| CG31045-PC [Drosophila melanogaster... 40 0.057
gi|437639|gb|AAA72295.1| [Plasmodium falciparum 3' end.], gene p... 40 0.057
gi|45185602|ref|NP_983318.1| ACL086Cp [Eremothecium gossypii] >g... 40 0.057
gi|17862830|gb|AAL39892.1| LP08646p [Drosophila melanogaster] 40 0.057
gi|553596|gb|AAA59888.1| cellular myosin heavy chain 40 0.057
gi|50734173|ref|XP_418995.1| PREDICTED: similar to RIKEN cDNA A9... 40 0.057
gi|136098|sp|P15846|TPMM_TRICO Tropomyosin, muscle >gnl|BL_ORD_I... 40 0.057
gi|42559586|sp|Q25632|TPM_ONCVO Tropomyosin (MOv-14) (Ov-tmy-1) ... 40 0.057
gi|33413776|gb|AAN39446.1| normocyte binding protein 2a [Plasmod... 40 0.057
gi|32698003|emb|CAB04326.3| Hypothetical protein F36F2.3 [Caenor... 40 0.057
gi|24647345|ref|NP_732108.1| CG31045-PA [Drosophila melanogaster... 40 0.057
gi|39580156|emb|CAE56771.1| Hypothetical protein CBG24575 [Caeno... 40 0.057
gi|24653448|ref|NP_610895.1| CG13337-PA [Drosophila melanogaster... 40 0.057
gi|50752130|ref|XP_422667.1| PREDICTED: similar to KIAA0794 prot... 40 0.057
gi|34879349|ref|XP_225981.2| similar to RIKEN cDNA 9130023G24 [R... 40 0.057
gi|24647343|ref|NP_732107.1| CG31045-PE [Drosophila melanogaster... 40 0.057
gi|25010035|gb|AAN71183.1| GH16009p [Drosophila melanogaster] 40 0.057
gi|23619293|ref|NP_705255.1| reticulocyte binding protein 2 homo... 40 0.057
gi|24647347|ref|NP_732109.1| CG31045-PB [Drosophila melanogaster... 40 0.057
gi|13345187|gb|AAK19244.1| reticulocyte binding protein 2 homolo... 40 0.057
gi|46125725|ref|XP_387416.1| hypothetical protein FG07240.1 [Gib... 40 0.057
gi|30173132|sp|Q9WU62|INCE_MOUSE Inner centromere protein >gnl|B... 40 0.057
gi|24664434|ref|NP_648742.2| CG6735-PA [Drosophila melanogaster]... 40 0.057
gi|17862940|gb|AAL39947.1| SD04227p [Drosophila melanogaster] 40 0.057
gi|4959423|gb|AAD34342.1| short CBL-3 protein [Homo sapiens] 40 0.057
gi|15485411|emb|CAC67634.1| hypothetical predicted protein L7913... 40 0.057
gi|17508909|ref|NP_492440.1| FAS1 like (55.8 kD) (1J654) [Caenor... 40 0.057
gi|20809330|gb|AAH28915.1| Cas-Br-M (murine) ecotropic retrovira... 40 0.057
gi|20149596|ref|NP_036248.2| Cas-Br-M (murine) ecotropic retrovi... 40 0.057
gi|46397888|sp|Q9ULV8|CBLC_HUMAN Signal transduction protein CBL... 40 0.057
gi|4218167|emb|CAA10724.1| myosin heavy chain [Drosophila melano... 40 0.057
gi|29249691|gb|EAA41197.1| GLP_28_7608_9155 [Giardia lamblia ATC... 40 0.057
gi|29436380|gb|AAH49849.1| MYH9 protein [Homo sapiens] 40 0.057
gi|21357267|ref|NP_649312.1| CG6014-PA [Drosophila melanogaster]... 40 0.057
gi|50554851|ref|XP_504834.1| hypothetical protein [Yarrowia lipo... 40 0.057
gi|34855327|ref|XP_214861.2| similar to Casitas B-lineage lympho... 40 0.074
gi|49899872|gb|AAH76895.1| Unknown (protein for MGC:88992) [Xeno... 40 0.074
gi|45358960|ref|NP_988517.1| structural maintenance of chromosom... 40 0.074
gi|42660665|ref|XP_208835.4| similar to hypothetical protein FLJ... 40 0.074
gi|625305|pir||A61231 myosin heavy chain nonmuscle form A - human 40 0.074
gi|17533741|ref|NP_494820.1| M protein repeat containing protein... 40 0.074
gi|15238072|ref|NP_198956.1| zinc finger (C3HC4-type RING finger... 40 0.074
gi|50729830|ref|XP_416670.1| PREDICTED: hypothetical protein XP_... 40 0.074
gi|38049524|ref|XP_286972.2| similar to KIAA2012 protein [Mus mu... 40 0.074
gi|47498084|ref|NP_998866.1| hypothetical protein MGC69322 [Xeno... 40 0.074
gi|48862999|ref|ZP_00316893.1| COG1196: Chromosome segregation A... 40 0.074
gi|11357142|pir||T44430 protein PV100 [imported] - winter squash... 40 0.074
gi|7494464|pir||T09127 probable erythrocyte-binding protein MAEB... 40 0.074
gi|42407402|dbj|BAD09560.1| putative Hec1 protein [Oryza sativa ... 40 0.074
gi|24649535|ref|NP_651211.2| CG6057-PA [Drosophila melanogaster]... 40 0.074
gi|47217186|emb|CAG11022.1| unnamed protein product [Tetraodon n... 40 0.074
gi|14041889|dbj|BAB55025.1| unnamed protein product [Homo sapiens] 40 0.074
gi|7159657|emb|CAB76376.1| SMC1 protein [Drosophila melanogaster... 40 0.074
gi|32565065|ref|NP_872028.1| M protein repeat containing protein... 40 0.074
gi|14009638|gb|AAK51689.1| putative tumor suppressor LEU5/RFP2 [... 40 0.074
gi|34495216|gb|AAQ73456.1| erythrocyte binding protein 3 [Plasmo... 40 0.074
gi|189036|gb|AAA36349.1| nonmuscle myosin heavy chain (NMHC) 40 0.074
gi|24665272|ref|NP_648886.1| CG16807-PA [Drosophila melanogaster... 40 0.074
gi|31207321|ref|XP_312627.1| ENSANGP00000015381 [Anopheles gambi... 40 0.074
gi|32403722|ref|XP_322474.1| hypothetical protein [Neurospora cr... 40 0.074
gi|12407427|gb|AAG53502.1| tripartite motif protein TRIM13 [Mus ... 40 0.074
gi|34596299|gb|AAQ76829.1| GRINL1A complex protein Gcom6 precurs... 40 0.074
gi|17533743|ref|NP_494821.1| M protein repeat containing protein... 40 0.074
gi|38103514|gb|EAA50201.1| hypothetical protein MG03960.4 [Magna... 40 0.074
gi|32406786|ref|XP_324006.1| predicted protein [Neurospora crass... 40 0.074
gi|28557139|dbj|BAC57573.1| tropomyosin4-2 [Takifugu rubripes] 40 0.074
gi|47223090|emb|CAG07177.1| unnamed protein product [Tetraodon n... 40 0.074
gi|321012|pir||A44980 tropomyosin, obliquely striated muscle - n... 40 0.074
gi|49117916|gb|AAH72844.1| Unknown (protein for IMAGE:4971062) [... 40 0.074
gi|47211645|emb|CAF92169.1| unnamed protein product [Tetraodon n... 40 0.074
gi|49256353|gb|AAH74447.1| Unknown (protein for MGC:84721) [Xeno... 40 0.074
gi|29245606|gb|EAA37235.1| GLP_91_8176_7298 [Giardia lamblia ATC... 40 0.074
gi|17533739|ref|NP_494819.1| M protein repeat containing protein... 40 0.074
gi|34880553|ref|XP_228973.2| similar to hypothetical protein FLJ... 40 0.074
gi|47202955|emb|CAF94885.1| unnamed protein product [Tetraodon n... 40 0.074
gi|32364134|gb|AAP75897.1| GRINL1A upstream protein 2 precursor ... 40 0.074
gi|14149754|ref|NP_075722.1| tripartite motif protein 13; ret fi... 40 0.074
gi|14581675|gb|AAK56791.1| putative transcription factor ret fin... 40 0.074
gi|34596295|gb|AAQ76827.1| GRINL1A complex protein Gcom4 precurs... 40 0.074
gi|26379548|dbj|BAC25419.1| unnamed protein product [Mus musculus] 40 0.074
gi|32265052|gb|AAP41549.1| GRINL1A complex protein 2 precursor [... 40 0.074
gi|34596293|gb|AAQ76826.1| GRINL1A complex protein Gcom3 precurs... 40 0.074
gi|34875177|ref|XP_344418.1| similar to tripartite motif protein... 40 0.074
gi|42660674|ref|XP_377369.1| similar to hypothetical protein FLJ... 40 0.074
gi|34596291|gb|AAQ76825.1| GRINL1A combined protein Gcom10 precu... 40 0.074
gi|47224983|emb|CAF97398.1| unnamed protein product [Tetraodon n... 40 0.074
gi|47227681|emb|CAG09678.1| unnamed protein product [Tetraodon n... 40 0.074
gi|33668516|gb|AAO39707.1| GRINL1A complex protein 1 Gcom1 precu... 40 0.074
gi|50258198|gb|EAL20892.1| hypothetical protein CNBE2530 [Crypto... 40 0.074
gi|38426303|gb|AAR20251.1| 309 kDa centrosomal protein [Drosophi... 40 0.074
gi|34596313|gb|AAQ76836.1| GRINL1A combined protein Gcom13 precu... 40 0.074
gi|34495215|gb|AAQ73455.1| erythrocyte binding protein 2 [Plasmo... 40 0.074
gi|50582991|ref|NP_689664.2| GRINL1A complex upstream protein; N... 40 0.074
gi|47216945|emb|CAG04887.1| unnamed protein product [Tetraodon n... 40 0.074
gi|34596303|gb|AAQ76831.1| GRINL1A combined protein Gcom11 precu... 40 0.074
gi|14149807|ref|NP_115517.1| hypothetical protein DKFZp434K1421 ... 40 0.074
gi|49065536|emb|CAG38586.1| DKFZP434K1421 [Homo sapiens] 40 0.074
gi|15208660|ref|NP_003132.2| 52kD Ro/SSA autoantigen; Sjogren sy... 39 0.097
gi|14994115|gb|AAK76432.1| SSA1 [Homo sapiens] 39 0.097
gi|23098600|ref|NP_692066.1| hypothetical protein OB1145 [Oceano... 39 0.097
gi|21227133|ref|NP_633055.1| Chromosome partition protein [Metha... 39 0.097
gi|50344874|ref|NP_001002109.1| zgc:85944 [Danio rerio] >gnl|BL_... 39 0.097
gi|27708530|ref|XP_228891.1| similar to Hypothetical protein FLJ... 39 0.097
gi|47229938|emb|CAG10352.1| unnamed protein product [Tetraodon n... 39 0.097
gi|28211447|ref|NP_782391.1| sensory transduction protein kinase... 39 0.097
gi|39584073|emb|CAE66479.1| Hypothetical protein CBG11758 [Caeno... 39 0.097
gi|39580049|emb|CAE71575.1| Hypothetical protein CBG18529 [Caeno... 39 0.097
gi|47605964|sp|O77819|ROC1_RABIT Rho-associated protein kinase 1... 39 0.097
gi|6677759|ref|NP_033097.1| Rho-associated coiled-coil forming k... 39 0.097
gi|12055369|emb|CAC20783.1| kinesin-like boursin [Paracentrotus ... 39 0.097
gi|50053824|ref|NP_001001932.1| early endosome antigen 1 [Mus mu... 39 0.097
gi|50416449|gb|AAH78005.1| Unknown (protein for IMAGE:4959220) [... 39 0.097
gi|34859534|ref|XP_347224.1| similar to A-kinase anchor protein ... 39 0.097
gi|26351889|dbj|BAC39581.1| unnamed protein product [Mus musculus] 39 0.097
gi|47210827|emb|CAF90884.1| unnamed protein product [Tetraodon n... 39 0.097
gi|33416768|gb|AAH55881.1| Hook homolog 2 [Mus musculus] 39 0.097
gi|41054750|ref|NP_957405.1| similar to hook homolog 2 [Danio re... 39 0.097
gi|47220556|emb|CAG05582.1| unnamed protein product [Tetraodon n... 39 0.097
gi|3024609|sp|Q15431|SCP1_HUMAN Synaptonemal complex protein 1 (... 39 0.097
gi|34878904|ref|NP_003167.2| synaptonemal complex protein 1 [Hom... 39 0.097
gi|34854301|ref|XP_342634.1| similar to A-kinase anchor protein ... 39 0.097
>gi|17534001|ref|NP_496523.1| ADP-ribosylation factor domain protein
1 64kD family member (2M102) [Caenorhabditis elegans]
gi|7503328|pir||T22135 hypothetical protein F43G6.8 -
Caenorhabditis elegans
gi|4008359|emb|CAA90397.1| Hypothetical protein F43G6.8
[Caenorhabditis elegans]
Length = 263
Score = 513 bits (1320), Expect = e-144
Identities = 251/263 (95%), Positives = 251/263 (95%)
Frame = -1
Query: 792 MDHGRRRLHSGSTPRGGERPAKRERISVEEQQSQEIRNLKRKLEEARQREDKYIKNEQLH 613
MDHGRRRLHSGSTPRGGERPAKRERISVEEQQSQEIRNLKRKLEEARQREDKYIKNEQLH
Sbjct: 1 MDHGRRRLHSGSTPRGGERPAKRERISVEEQQSQEIRNLKRKLEEARQREDKYIKNEQLH 60
Query: 612 HTAMRSKQQRIERMEKSMESTNRKMYATQCRLNDMENIYDDLEMESKIMADFIDHYYDSR 433
HTAMRSKQQRIERMEKSMESTNRKMYATQCRLNDMENIYDDLEMESKIMADFIDHYYDSR
Sbjct: 61 HTAMRSKQQRIERMEKSMESTNRKMYATQCRLNDMENIYDDLEMESKIMADFIDHYYDSR 120
Query: 432 NITEEDRDELQDKLDEEAANYRDLEDRIKEVRHRDRYMKTVETERKRTTFYRKKMXXXXX 253
NITEEDRDELQDKLDEEAANYRDLEDRIKEVRHRDRYMKTVETERKRTTFYRKKM
Sbjct: 121 NITEEDRDELQDKLDEEAANYRDLEDRIKEVRHRDRYMKTVETERKRTTFYRKKMLELAE 180
Query: 252 XXXXXXXEVTGETPLWKLCEICAHQFSHSDEYVPRVLVCGHTLCTSCIEKLDVGDGIRCP 73
EVTGETPLWKLCEICAHQFSHSDEYVPRVLVCGHTLCTSCIEKLDVGDGIRCP
Sbjct: 181 QLQFEQQEVTGETPLWKLCEICAHQFSHSDEYVPRVLVCGHTLCTSCIEKLDVGDGIRCP 240
Query: 72 FCRTWTNMKRIEALPKNFQILQM 4
FCRTWTNMKRIEALPKNFQILQM
Sbjct: 241 FCRTWTNMKRIEALPKNFQILQM 263