Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F44D12_11
(797 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17540440|ref|NP_501815.1| glycogen synthase alpha family memb... 515 e-145
gi|17506723|ref|NP_491474.1| glycogen synthase kinase family mem... 308 e-104
gi|39584960|emb|CAE64384.1| Hypothetical protein CBG09071 [Caeno... 301 e-103
gi|38422767|emb|CAA20977.2| Hypothetical protein Y106G6D.4 [Caen... 154 2e-36
gi|17510843|ref|NP_492668.1| kinase protein PROT family member (... 154 2e-36
gi|39586278|emb|CAE66689.1| Hypothetical protein CBG12029 [Caeno... 133 4e-30
gi|46431257|gb|EAK90854.1| hypothetical protein CaO19.1593 [Cand... 123 5e-27
gi|48093968|gb|AAT40314.1| glycogen synthase kinase 3 [Chlamydom... 121 2e-26
gi|50551241|ref|XP_503094.1| hypothetical protein [Yarrowia lipo... 120 3e-26
gi|38103528|gb|EAA50213.1| hypothetical protein MG03972.4 [Magna... 119 7e-26
gi|50424313|ref|XP_460743.1| unnamed protein product [Debaryomyc... 119 7e-26
gi|32405824|ref|XP_323525.1| hypothetical protein ( (AL451015) p... 119 7e-26
gi|49067771|ref|XP_398175.1| hypothetical protein UM00560.1 [Ust... 119 1e-25
gi|25287592|pir||C84807 probable cell division control protein k... 118 2e-25
gi|48391484|gb|AAT42372.1| glycogen synthase kinase-3 [Lytechinu... 118 2e-25
gi|11259615|pir||T45138 protein kinase skp1 [imported] - fission... 117 4e-25
gi|19114046|ref|NP_593134.1| protein kinase skp1p [Schizosacchar... 117 4e-25
gi|1877397|emb|CAA72330.1| shaggy-like kinase [Ricinus communis] 116 5e-25
gi|17505909|ref|NP_492367.1| protein kinase PROT family member (... 116 5e-25
gi|15233984|ref|NP_193606.1| shaggy-related protein kinase eta /... 116 5e-25
gi|18700188|gb|AAL77705.1| AT4g18710/F28A21_120 [Arabidopsis tha... 116 5e-25
gi|8393496|ref|NP_059040.1| glycogen synthase kinase 3 alpha [Ra... 116 5e-25
gi|49574532|ref|NP_063937.2| glycogen synthase kinase 3 alpha [H... 116 5e-25
gi|682745|gb|AAA62432.1| glycogen synthase kinase 3 116 5e-25
gi|2959981|emb|CAA10901.1| GSK3 beta [Paracentrotus lividus] 116 5e-25
gi|49098370|ref|XP_410645.1| conserved hypothetical protein [Asp... 116 6e-25
gi|7434281|pir||T03777 probable shaggy-like protein kinase etha ... 116 6e-25
gi|19112356|ref|NP_595564.1| putative serine/threonine protein k... 116 6e-25
gi|11259757|pir||T43008 probable protein kinase (EC 2.7.1.-) - f... 116 6e-25
gi|19112352|ref|NP_595560.1| identical to S.pombe mRNA: DDBJ ACC... 116 6e-25
gi|34902812|ref|NP_912753.1| unnamed protein product [Oryza sati... 115 8e-25
gi|18858781|ref|NP_571465.1| glycogen synthase kinase 3 alpha [D... 115 8e-25
gi|22326813|ref|NP_196968.2| protein kinase family protein [Arab... 115 1e-24
gi|50259653|gb|EAL22323.1| hypothetical protein CNBB4980 [Crypto... 115 1e-24
gi|23487540|gb|EAA21083.1| Protein kinase domain, putative [Plas... 115 1e-24
gi|7229084|dbj|BAA92442.1| glycogen synthase kinase 3 beta [Dani... 115 1e-24
gi|18858783|ref|NP_571456.1| glycogen synthase kinase 3 beta [Da... 115 1e-24
gi|38492874|pdb|1PYX|A Chain A, Gsk-3 Beta Complexed With Amp-Pn... 115 1e-24
gi|42543881|pdb|1UV5|A Chain A, Glycogen Synthase Kinase 3 Beta ... 115 1e-24
gi|9790077|ref|NP_062801.1| glycogen synthase kinase 3 beta [Mus... 115 1e-24
gi|1082745|pir||S53324 glycogen synthase kinase 3 beta (EC 2.7.1... 115 1e-24
gi|20455502|sp|P49841|KG3B_HUMAN Glycogen synthase kinase-3 beta... 115 1e-24
gi|34907628|ref|NP_915161.1| putative cyclin-dependent kinase B1... 115 1e-24
gi|38492892|pdb|1Q3D|A Chain A, Gsk-3 Beta Complexed With Stauro... 115 1e-24
gi|50729544|ref|XP_416557.1| PREDICTED: similar to glycogen synt... 114 2e-24
gi|21361340|ref|NP_002084.2| glycogen synthase kinase 3 beta [Ho... 114 2e-24
gi|33303895|gb|AAQ02461.1| glycogen synthase kinase 3 beta [synt... 114 2e-24
gi|18655515|pdb|1H8F|A Chain A, Glycogen Synthase Kinase 3 Beta.... 114 2e-24
gi|48096736|ref|XP_392504.1| similar to Protein kinase shaggy (P... 114 2e-24
gi|46125903|ref|XP_387505.1| hypothetical protein FG07329.1 [Gib... 114 2e-24
gi|50251690|dbj|BAD27595.1| putative Shaggy-related protein kina... 114 2e-24
gi|50428675|gb|AAT77026.1| putative protein kinase [Oryza sativa... 114 2e-24
gi|33591206|gb|AAQ23107.1| shaggy-related protein kinase 2 [Phys... 114 3e-24
gi|33591208|gb|AAQ23108.1| shaggy-related protein kinase 3 [Phys... 114 3e-24
gi|33591212|gb|AAQ23110.1| shaggy-related protein kinase 5 [Phys... 114 3e-24
gi|33591214|gb|AAQ23111.1| shaggy-related protein kinase 1 [Phys... 114 3e-24
gi|33591204|gb|AAQ23106.1| shaggy-related protein kinase 1 [Phys... 114 3e-24
gi|15224593|ref|NP_180655.1| shaggy-related protein kinase delta... 114 3e-24
gi|125374|sp|P18266|KG3B_RAT Glycogen synthase kinase-3 beta (GS... 114 3e-24
gi|1236190|gb|AAA92823.1| cyclin dependent protein kinase homolo... 114 3e-24
gi|21553877|gb|AAM62970.1| shaggy related protein kinase ASK-GAM... 113 4e-24
gi|15230058|ref|NP_187235.1| shaggy-related protein kinase gamma... 113 4e-24
gi|1431622|emb|CAA67554.1| protein kinase [Trifolium repens] 113 4e-24
gi|12643750|sp|Q39010|KSG6_ARATH Shaggy-related protein kinase d... 113 4e-24
gi|18421039|ref|NP_568486.1| shaggy-related protein kinase alpha... 113 4e-24
gi|2398519|emb|CAA04265.1| shaggy-like kinase alpha [Arabidopsis... 113 4e-24
gi|541901|pir||S41596 protein kinase ASK-alpha (EC 2.7.1.-) [sim... 113 4e-24
gi|1749448|dbj|BAA13782.1| Saccharomyces cerevisiae protein kina... 113 4e-24
gi|2117783|pir||I51425 intracellular kinase (EC 2.7.1.-) - Afric... 113 4e-24
gi|34894416|ref|NP_908533.1| putative shaggy-related protein kin... 113 5e-24
gi|11259751|pir||T48637 protein kinase MSK-3-like - Arabidopsis ... 113 5e-24
gi|7434326|pir||T09586 probable cdc2-like protein kinase cdc2MsD... 113 5e-24
gi|15221476|ref|NP_172127.1| shaggy-related protein kinase iota ... 113 5e-24
gi|11182434|sp|P51139|MSK3_MEDSA Glycogen synthase kinase-3 homo... 113 5e-24
gi|481018|pir||S37642 protein kinase MSK-3 (EC 2.7.1.-) [similar... 113 5e-24
gi|2117784|pir||I51692 glycogen synthase kinase (EC 2.7.1.-) 3 b... 113 5e-24
gi|29249328|gb|EAA40842.1| GLP_154_37233_36121 [Giardia lamblia ... 113 5e-24
gi|11133532|sp|Q40518|MSK1_TOBAC Shaggy-related protein kinase N... 112 7e-24
gi|21745456|gb|AAM77397.1| GSK-like kinase [Triticum aestivum] 112 7e-24
gi|1709128|sp|P51138|MSK2_MEDSA Glycogen synthase kinase-3 homol... 112 7e-24
gi|100915|pir||A40444 protein kinase (EC 2.7.1.37) cdc2 homolog ... 112 7e-24
gi|115923|sp|P23111|CDC2_MAIZE Cell division control protein 2 h... 112 7e-24
gi|1161512|emb|CAA64409.1| shaggy-like kinase etha [Arabidopsis ... 112 9e-24
gi|21593135|gb|AAM65084.1| putative shaggy-like protein kinase d... 112 9e-24
gi|1076649|pir||S51105 shaggy protein kinase 4 (EC 2.7.1.-) - ga... 112 1e-23
gi|6324022|ref|NP_014092.1| Disp. for mitosis, required for chr.... 112 1e-23
gi|1076838|pir||A55476 protein kinase (EC 2.7.1.37) gskA - slime... 112 1e-23
gi|47117857|sp|P51136|KG3H_DICDI Glycogen synthase kinase-3 homo... 112 1e-23
gi|34902408|ref|NP_912550.1| Putative CELL DIVISION CONTROL PROT... 112 1e-23
gi|17510851|ref|NP_492689.1| glycogen synthase alpha family memb... 112 1e-23
gi|24987247|pdb|1GNG|A Chain A, Glycogen Synthase Kinase-3 Beta ... 112 1e-23
gi|47213751|emb|CAF96416.1| unnamed protein product [Tetraodon n... 112 1e-23
gi|3236117|emb|CAA11861.1| shaggy kinase 6 [Petunia x hybrida] 111 2e-23
gi|1504063|emb|CAA68872.1| shaggy-like kinase kappa [Arabidopsis... 111 2e-23
gi|7494175|pir||T18457 glycogen synthase kinase homolog - malari... 111 2e-23
gi|23957759|ref|NP_473241.2| glycogen synthase kinase, putative ... 111 2e-23
gi|1076387|pir||S51938 protein kinase AtK-1 (EC 2.7.1.-) - Arabi... 111 2e-23
gi|1076651|pir||S51106 shaggy protein kinase 6 (EC 2.7.1.-) - ga... 111 2e-23
gi|2911533|emb|CAA58595.1| Petunia Shaggy kinase 6 [Petunia x hy... 111 2e-23
gi|7229082|dbj|BAA92441.1| glycogen synthase kinase 3 alpha [Dan... 111 2e-23
gi|33591210|gb|AAQ23109.1| shaggy-related protein kinase 4 [Phys... 111 2e-23
gi|4096103|gb|AAD10483.1| p34cdc2 [Triticum aestivum] 111 2e-23
gi|231706|sp|P29618|CC21_ORYSA Cell division control protein 2 h... 111 2e-23
gi|18408696|ref|NP_566911.1| cell division control protein 2 hom... 111 2e-23
gi|11259538|pir||T49271 CELL DIVISION CONTROL PROTEIN 2 HOMOLOG ... 111 2e-23
gi|15236918|ref|NP_191981.1| shaggy-related protein kinase theta... 111 2e-23
gi|34810589|pdb|1O9U|A Chain A, Glycogen Synthase Kinase 3 Beta ... 111 2e-23
gi|7434282|pir||T03601 shaggy protein kinase (EC 2.7.1.-) 6 - co... 110 3e-23
gi|11132756|sp|O04160|KSGT_BRANA Shaggy-related protein kinase t... 110 3e-23
gi|47210225|emb|CAF90907.1| unnamed protein product [Tetraodon n... 110 3e-23
gi|7106485|dbj|BAA92186.1| glycogen synthase kinase [Ciona intes... 110 3e-23
gi|100916|pir||B40444 protein kinase (EC 2.7.1.37) cdc2 homolog ... 110 3e-23
gi|6323788|ref|NP_013859.1| Required for Ime1p phosphorylation, ... 110 3e-23
gi|629544|pir||S40469 mitogen-activated protein kinase 3 (EC 2.7... 110 3e-23
gi|295639|gb|AAA16206.1| protein-serine kinase 110 3e-23
gi|15231196|ref|NP_190150.1| mitogen-activated protein kinase, p... 110 3e-23
gi|45269878|gb|AAS56320.1| YMR139W [Saccharomyces cerevisiae] 110 3e-23
gi|7434277|pir||T02297 shaggy protein kinase (EC 2.7.1.-) 91 [si... 110 3e-23
gi|34903768|ref|NP_913231.1| unnamed protein product [Oryza sati... 110 3e-23
gi|1709127|sp|P51137|MSK1_MEDSA Glycogen synthase kinase-3 homol... 110 3e-23
gi|9885801|gb|AAG01533.1| cyclin-dependent kinase B1-2 [Nicotian... 110 3e-23
gi|9885799|gb|AAG01532.1| cyclin-dependent kinase B1-1 [Nicotian... 110 3e-23
gi|6319455|ref|NP_009537.1| Mitogen-activated protein kinase (MA... 110 5e-23
gi|171533|gb|AAA34613.1| FUS3 protein 110 5e-23
gi|19114921|ref|NP_594009.1| mitogen-activated protein kinase sp... 109 6e-23
gi|24637171|gb|AAN63591.1| GSK-3-like protein MsK4 [Medicago sat... 109 6e-23
gi|19699294|gb|AAL91258.1| AT3g48750/T21J18_20 [Arabidopsis thal... 109 8e-23
gi|10896|emb|CAA37419.1| sgg protein kinase [Drosophila melanoga... 109 8e-23
gi|3928148|emb|CAA10288.1| protein kinase [Cicer arietinum] 109 8e-23
gi|50311635|ref|XP_455844.1| unnamed protein product [Kluyveromy... 109 8e-23
gi|3127831|emb|CAA61157.1| protein kinase [Kluyveromyces lactis] 109 8e-23
gi|15217795|ref|NP_176096.1| shaggy-related protein kinase kappa... 109 8e-23
gi|39592422|emb|CAE63499.1| Hypothetical protein CBG07972 [Caeno... 109 8e-23
gi|103318|pir||S10932 probable protein kinase zeste-white3 (EC 2... 108 1e-22
gi|17136458|ref|NP_476715.1| CG2621-PB [Drosophila melanogaster]... 108 1e-22
gi|6957460|emb|CAB72296.1| EG:155E2.3 [Drosophila melanogaster] 108 1e-22
gi|11144|emb|CAA50212.1| protein kinase; sgg protein kinase [Dro... 108 1e-22
gi|50878402|gb|AAT85177.1| putative glycogen synthase kinase [Or... 108 1e-22
gi|45553992|ref|NP_996334.1| CG2621-PK [Drosophila melanogaster]... 108 1e-22
gi|27542763|gb|AAO16696.1| cyclin-dependent kinase-like protein ... 108 1e-22
gi|17509723|ref|NP_493243.1| drosophila ShaGGy homolog, which ha... 108 1e-22
gi|5566268|gb|AAD45354.1| GSK-3 [Caenorhabditis elegans] 108 1e-22
gi|24639383|ref|NP_476716.2| CG2621-PD [Drosophila melanogaster]... 108 1e-22
gi|13124808|sp|P18431|SGG_DROME Protein kinase shaggy (Protein z... 108 1e-22
gi|4157971|emb|CAA19676.1| EG:155E2.3 [Drosophila melanogaster] ... 108 1e-22
gi|17136456|ref|NP_476714.1| CG2621-PA [Drosophila melanogaster]... 108 1e-22
gi|21429198|gb|AAM50318.1| SD09379p [Drosophila melanogaster] 108 1e-22
gi|45554006|ref|NP_996335.1| CG2621-PG [Drosophila melanogaster]... 108 1e-22
gi|7434275|pir||T02254 shaggy protein kinase (EC 2.7.1.-) 111 [s... 108 1e-22
gi|25287630|pir||F86232 hypothetical protein [imported] - Arabid... 108 1e-22
gi|2499616|sp|Q40531|NTF6_TOBAC Mitogen-activated protein kinase... 108 1e-22
gi|15218288|ref|NP_172455.1| shaggy-related protein kinase kappa... 108 1e-22
gi|3396052|gb|AAC28850.1| MAP kinase homolog [Triticum aestivum] 108 1e-22
gi|11125683|emb|CAC15503.1| B1-type cyclin dependent kinase [Lyc... 108 1e-22
gi|21165529|dbj|BAB93532.1| mitogen-activated protein kinase [So... 108 2e-22
gi|12718824|dbj|BAB32406.1| NRK1 MAPK [Nicotiana tabacum] 108 2e-22
gi|34867827|ref|XP_343113.1| similar to MOK protein kinase [Ratt... 108 2e-22
gi|7434276|pir||T02256 shaggy protein kinase (EC 2.7.1.-) 59 [si... 108 2e-22
gi|37536168|ref|NP_922386.1| putative shaggy-like kinase [Oryza ... 108 2e-22
gi|10178642|gb|AAG13665.1| serine/threonine kinase GSK3 [Hydra v... 107 2e-22
gi|8925323|gb|AAF81420.1| MAP kinase 2 [Capsicum annuum] 107 2e-22
gi|50286665|ref|XP_445762.1| unnamed protein product [Candida gl... 107 2e-22
gi|585519|sp|Q07176|MMK1_MEDSA Mitogen-activated protein kinase ... 107 2e-22
gi|1362151|pir||S56638 mitogen-activated protein kinase 1 homolo... 107 2e-22
gi|42572751|ref|NP_974471.1| shaggy-related protein kinase beta ... 107 3e-22
gi|15233049|ref|NP_191675.1| shaggy-related protein kinase beta ... 107 3e-22
gi|7657498|ref|NP_055041.1| renal tumor antigen; renal cell carc... 107 4e-22
gi|4557439|ref|NP_001249.1| cyclin-dependent kinase 3 [Homo sapi... 107 4e-22
gi|37619789|emb|CAA86858.2| Hypothetical protein R03D7.5 [Caenor... 106 5e-22
gi|40645549|dbj|BAD06585.1| MAP kinase [Candida tropicalis] 106 5e-22
gi|21165525|dbj|BAB93530.1| mitogen-activated protein kinase [So... 106 7e-22
gi|30171843|gb|AAP20420.1| mitogen-activated protein kinase 2 [L... 106 7e-22
gi|50293323|ref|XP_449073.1| unnamed protein product [Candida gl... 106 7e-22
gi|45725015|emb|CAG23921.1| putative mitogen-activated protein k... 106 7e-22
gi|8132287|gb|AAF73236.1| MAP kinase 3 [Pisum sativum] 106 7e-22
gi|25989353|gb|AAL47482.1| cyclin-dependent kinase [Helianthus t... 106 7e-22
gi|7489556|pir||T04119 probable serine/threonine protein kinase ... 105 9e-22
gi|24651631|ref|NP_733426.1| CG31003-PA [Drosophila melanogaster... 105 9e-22
gi|45188126|ref|NP_984349.1| ADR253Wp [Eremothecium gossypii] >g... 105 9e-22
gi|4836599|gb|AAD30494.1| cell division control protein 2 [Phase... 105 9e-22
gi|27374990|dbj|BAC53772.1| salicylic acid-induced protein kinas... 105 9e-22
gi|46437538|gb|EAK96883.1| hypothetical protein CaO19.460 [Candi... 105 9e-22
gi|1709098|sp|P50873|MRK1_YEAST Serine/threonine-protein kinase ... 105 1e-21
gi|585454|sp|Q06060|MAPK_PEA Mitogen-activated protein kinase ho... 105 1e-21
gi|11869991|gb|AAG40579.1| MAP kinase 1 [Oryza sativa] >gnl|BL_O... 105 1e-21
gi|12698876|gb|AAK01710.1| MAP kinase BIMK1 [Oryza sativa] 105 1e-21
gi|10862876|emb|CAC13967.1| MAPK2 protein [Oryza sativa] 105 1e-21
gi|6320124|ref|NP_010204.1| putative protein kinase with similar... 105 1e-21
gi|24636265|sp|P93101|CDC2_CHERU Cell division control protein 2... 105 1e-21
gi|27476068|gb|AAO16999.1| Putative MAP kinase 1 [Oryza sativa (... 105 1e-21
gi|50421959|ref|XP_459540.1| unnamed protein product [Debaryomyc... 105 1e-21
gi|47226970|emb|CAG05862.1| unnamed protein product [Tetraodon n... 105 1e-21
gi|12001934|gb|AAG43110.1| CEK2 [Candida albicans] 105 1e-21
gi|49077282|ref|XP_402517.1| hypothetical protein UM04902.1 [Ust... 105 1e-21
gi|2852373|gb|AAC98088.1| mitogen-activated protein kinase [Pneu... 104 2e-21
gi|11275338|dbj|BAB18271.1| mitogen-activated protein kinase [Ch... 104 2e-21
gi|3702608|emb|CAA11862.1| shaggy kinase 7 [Petunia x hybrida] 104 2e-21
gi|7106391|ref|NP_036103.1| renal tumor antigen; MAPK/MAK/MRK/ o... 104 2e-21
gi|541800|pir||S42049 protein kinase (EC 2.7.1.37) cdc2 - Norway... 104 2e-21
gi|2956719|emb|CAA12223.1| cyclin dependent kinase 2 [Sphaerechi... 104 2e-21
gi|7434328|pir||T09622 protein kinase MMK4 (EC 2.7.1.-), cold- a... 104 2e-21
gi|50546527|ref|XP_500733.1| hypothetical protein [Yarrowia lipo... 104 2e-21
gi|32187089|gb|AAP73784.1| cyclin-dependent kinase [Populus trem... 104 2e-21
gi|4456682|emb|CAB37188.1| MAP kinase [Medicago sativa] 104 2e-21
gi|30171839|gb|AAP20419.1| mitogen-activated protein kinase 1 [L... 104 2e-21
gi|21165523|dbj|BAB93529.1| mitogen-activated protein kinase [So... 104 2e-21
gi|50426821|ref|XP_462008.1| unnamed protein product [Debaryomyc... 104 2e-21
gi|7649153|gb|AAF65766.1| mitogen-activated protein kinase [Euph... 104 2e-21
gi|5921443|sp|Q38772|CC2A_ANTMA Cell division control protein 2 ... 104 2e-21
gi|8671339|emb|CAA56815.2| cdc2Pnc [Pinus contorta] 104 2e-21
gi|2138340|gb|AAB58396.1| salicylic acid-activated MAP kinase [N... 104 2e-21
gi|7489305|pir||T17115 protein kinase cdc2a (EC 2.7.1.-), cyclin... 104 2e-21
gi|1168810|sp|P43063|CC28_CANAL Cell division control protein 28... 103 3e-21
gi|25287625|pir||C86214 hypothetical protein [imported] - Arabid... 103 3e-21
gi|42656289|ref|XP_293029.3| similar to cyclin-dependent kinase-... 103 3e-21
gi|24412848|emb|CAD54741.1| putative mitogen-activated protein k... 103 3e-21
gi|6491800|emb|CAB61889.1| MAPK4 protein [Oryza sativa] 103 3e-21
gi|11869994|gb|AAG40580.1| MAP kinase 2 [Oryza sativa] 103 3e-21
gi|17224978|gb|AAL37195.1| cyclin dependent kinase [Helianthus a... 103 3e-21
gi|7434315|pir||T14915 mitogen-activated protein kinase I (EC 2.... 103 3e-21
gi|50308563|ref|XP_454284.1| unnamed protein product [Kluyveromy... 103 3e-21
gi|37813142|gb|AAR04351.1| putative MAPK [Tetrahymena thermophila] 103 3e-21
gi|27450763|gb|AAO14684.1| shaggy-like kinase [Pyrocystis lunula] 103 3e-21
gi|15232441|ref|NP_190986.1| cell division control protein 2 hom... 103 3e-21
gi|7434274|pir||T01756 hypothetical protein A_IG002P16.21 - Arab... 103 4e-21
gi|10185114|emb|CAC08564.1| wound-induced GSK-3-like protein [Me... 103 4e-21
gi|25052802|gb|AAN65179.1| mitogen-activated protein kinase 6 [P... 103 4e-21
gi|29849|emb|CAA43807.1| CDK2 [Homo sapiens] 103 4e-21
gi|38109914|gb|EAA55711.1| hypothetical protein MG01362.4 [Magna... 103 4e-21
gi|18415242|ref|NP_567574.1| protein kinase, putative [Arabidops... 103 4e-21
gi|15224359|ref|NP_181907.1| mitogen-activated protein kinase, p... 103 4e-21
gi|30684655|ref|NP_849407.1| protein kinase, putative [Arabidops... 103 4e-21
gi|40804978|gb|AAR91747.1| cyclin-dependent serine/threonine pro... 103 4e-21
gi|49071314|ref|XP_399946.1| hypothetical protein UM02331.1 [Ust... 103 6e-21
gi|422069|pir||A47211 protein kinase ERK (EC 2.7.1.-) CEK1 - yea... 103 6e-21
gi|312803|emb|CAA43985.1| cdk2 [Homo sapiens] 103 6e-21
gi|5921709|sp|O55076|CDK2_CRIGR Cell division protein kinase 2 >... 103 6e-21
gi|18655411|pdb|1GII|A Chain A, Human Cyclin Dependent Kinase 2 ... 103 6e-21
gi|34809859|pdb|1H01|A Chain A, Cdk2 In Complex With A Disubstit... 103 6e-21
gi|40889309|pdb|1PF8|A Chain A, Crystal Structure Of Human Cycli... 103 6e-21
gi|6166046|sp|Q63699|CDK2_RAT Cell division protein kinase 2 >gn... 103 6e-21
gi|7949020|ref|NP_058036.1| cyclin-dependent kinase 2 isoform 2 ... 103 6e-21
gi|1345715|sp|P48963|CDK2_MESAU Cell division protein kinase 2 >... 103 6e-21
gi|16936528|ref|NP_001789.2| cyclin-dependent kinase 2 isoform 1... 103 6e-21
gi|7488272|pir||T04432 protein kinase homolog T18B16.80 - Arabid... 103 6e-21
gi|4139569|pdb|1B38|A Chain A, Human Cyclin-Dependent Kinase 2 >... 103 6e-21
gi|34809870|pdb|1OIT|A Chain A, Imidazopyridines: A Potent And S... 103 6e-21
gi|33356961|pdb|1GZ8|A Chain A, Human Cyclin Dependent Kinase 2 ... 103 6e-21
gi|34809869|pdb|1OIR|A Chain A, Imidazopyridines: A Potent And S... 103 6e-21
gi|30583821|gb|AAP36159.1| Homo sapiens cyclin-dependent kinase ... 103 6e-21
gi|25052806|gb|AAN65181.1| mitogen-activated protein kinase 3b [... 103 6e-21
gi|21902501|gb|AAM78549.1| cyclin-dependent kinase CDK-4/6 [Caen... 103 6e-21
gi|39595867|emb|CAE67370.1| Hypothetical protein CBG12846 [Caeno... 103 6e-21
gi|50514017|pdb|1VYW|A Chain A, Structure Of Cdk2CYCLIN A WITH P... 103 6e-21
gi|50404854|ref|YP_053946.1| MAP kinase, putative [Paramecium te... 102 7e-21
gi|24158643|pdb|1H1P|A Chain A, Structure Of Human Thr160-Phosph... 102 7e-21
gi|1942625|pdb|1JST|A Chain A, Phosphorylated Cyclin-Dependent K... 102 7e-21
gi|1196796|gb|AAC41680.1| protein kinase p34cdc2 102 7e-21
gi|6730495|pdb|1QMZ|A Chain A, Phosphorylated Cdk2-Cyclyin A-Sub... 102 7e-21
gi|533281|dbj|BAA03536.1| ATMPK2 [Arabidopsis thaliana] 102 7e-21
gi|16975317|pdb|1E9H|A Chain A, Thr 160 Phosphorylated Cdk2 - Hu... 102 7e-21
gi|2129855|pir||S60121 mitogen-activated protein kinase MMK2 (EC... 102 7e-21
gi|38122752|gb|AAR11450.1| salt-induced MAP kinase 1 [Zea mays] 102 7e-21
gi|34810054|pdb|1OGU|A Chain A, Structure Of Human Thr160-Phosph... 102 7e-21
gi|30171845|gb|AAP20421.1| mitogen-activated protein kinase 3 [L... 102 7e-21
gi|13811965|ref|NP_113094.1| putative protein kinase [Guillardia... 102 9e-21
gi|5921446|sp|Q38774|CC2C_ANTMA Cell division control protein 2 ... 102 9e-21
gi|7434295|pir||T03971 mitogen-activated protein kinase (EC 2.7.... 102 9e-21
gi|19263187|gb|AAL40897.1| extracellular signal-regulated kinase... 102 9e-21
gi|45187705|ref|NP_983928.1| ADL168Cp [Eremothecium gossypii] >g... 102 9e-21
gi|38082906|ref|XP_355031.1| similar to cyclin-dependent kinase-... 102 9e-21
gi|3123616|emb|CAA76701.1| cyclin-dependent protein kinase p34cd... 102 9e-21
gi|22266163|emb|CAD43850.1| cell division cycle protein 2 [Daucu... 102 9e-21
gi|2289782|dbj|BAA21673.1| cdc2 kinase [Allium cepa] 102 9e-21
gi|2499615|sp|Q40532|NTF4_TOBAC Mitogen-activated protein kinase... 102 9e-21
gi|41745824|gb|AAS10184.1| mitogen-activated protein kinase [Ent... 102 9e-21
gi|50302351|ref|XP_451110.1| unnamed protein product [Kluyveromy... 102 1e-20
gi|32563948|ref|NP_494947.2| mitogen-activated Protein Kinase (m... 102 1e-20
gi|50811836|ref|NP_998571.1| cyclin-dependent kinase 2 [Danio re... 102 1e-20
gi|1168865|sp|P43450|CDK2_CARAU Cell division protein kinase 2 >... 102 1e-20
gi|25141338|ref|NP_494946.2| mitogen-activated Protein Kinase (m... 102 1e-20
gi|39587486|emb|CAE58424.1| Hypothetical protein CBG01555 [Caeno... 102 1e-20
gi|7495390|pir||T29599 hypothetical protein C04G6.1 - Caenorhabd... 102 1e-20
gi|1169549|sp|P28869|ERK1_CANAL Extracellular signal-regulated k... 102 1e-20
gi|50773534|ref|XP_427196.1| PREDICTED: similar to Cell division... 102 1e-20
gi|50727074|gb|AAT81209.1| Map kinase protein 2, isoform c [Caen... 102 1e-20
gi|6624279|dbj|BAA88508.1| Ser/Thr kinase KKIAMRE [Oryctolagus c... 102 1e-20
gi|1169550|sp|P42525|ERK1_DICDI Extracellular signal-regulated k... 101 2e-20
gi|30348584|emb|CAD43731.1| MAP kinase [Ustilago maydis] 101 2e-20
gi|1362214|pir||A56042 mitogen-activated protein kinase (EC 2.7.... 101 2e-20
gi|231707|sp|P29619|CC22_ORYSA Cell division control protein 2 h... 101 2e-20
gi|34810067|pdb|1OVE|A Chain A, The Structure Of P38 Alpha In Co... 101 2e-20
gi|4887127|gb|AAD32204.1| putative mitogen-activated protein kin... 101 2e-20
gi|45198537|ref|NP_985566.1| AFR019Wp [Eremothecium gossypii] >g... 101 2e-20
gi|42627725|dbj|BAD11137.1| mitogen-activated protein kinase [Co... 101 2e-20
gi|533280|dbj|BAA03535.1| ATMPK1 [Arabidopsis thaliana] 101 2e-20
gi|15231753|ref|NP_191538.1| mitogen-activated protein kinase, p... 101 2e-20
gi|18406388|ref|NP_564746.1| mitogen-activated protein kinase, p... 101 2e-20
gi|2499613|sp|Q40353|MMK2_MEDSA Mitogen-activated protein kinase... 101 2e-20
gi|8132347|gb|AAF73257.1| MAP kinase PsMAPK2 [Pisum sativum] 101 2e-20
gi|5007038|gb|AAD37790.1| MAP kinase [Ipomoea batatas] 101 2e-20
gi|1346567|sp|P47812|MK14_XENLA Mitogen-activated protein kinase... 101 2e-20
gi|8860|emb|CAA37951.1| protein kinase [Drosophila melanogaster]... 101 2e-20
gi|47124901|gb|AAH70644.1| MGC81521 protein [Xenopus laevis] 101 2e-20
gi|32414773|ref|XP_327866.1| hypothetical protein ( (AF116453) c... 101 2e-20
gi|41053019|dbj|BAD07950.1| putative p34cdc2 [Oryza sativa (japo... 101 2e-20
gi|7434293|pir||T08065 protein kinase (EC 2.7.1.37) cdc2 - green... 101 2e-20
gi|46437168|gb|EAK96519.1| hypothetical protein CaO19.2886 [Cand... 101 2e-20
gi|1420882|emb|CAA67342.1| cdec2-related kinase [Theileria parva] 101 2e-20
gi|3608177|dbj|BAA33152.1| cdc2 [Pisum sativum] 101 2e-20
gi|24636266|sp|Q41639|CDC2_VIGAC Cell division control protein 2... 101 2e-20
gi|7341300|gb|AAF61238.1| MAP kinase MAPK2 [Oryza sativa] >gnl|B... 101 2e-20
gi|2499614|sp|Q40517|NTF3_TOBAC Mitogen-activated protein kinase... 101 2e-20
gi|49671277|gb|AAH75368.1| Unknown (protein for MGC:89076) [Xeno... 101 2e-20
gi|30962145|emb|CAD59691.1| Mitogen-activated protein kinase [Ly... 101 2e-20
gi|17535411|ref|NP_496356.1| protein kinase family member (2L239... 101 2e-20
gi|3212538|pdb|1IAN| Human P38 Map Kinase Inhibitor Complex 100 3e-20
gi|2554639|pdb|1WFC| Structure Of Apo, Unphosphorylated, P38 Mi... 100 3e-20
gi|50553802|ref|XP_504312.1| hypothetical protein [Yarrowia lipo... 100 3e-20
gi|12005890|gb|AAG44657.1| MAP kinase 1 [Gaeumannomyces graminis] 100 3e-20
gi|25989351|gb|AAL47481.1| cyclin-dependent kinase [Helianthus t... 100 3e-20
gi|33324533|gb|AAQ08004.1| Cdk1 protein kinase [Cryptococcus neo... 100 3e-20
gi|629546|pir||S40471 mitogen-activated protein kinase 5 (EC 2.7... 100 3e-20
gi|37927357|pdb|1OZ1|A Chain A, P38 Mitogen-Activated Kinase In ... 100 3e-20
gi|30584111|gb|AAP36304.1| Homo sapiens mitogen-activated protei... 100 3e-20
gi|4929863|pdb|1A9U| The Complex Structure Of The Map Kinase P3... 100 3e-20
gi|20986512|ref|NP_620581.1| mitogen-activated protein kinase 14... 100 3e-20
gi|11558194|emb|CAC17703.1| cyclin dependent kinase (cdc2b) [Che... 100 4e-20
gi|29427835|sp|Q8NK05|CPK1_CRYNE Mitogen-activated protein kinas... 100 4e-20
gi|2499612|sp|Q40884|MAPK_PETHY Mitogen-activated protein kinase... 100 4e-20
gi|21591757|gb|AAM64214.1| Hog1p-like protein [Hortaea werneckii] 100 4e-20
gi|2117788|pir||S57928 protein kinase (EC 2.7.1.37) cdc2 homolog... 100 4e-20
gi|1705676|sp|P52389|CDC2_VIGUN Cell division control protein 2 ... 100 4e-20
gi|23344742|gb|AAN28684.1| cell cycle related kinase [Homo sapiens] 100 4e-20
gi|4096105|gb|AAD10484.1| p34cdc2 [Triticum aestivum] 100 4e-20
gi|42109009|emb|CAF25030.1| mitogen-activated protein kinase [Ar... 100 4e-20
gi|17541722|ref|NP_501365.1| p38 Map Kinase (43.9 kD) (pmk-1) [C... 100 4e-20
gi|39591174|emb|CAE73227.1| Hypothetical protein CBG20633 [Caeno... 100 4e-20
gi|50304029|ref|XP_451964.1| unnamed protein product [Kluyveromy... 100 4e-20
gi|11125685|emb|CAC15504.1| B2-type cyclin dependent kinase [Lyc... 100 5e-20
gi|849068|dbj|BAA09369.1| cdc2 homolog [Nicotiana tabacum] 100 5e-20
gi|9885803|gb|AAG01534.1| cyclin-dependent kinase A:4 [Nicotiana... 100 5e-20
gi|15218451|ref|NP_172492.1| mitogen-activated protein kinase, p... 100 5e-20
gi|4239889|dbj|BAA74734.1| MAP kinase 5 [Zea mays] 100 5e-20
gi|5921445|sp|Q38773|CC2B_ANTMA Cell division control protein 2 ... 100 5e-20
gi|27374988|dbj|BAC53771.1| wound-inuduced protein kinase [Nicot... 100 5e-20
gi|32130551|gb|AAO86687.1| long flagella protein LF4 [Chlamydomo... 100 5e-20
gi|49093716|ref|XP_408319.1| CDC2_EMENI Cell division control pr... 100 5e-20
gi|2564703|gb|AAC06329.1| Cdc2 cyclin-dependent kinase [Pneumocy... 100 5e-20
gi|2564701|gb|AAD05577.1| Cdc2 cyclin-dependent kinase [Pneumocy... 100 5e-20
gi|17551028|ref|NP_510429.1| glycogen synthase kinase 3 beta (XP... 100 5e-20
gi|3024155|sp|O02812|MK14_CANFA Mitogen-activated protein kinase... 100 5e-20
gi|25052804|gb|AAN65180.1| mitogen-activated protein kinase 4 [P... 100 5e-20
gi|39595255|emb|CAE60292.1| Hypothetical protein CBG03876 [Caeno... 100 5e-20
gi|27803020|emb|CAD60723.1| unnamed protein product [Podospora a... 100 6e-20
gi|18143321|dbj|BAB79636.1| wound induced protein kinase [Nicoti... 100 6e-20
gi|33088202|gb|AAP93200.1| mitogen activated protein kinase [Cor... 100 6e-20
gi|31322228|gb|AAO63561.1| mitogen activated protein kinase [Ver... 100 6e-20
gi|25287596|pir||T51944 pathogenicity MAP kinase 1 [imported] - ... 100 6e-20
gi|38107672|gb|EAA53815.1| hypothetical protein MG09565.4 [Magna... 100 6e-20
gi|33242579|gb|AAQ01000.1| MAP kinase 1 [Cordyceps bassiana] >gn... 100 6e-20
gi|6321477|ref|NP_011554.1| Recovery from alpha factor arrest; K... 100 6e-20
gi|1419310|emb|CAA67306.1| cdc2-like kinase [Theileria annulata] 100 6e-20
gi|39596818|emb|CAE59045.1| Hypothetical protein CBG02327 [Caeno... 100 6e-20
gi|6457321|gb|AAF09475.1| osmotic sensitivity MAP Kinase [Magnap... 100 6e-20
gi|19112421|ref|NP_595629.1| cell division control protein 2 [Sc... 100 6e-20
gi|45477412|gb|AAP93199.2| mitogen activated protein kinase [Met... 100 6e-20
gi|18479080|gb|AAL73403.1| pathogenicity MAP kinase 1 [Gibberell... 100 6e-20
gi|46124015|ref|XP_386561.1| hypothetical protein FG06385.1 [Gib... 100 6e-20
gi|9858841|gb|AAG01162.1| mitogen-activated protein kinase [Fusa... 100 6e-20
gi|41688570|sp|Q00859|MAPK_FUSSO Mitogen-activated protein kinas... 100 6e-20
gi|13620175|emb|CAC36428.1| mitogen activated protein kinase [Gi... 100 6e-20
gi|50421845|ref|XP_459480.1| unnamed protein product [Debaryomyc... 100 6e-20
gi|15526337|emb|CAA04648.2| cdc2-related kinase 3 [Leishmania me... 99 8e-20
gi|4185262|gb|AAD08994.1| cdc2-related kinase [Leishmania major] 99 8e-20
gi|18076013|emb|CAD20058.1| cdc2-related kinase 3 [Leishmania do... 99 8e-20
gi|2795859|gb|AAB97138.1| MAP kinase [Drosophila melanogaster] 99 8e-20
gi|17137202|ref|NP_477163.1| CG5475-PA [Drosophila melanogaster]... 99 8e-20
gi|18413509|ref|NP_567378.1| mitogen-activated protein kinase, p... 99 8e-20
gi|21431796|sp|Q39025|MPK5_ARATH Mitogen-activated protein kinas... 99 8e-20
gi|115924|sp|P24923|CC21_MEDSA Cell division control protein 2 h... 99 8e-20
gi|19577355|emb|CAD28436.1| probable osmotic sensitivity map kin... 99 8e-20
gi|23664456|gb|AAM89501.1| mitogen-activated protein kinase [Lep... 99 8e-20
gi|32421451|ref|XP_331169.1| hypothetical protein ( (AF348490) M... 99 8e-20
gi|14030263|gb|AAK52840.1| mitogen-activated protein kinase [Pyr... 99 8e-20
gi|7434325|pir||T13024 probable protein kinase (EC 2.7.1.-) F8L2... 99 8e-20
gi|2589145|dbj|BAA23218.1| p34cdc2 [Hemicentrotus pulcherrimus] 99 8e-20
gi|29500879|emb|CAD59793.1| mitogen-activated protein kinase [Or... 99 1e-19
gi|50291947|ref|XP_448406.1| unnamed protein product [Candida gl... 99 1e-19
gi|1362556|pir||S53538 protein kinase (EC 2.7.1.37) cdc2 homolog... 99 1e-19
gi|23534536|gb|AAN34610.1| MAP kinase TmkA [Hypocrea virens] 99 1e-19
gi|7434290|pir||T02922 protein kinase (EC 2.7.1.37) cdc2 homolog... 99 1e-19
gi|7498700|pir||T15983 hypothetical protein F09C12.2 - Caenorhab... 99 1e-19
gi|15224120|ref|NP_179409.1| mitogen-activated protein kinase, p... 99 1e-19
gi|629548|pir||S40473 mitogen-activated protein kinase 7 (EC 2.7... 99 1e-19
gi|37536404|ref|NP_922504.1| putative serine/threonine protein k... 99 1e-19
gi|13249052|gb|AAK16652.1| CDC2 homolog [Populus tremula x Popul... 99 1e-19
gi|727249|gb|AAA79977.1| CDC2 99 1e-19
gi|34853514|ref|XP_215467.2| cyclin-dependent kinase 7 (MO15 hom... 99 1e-19
gi|16716469|ref|NP_444410.1| cell cycle related kinase; CDK-rela... 99 1e-19
gi|10798897|gb|AAG23132.1| MAP kinase [Botryotinia fuckeliana] 99 1e-19
gi|21636306|gb|AAM69918.1| MAP kinase Tmk1 [Trichoderma atroviride] 99 1e-19
gi|5739482|gb|AAD50496.1| mitogen activated protein kinase [Coll... 99 1e-19
gi|33860247|gb|AAQ54908.1| mitogen activated protein kinase SMK1... 99 1e-19
gi|12657601|dbj|BAB21569.1| mitogen-activated protein kinase [Gl... 99 1e-19
gi|49092790|ref|XP_407856.1| hypothetical protein AN3719.2 [Aspe... 99 1e-19
gi|6224710|gb|AAF05913.1| mitogen-activated protein kinase [Coch... 99 1e-19
gi|10092590|ref|NP_036081.1| mitogen activated protein kinase 14... 99 1e-19
gi|1916984|gb|AAB51285.1| p38 mitogen activated protein kinase [... 99 1e-19
gi|10046831|emb|CAC07956.1| putative mitogen-activated protein k... 99 1e-19
gi|13591928|ref|NP_112282.1| mitogen activated protein kinase 14... 99 1e-19
gi|2914479|pdb|1P38| The Structure Of The Map Kinase P38 At 2.1... 99 1e-19
gi|50423197|ref|XP_460179.1| unnamed protein product [Debaryomyc... 99 1e-19
gi|32565867|ref|NP_872069.1| predicted CDS, mitogen-activated Pr... 99 1e-19
gi|32419969|ref|XP_330428.1| CELL DIVISION CONTROL PROTEIN 2 (CY... 99 1e-19
gi|15218072|ref|NP_173517.1| cell division control protein, puta... 99 1e-19
gi|21536682|gb|AAM61014.1| putative cell division control protei... 99 1e-19
gi|432560|gb|AAB28424.1| Cdc2E10 product {P element-induced L to... 99 1e-19
gi|39596586|emb|CAE63205.1| Hypothetical protein CBG07560 [Caeno... 99 1e-19
gi|2828688|gb|AAC27446.1| protein kinase 3 [Toxoplasma gondii] 98 2e-19
gi|37496992|dbj|BAC98412.1| Cdc2 homologue [Halocynthia roretzi] 98 2e-19
gi|42362295|gb|AAS13369.1| cyclin-dependent kinases CDKB [Glycin... 98 2e-19
gi|45160119|gb|AAS55115.1| mitogen activated protein kinase 4 [T... 98 2e-19
gi|47551261|ref|NP_999813.1| MAP kinase [Strongylocentrotus purp... 98 2e-19
gi|46136193|ref|XP_389788.1| hypothetical protein FG09612.1 [Gib... 98 2e-19
gi|37907667|gb|AAP48614.1| MAP kinase TMK3 [Trichoderma atroviride] 98 2e-19
gi|19113755|ref|NP_592843.1| mitogen-activated protein kinase st... 98 2e-19
gi|15147362|gb|AAG53654.2| MAP kinase-I [Blumeria graminis] 98 2e-19
gi|48095386|ref|XP_394432.1| similar to ENSANGP00000004533 [Apis... 98 2e-19
gi|16217|emb|CAA40972.1| p34(cdc2)-like protein [Arabidopsis tha... 98 2e-19
gi|39645509|gb|AAH63937.1| Mapk14b protein [Danio rerio] 98 2e-19
gi|7305253|ref|NP_038899.1| mitogen-activated protein kinase 12;... 98 2e-19
gi|6319636|ref|NP_009718.1| Catalytic subunit of the main cell c... 98 2e-19
gi|20068275|emb|CAD29319.1| cyclin-dependent kinase [Juglans nig... 98 2e-19
gi|1168866|sp|P23437|CDK2_XENLA Cell division protein kinase 2 (... 98 2e-19
gi|104008|pir||A37871 protein kinase (EC 2.7.1.37) cdk2 - Africa... 98 2e-19
gi|32709397|gb|AAP86959.1| ERK-like protein CpMK2 [Cryphonectria... 98 2e-19
gi|4506089|ref|NP_002738.1| mitogen-activated protein kinase 4; ... 98 2e-19
gi|14624994|dbj|BAB61877.1| cyclin-dependent kinase 1 [Acrosipho... 98 2e-19
gi|19113141|ref|NP_596349.1| cdk-activating kinase [Schizosaccha... 97 3e-19
gi|25287633|pir||C86146 hypothetical protein F22L4.10 [imported]... 97 3e-19
gi|50289387|ref|XP_447125.1| unnamed protein product [Candida gl... 97 3e-19
gi|3123614|emb|CAA76700.1| cyclin-dependent protein kinase p34cd... 97 3e-19
gi|1835258|emb|CAA99991.1| cdc2 kinase homologue [Sesbania rostr... 97 3e-19
gi|50290919|ref|XP_447892.1| unnamed protein product [Candida gl... 97 3e-19
gi|1705723|sp|Q03147|CDK7_MOUSE Cell division protein kinase 7 (... 97 3e-19
gi|1083627|pir||S51085 CdK-activating kinase Cdk7 - rat (fragmen... 97 3e-19
gi|46122031|ref|XP_385569.1| hypothetical protein FG05393.1 [Gib... 97 3e-19
gi|45185497|ref|NP_983213.1| ACL191Cp [Eremothecium gossypii] >g... 97 3e-19
gi|48104548|ref|XP_395800.1| similar to ENSANGP00000002848 [Apis... 97 3e-19
gi|21165527|dbj|BAB93531.1| mitogen-activated protein kinase [So... 97 3e-19
gi|45826465|gb|AAS77871.1| mitogen-activated protein kinase [Cor... 97 3e-19
gi|1705724|sp|P51952|CDK7_RAT Cell division protein kinase 7 (CD... 97 3e-19
gi|49073396|ref|XP_400920.1| conserved hypothetical protein [Ust... 97 4e-19
gi|19075421|ref|NP_587921.1| cyclin-dependent protein kinase pho... 97 4e-19
gi|8925321|gb|AAF81419.1| MAP kinase 1 [Capsicum annuum] 97 4e-19
gi|37805857|dbj|BAC99508.1| putative mitogen-activated protein k... 97 4e-19
gi|46128181|ref|XP_388644.1| CDC2_AJECA Cell division control pr... 97 4e-19
gi|15072770|emb|CAC47939.1| MAP kinase 1 [Claviceps purpurea] 97 4e-19
gi|26396333|sp|Q9I958|M14B_CYPCA Mitogen-activated protein kinas... 97 4e-19
gi|11120692|ref|NP_068514.1| SAP kinase-3 [Rattus norvegicus] >g... 97 4e-19
gi|19074550|ref|NP_586056.1| MRK1-LIKE SER/THR PROTEIN KINASE [E... 97 4e-19
gi|47225786|emb|CAF98266.1| unnamed protein product [Tetraodon n... 97 5e-19
gi|27542952|gb|AAO16560.1| mitogen-activated protein kinase [Tri... 97 5e-19
gi|24660567|ref|NP_729319.1| CG7892-PA [Drosophila melanogaster]... 97 5e-19
gi|47226912|emb|CAG05804.1| unnamed protein product [Tetraodon n... 97 5e-19
gi|49257630|gb|AAH74266.1| Mapk14a-prov protein [Xenopus laevis] 97 5e-19
gi|45201143|ref|NP_986713.1| AGR048Cp [Eremothecium gossypii] >g... 97 5e-19
gi|24660555|ref|NP_729316.1| CG7892-PE [Drosophila melanogaster]... 97 5e-19
gi|1362620|pir||B54843 nemo, form II - fruit fly (Drosophila mel... 97 5e-19
gi|1377888|gb|AAB02567.1| cdc2 gene product 97 5e-19
gi|1575290|gb|AAB09465.1| p34 cdc2 kinase [Mus musculus] 97 5e-19
gi|32413661|ref|XP_327310.1| MITOGEN-ACTIVATED PROTEIN KINASE ST... 97 5e-19
gi|23489870|gb|EAA21777.1| cdc2-related kinase 2 [Plasmodium yoe... 97 5e-19
gi|1362619|pir||A54843 nemo, form I - fruit fly (Drosophila mela... 97 5e-19
gi|15077322|gb|AAK83124.1| osmotic sensitive-2 [Neurospora crass... 97 5e-19
gi|49121170|ref|XP_412398.1| hypothetical protein AN8261.2 [Aspe... 96 7e-19
gi|45504120|dbj|BAD12561.1| mitogen-activated protein kinase Mpk... 96 7e-19
gi|2960401|dbj|BAA25143.1| Zhog2p [Zygosaccharomyces rouxii] 96 7e-19
gi|21537217|gb|AAM61558.1| putative cell division control protei... 96 7e-19
gi|28172866|emb|CAD56245.1| putative cyclin dependent kinase A [... 96 7e-19
gi|45200855|ref|NP_986425.1| AGL242Cp [Eremothecium gossypii] >g... 96 7e-19
gi|45187558|ref|NP_983781.1| ADL315Cp [Eremothecium gossypii] >g... 96 7e-19
gi|3643645|gb|AAC42260.1| cyclin-dependent protein kinase PHOA(M... 96 7e-19
gi|47682830|gb|AAH70640.1| MGC81499 protein [Xenopus laevis] 96 7e-19
gi|432562|gb|AAB28426.1| Cdc2E1-9 product {P element-induced P t... 96 7e-19
gi|7434327|pir||T09591 probable cdc2-like protein kinase cdc2MsF... 96 7e-19
gi|15223081|ref|NP_177780.1| cell division control protein, puta... 96 7e-19
gi|15234397|ref|NP_195363.1| mitogen-activated protein kinase, p... 96 7e-19
gi|27312014|gb|AAN75065.2| mitogen-activated protein kinase [Mal... 96 7e-19
gi|2131000|emb|CAB09307.1| MAP-kinase homologue [Leishmania mexi... 96 7e-19
gi|3776100|emb|CAA11852.1| cdc2-related kinase 2 [Plasmodium kno... 96 9e-19
gi|50311899|ref|XP_455981.1| unnamed protein product [Kluyveromy... 96 9e-19
gi|2960352|emb|CAA12343.1| cyclin dependent kinase 1 [Sphaerechi... 96 9e-19
gi|4502743|ref|NP_001790.1| cyclin-dependent kinase 7; cyclin-de... 96 9e-19
gi|17136606|ref|NP_476797.1| CG5363-PA [Drosophila melanogaster]... 96 9e-19
gi|432557|gb|AAB28421.1| Cdc2E1-4 product {P element-induced G t... 96 9e-19
gi|33304107|gb|AAQ02561.1| cyclin-dependent kinase 7 [synthetic ... 96 9e-19
gi|47087325|ref|NP_998638.1| zgc:55498 [Danio rerio] >gnl|BL_ORD... 96 9e-19
gi|4503069|ref|NP_001306.1| mitogen-activated protein kinase 14 ... 96 9e-19
>gi|17540440|ref|NP_501815.1| glycogen synthase alpha family member
(4K802) [Caenorhabditis elegans]
gi|7503371|pir||T22168 hypothetical protein F44D12.11 -
Caenorhabditis elegans
Length = 399
Score = 515 bits (1327), Expect = e-145
Identities = 253/253 (100%), Positives = 253/253 (100%)
Frame = -3
Query: 795 EEHRVVHRDLKPVNILVDHDTGFLKISDFGSVKIIVKGKANNHYQVTRFYRPPELLQKAM 616
EEHRVVHRDLKPVNILVDHDTGFLKISDFGSVKIIVKGKANNHYQVTRFYRPPELLQKAM
Sbjct: 136 EEHRVVHRDLKPVNILVDHDTGFLKISDFGSVKIIVKGKANNHYQVTRFYRPPELLQKAM 195
Query: 615 EYNCTVDVWSAGCIMAEMVKRRVVFPGRDSAQQMKLYCRCFGVPTEQDILAMKGERLENE 436
EYNCTVDVWSAGCIMAEMVKRRVVFPGRDSAQQMKLYCRCFGVPTEQDILAMKGERLENE
Sbjct: 196 EYNCTVDVWSAGCIMAEMVKRRVVFPGRDSAQQMKLYCRCFGVPTEQDILAMKGERLENE 255
Query: 435 LWKFTKGFGLQRLVTEITPDQLQFIKRILVYTPEKRLHGKQLLQDDFFQTKTPRQSVLLY 256
LWKFTKGFGLQRLVTEITPDQLQFIKRILVYTPEKRLHGKQLLQDDFFQTKTPRQSVLLY
Sbjct: 256 LWKFTKGFGLQRLVTEITPDQLQFIKRILVYTPEKRLHGKQLLQDDFFQTKTPRQSVLLY 315
Query: 255 WSRLTTGIRGFQTVRRATLMRMFFREDQHLSRRNRRWLVMSNRMRTTLTIDVVGHQVKIV 76
WSRLTTGIRGFQTVRRATLMRMFFREDQHLSRRNRRWLVMSNRMRTTLTIDVVGHQVKIV
Sbjct: 316 WSRLTTGIRGFQTVRRATLMRMFFREDQHLSRRNRRWLVMSNRMRTTLTIDVVGHQVKIV 375
Query: 75 DHRRLRRLLLSVP 37
DHRRLRRLLLSVP
Sbjct: 376 DHRRLRRLLLSVP 388