Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F44D12_5
(1344 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17540434|ref|NP_501809.1| putative nuclear protein family mem... 810 0.0
gi|17508959|ref|NP_491796.1| putative protein family member (1G7... 367 e-100
gi|17533931|ref|NP_496775.1| putative protein family member (2N3... 330 5e-89
gi|39595704|emb|CAE67207.1| Hypothetical protein CBG12643 [Caeno... 326 9e-88
gi|39579126|emb|CAE57024.1| Hypothetical protein CBG24900 [Caeno... 281 3e-74
gi|39579309|emb|CAE56677.1| Hypothetical protein CBG24453 [Caeno... 179 2e-43
gi|17531721|ref|NP_496312.1| putative nuclear protein family mem... 147 7e-34
gi|39591156|emb|CAE73209.1| Hypothetical protein CBG20614 [Caeno... 136 1e-30
gi|17506213|ref|NP_492203.1| putative nuclear protein family mem... 134 6e-30
gi|39580217|emb|CAE71724.1| Hypothetical protein CBG18702 [Caeno... 125 2e-27
gi|39579308|emb|CAE56676.1| Hypothetical protein CBG24452 [Caeno... 105 2e-21
gi|39104508|dbj|BAC65744.3| mKIAA1187 protein [Mus musculus] 50 2e-04
gi|39585444|emb|CAE70527.1| Hypothetical protein CBG17156 [Caeno... 49 4e-04
gi|39589507|emb|CAE74536.1| Hypothetical protein CBG22293 [Caeno... 47 8e-04
gi|25151613|ref|NP_741698.1| putative protein (80.3 kD) (5T676) ... 47 8e-04
gi|31746683|gb|AAP68958.1| Uncoordinated protein 89, isoform b [... 47 0.001
gi|7511618|pir||T29757 protein UNC-89 - Caenorhabditis elegans 47 0.001
gi|1160355|gb|AAB00542.1| UNC-89 47 0.001
gi|25141314|ref|NP_491290.2| UNCoordinated locomotion UNC-89, PH... 47 0.001
gi|23509309|ref|NP_701976.1| hypothetical protein [Plasmodium fa... 47 0.001
gi|8096269|dbj|BAA95789.1| KED [Nicotiana tabacum] 46 0.002
gi|34859138|ref|XP_219296.2| similar to proliferation potential-... 45 0.003
gi|24650716|ref|NP_733234.1| CG12877-PB [Drosophila melanogaster... 45 0.003
gi|17367114|sp|Q9U7E0|ATRX_CAEEL Transcriptional regulator ATRX ... 45 0.003
gi|17509687|ref|NP_491423.1| human XNP gene related (156.2 kD) (... 45 0.003
gi|25012269|gb|AAN71248.1| LD30051p [Drosophila melanogaster] 45 0.003
gi|24650714|ref|NP_651584.1| CG12877-PA [Drosophila melanogaster... 45 0.003
gi|23612496|ref|NP_704057.1| sin3 associated polypeptide p18-lik... 45 0.004
gi|47225554|emb|CAG12037.1| unnamed protein product [Tetraodon n... 45 0.005
gi|17505713|ref|NP_492684.1| dauer or Aging adult Overexpression... 45 0.005
gi|544124|sp|P35663|CYL1_HUMAN Cylicin I (Multiple-band polypept... 45 0.005
gi|42662574|ref|XP_088636.5| cylicin, basic protein of sperm hea... 45 0.005
gi|39589597|emb|CAE66832.1| Hypothetical protein CBG12202 [Caeno... 45 0.005
gi|49077390|ref|XP_402560.1| hypothetical protein UM04945.1 [Ust... 45 0.005
gi|21755300|dbj|BAC04654.1| unnamed protein product [Homo sapiens] 44 0.007
gi|39586156|emb|CAE69232.1| Hypothetical protein CBG15274 [Caeno... 44 0.007
gi|24620453|gb|AAN61517.1| 2MDa_1 protein [Caenorhabditis elegans] 44 0.011
gi|17565434|ref|NP_504585.1| fibronectin, type III and M protein... 44 0.011
gi|50407251|ref|XP_456697.1| unnamed protein product [Debaryomyc... 44 0.011
gi|50732487|ref|XP_418658.1| PREDICTED: similar to RIKEN cDNA 58... 44 0.011
gi|15228477|ref|NP_189519.1| expressed protein [Arabidopsis thal... 44 0.011
gi|24620454|gb|AAN61518.1| 2MDa_2 protein [Caenorhabditis elegans] 44 0.011
gi|24620455|gb|AAN61519.1| 1MDa_1 protein [Caenorhabditis elegans] 44 0.011
gi|730030|sp|P40631|MLH_TETTH Micronuclear linker histone polypr... 43 0.015
gi|6002950|gb|AAF00223.1| triadin isoform 3 [Canis familiaris] 43 0.015
gi|38109806|gb|EAA55617.1| hypothetical protein MG01268.4 [Magna... 43 0.015
gi|31542192|ref|NP_659190.2| cDNA sequence BC019977 [Mus musculu... 43 0.020
gi|8134743|sp|Q28820|TRDN_RABIT Triadin >gnl|BL_ORD_ID|1941517 g... 43 0.020
gi|18043435|gb|AAH19977.1| BC019977 protein [Mus musculus] 43 0.020
gi|21362996|sp|P82179|TRDN_CANFA Triadin >gnl|BL_ORD_ID|310205 g... 43 0.020
gi|38079996|ref|XP_287445.2| expressed sequence AF013969 [Mus mu... 43 0.020
gi|23509866|ref|NP_702533.1| hypothetical protein [Plasmodium fa... 42 0.026
gi|13518400|ref|NP_084759.1| Ycf1 protein [Oenothera elata subsp... 42 0.026
gi|50285857|ref|XP_445357.1| unnamed protein product [Candida gl... 42 0.026
gi|17542856|ref|NP_500057.1| putative nuclear protein (4B983) [C... 42 0.026
gi|4557509|ref|NP_001331.1| cylicin 2 [Homo sapiens] >gnl|BL_ORD... 42 0.033
gi|50727023|gb|AAT81179.1| Hypothetical protein Y44E3A.4 [Caenor... 42 0.033
gi|17541376|ref|NP_501845.1| putative nuclear protein, with a co... 42 0.033
gi|1144491|gb|AAC48498.1| cardiac triadin isoform 3 >gnl|BL_ORD_... 42 0.044
gi|50286801|ref|XP_445830.1| unnamed protein product [Candida gl... 42 0.044
gi|39579372|emb|CAE56303.1| Hypothetical protein CBG23960 [Caeno... 42 0.044
gi|24943078|gb|AAF68853.2| Nopp140-like nucleolar protein [Droso... 42 0.044
gi|45551819|ref|NP_730694.2| CG7421-PA [Drosophila melanogaster]... 42 0.044
gi|47209508|emb|CAF91244.1| unnamed protein product [Tetraodon n... 42 0.044
gi|48730797|ref|ZP_00264544.1| COG0810: Periplasmic protein TonB... 42 0.044
gi|11320891|gb|AAG33941.1| pinin [Homo sapiens] 42 0.044
gi|49095810|ref|XP_409366.1| hypothetical protein AN5229.2 [Aspe... 42 0.044
gi|24668401|ref|NP_730693.1| CG7421-PB [Drosophila melanogaster]... 42 0.044
gi|39586313|emb|CAE66724.1| Hypothetical protein CBG12070 [Caeno... 42 0.044
gi|3123014|sp|P87498|VIT1_CHICK Vitellogenin I precursor (Minor ... 41 0.057
gi|50751408|ref|XP_422384.1| PREDICTED: similar to vitellogenin ... 41 0.057
gi|32422567|ref|XP_331727.1| hypothetical protein [Neurospora cr... 41 0.057
gi|32484979|ref|NP_003655.3| adaptor-related protein complex 3, ... 41 0.057
gi|18201935|sp|O00203|A3B1_HUMAN Adapter-related protein complex... 41 0.057
gi|47937903|gb|AAH71371.1| Unknown (protein for IMAGE:6895565) [... 41 0.057
gi|1546779|gb|AAB49620.1| PACT 41 0.057
gi|23956062|ref|NP_035377.1| retinoblastoma binding protein 6 [M... 41 0.057
gi|34785605|gb|AAH58038.1| Unknown (protein for IMAGE:6620883) [... 41 0.074
gi|23613705|ref|NP_704726.1| hypothetical protein [Plasmodium fa... 41 0.074
gi|32406786|ref|XP_324006.1| predicted protein [Neurospora crass... 41 0.074
gi|50304587|ref|XP_452249.1| unnamed protein product [Kluyveromy... 41 0.074
gi|34784456|gb|AAH57473.1| LOC402866 protein [Danio rerio] 41 0.074
gi|24639088|ref|NP_524753.2| CG3064-PB [Drosophila melanogaster]... 41 0.074
gi|24663664|ref|NP_648627.1| CG11274-PA [Drosophila melanogaster... 41 0.074
gi|7460239|pir||T13564 microtubule-associated protein homolog - ... 41 0.074
gi|7511968|pir||T13165 mutator 2 - fruit fly (Drosophila melanog... 41 0.074
gi|44885228|emb|CAE45725.1| PNUTSDm protein [Drosophila melanoga... 40 0.097
gi|19920484|ref|NP_608554.1| CG4124-PB [Drosophila melanogaster]... 40 0.097
gi|46433099|gb|EAK92553.1| hypothetical protein CaO19.702 [Candi... 40 0.097
gi|24655488|ref|NP_647642.2| CG7971-PA [Drosophila melanogaster]... 40 0.097
gi|24655493|ref|NP_728653.1| CG7971-PB [Drosophila melanogaster]... 40 0.097
gi|24655483|ref|NP_728652.1| CG7971-PC [Drosophila melanogaster]... 40 0.097
gi|47229663|emb|CAG06859.1| unnamed protein product [Tetraodon n... 40 0.097
gi|24580743|ref|NP_722667.1| CG4124-PC [Drosophila melanogaster]... 40 0.097
gi|47575780|ref|NP_001001234.1| hypothetical protein MGC69461 [X... 40 0.097
gi|50761761|ref|XP_429158.1| PREDICTED: similar to lens epitheli... 40 0.097
gi|32421759|ref|XP_331323.1| hypothetical protein [Neurospora cr... 40 0.097
gi|44885244|emb|CAE45726.1| PNUTSDm protein [Drosophila melanoga... 40 0.097
gi|46431856|gb|EAK91379.1| hypothetical protein CaO19.7818 [Cand... 40 0.13
gi|15221547|ref|NP_172152.1| DEIH-box RNA/DNA helicase [Arabidop... 40 0.13
gi|17534591|ref|NP_495100.1| putative protein, with 4 coiled coi... 40 0.13
gi|23612532|ref|NP_704093.1| hypothetical protein [Plasmodium fa... 40 0.13
gi|4432953|dbj|BAA20855.1| annexin V-binding protein (ABP-10) [R... 40 0.13
gi|50732998|ref|XP_418864.1| PREDICTED: similar to cell division... 40 0.13
gi|24414611|gb|AAN39118.1| peptidylprolyl cis-trans isomerase [D... 40 0.13
gi|21554368|gb|AAM63475.1| unknown [Arabidopsis thaliana] 40 0.13
gi|24650807|ref|NP_733246.1| CG1866-PA [Drosophila melanogaster]... 40 0.13
gi|28571910|ref|NP_651618.3| CG1866-PB [Drosophila melanogaster]... 40 0.13
gi|23488127|gb|EAA21236.1| maebl [Plasmodium yoelii yoelii] 40 0.13
gi|17540204|ref|NP_500767.1| MSP-domain protein like family memb... 40 0.13
gi|39593039|emb|CAE64508.1| Hypothetical protein CBG09238 [Caeno... 40 0.13
gi|25012455|gb|AAN71333.1| RE23622p [Drosophila melanogaster] 40 0.13
gi|25406929|pir||E86201 protein F12K11.4 [imported] - Arabidopsi... 40 0.13
gi|24656362|ref|NP_611495.1| CG11180-PA [Drosophila melanogaster... 40 0.17
gi|23613384|ref|NP_703228.1| Ebl-1 like protein, putative [Plasm... 40 0.17
gi|20819438|ref|XP_129997.1| TAF3 RNA polymerase II, TATA box bi... 40 0.17
gi|7503971|pir||T32466 hypothetical protein F52G3.1 - Caenorhabd... 40 0.17
gi|15450443|gb|AAK96515.1| AT5g53800/MGN6_19 [Arabidopsis thalia... 40 0.17
gi|48135928|ref|XP_393354.1| similar to CG7971-PC [Apis mellifera] 40 0.17
gi|39589312|emb|CAE74341.1| Hypothetical protein CBG22059 [Caeno... 40 0.17
gi|2127600|pir||JC6009 surface-located membrane protein lmp3 pre... 40 0.17
gi|9759074|dbj|BAB09552.1| unnamed protein product [Arabidopsis ... 40 0.17
gi|18423555|ref|NP_568799.1| expressed protein [Arabidopsis thal... 40 0.17
gi|2134123|pir||I51618 nucleolar phosphoprotein - African clawed... 40 0.17
gi|21430166|gb|AAM50761.1| LD10524p [Drosophila melanogaster] 40 0.17
gi|17568023|ref|NP_510744.1| HLA-B associated (128.0 kD) (XR585)... 40 0.17
gi|26522598|dbj|BAC44837.1| JESEBL [Plasmodium falciparum] 40 0.17
gi|34870721|ref|XP_220420.2| similar to putative transcription f... 40 0.17
gi|23509035|ref|NP_701703.1| hypothetical protein [Plasmodium fa... 40 0.17
gi|7489917|pir||JC6552 DNA topoisomerase (EC 5.99.1.2) - slime m... 40 0.17
gi|17552208|ref|NP_498392.1| tho2 (164.4 kD) (3H463) [Caenorhabd... 39 0.22
gi|1197337|emb|CAA64859.1| Lmp4 protein [Mycoplasma hominis] 39 0.22
gi|2127599|pir||PC6003 surface membrane protein lmp4 - Mycoplasm... 39 0.22
gi|20521788|dbj|BAA86501.2| KIAA1187 protein [Homo sapiens] 39 0.22
gi|23509704|ref|NP_702371.1| hypothetical protein, conserved [Pl... 39 0.22
gi|31201363|ref|XP_309629.1| ENSANGP00000011118 [Anopheles gambi... 39 0.22
gi|23488615|gb|EAA21359.1| hypothetical protein [Plasmodium yoel... 39 0.22
gi|45185293|ref|NP_983010.1| ABR064Wp [Eremothecium gossypii] >g... 39 0.22
gi|45501333|gb|AAH67256.1| FLJ10350 protein [Homo sapiens] 39 0.22
gi|28422195|gb|AAH44265.1| B52-prov protein [Xenopus laevis] 39 0.22
gi|25395798|pir||G88480 protein C16A3.7 [imported] - Caenorhabdi... 39 0.22
gi|39594465|emb|CAE72043.1| Hypothetical protein CBG19125 [Caeno... 39 0.22
gi|7415524|dbj|BAA93438.1| FmtB [Staphylococcus aureus] 39 0.22
gi|39582090|emb|CAE63733.1| Hypothetical protein CBG08261 [Caeno... 39 0.22
gi|5834649|emb|CAB55329.1| Mrp protein [Staphylococcus aureus] 39 0.22
gi|34875614|ref|XP_218162.2| similar to Translation initiation f... 39 0.22
gi|17556242|ref|NP_497198.1| chromo domain containing protein (7... 39 0.22
gi|23508470|ref|NP_701139.1| hypothetical protein [Plasmodium fa... 39 0.22
gi|27227741|emb|CAD59239.1| NAD(+) ADP-ribosyltransferase-3 [Dic... 39 0.28
gi|27805829|ref|NP_776727.1| cylicin, basic protein of sperm hea... 39 0.28
gi|24655776|ref|NP_523887.2| CG1960-PA [Drosophila melanogaster]... 39 0.28
gi|15238754|ref|NP_200156.1| expressed protein [Arabidopsis thal... 39 0.28
gi|20070262|ref|NP_056465.2| TNF receptor-associated factor 3 in... 39 0.28
gi|7415419|dbj|BAA93431.1| ORF1 [Staphylococcus aureus] 39 0.28
gi|46437429|gb|EAK96776.1| hypothetical protein CaO19.2859 [Cand... 39 0.28
gi|50294918|ref|XP_449870.1| unnamed protein product [Candida gl... 39 0.28
gi|24659555|ref|NP_729188.1| CG32394-PA [Drosophila melanogaster... 39 0.28
gi|38344339|emb|CAD41755.2| OSJNBa0058K23.21 [Oryza sativa (japo... 39 0.28
gi|50255325|gb|EAL18060.1| hypothetical protein CNBK0810 [Crypto... 39 0.28
gi|19401863|gb|AAL87694.1| non-transporter ABC protein AbcF4 [Di... 39 0.28
gi|33359633|gb|AAQ17064.1| nucleolin 2 [Cyprinus carpio] 39 0.28
gi|24655771|ref|NP_728695.1| CG1960-PB [Drosophila melanogaster]... 39 0.28
gi|12804871|gb|AAH01883.1| Nucleolar and coiled-body phosphoprot... 39 0.28
gi|32879843|gb|AAP88752.1| nucleolar and coiled-body phosphoprot... 39 0.28
gi|27370871|gb|AAH41236.1| XNopp180 protein [Xenopus laevis] 39 0.28
gi|6321599|ref|NP_011675.1| Nucleolar protein that binds nuclear... 39 0.28
gi|34861441|ref|XP_215182.2| similar to Splicing factor 3b, subu... 39 0.28
gi|24650530|ref|NP_651538.1| CG6066-PA [Drosophila melanogaster]... 39 0.37
gi|25012304|gb|AAN71264.1| LD40727p [Drosophila melanogaster] 39 0.37
gi|434765|dbj|BAA04803.1| ORF [Homo sapiens] 39 0.37
gi|50292059|ref|XP_448462.1| unnamed protein product [Candida gl... 39 0.37
gi|21622344|emb|CAD37044.1| related to chromatin assembly comple... 39 0.37
gi|47211143|emb|CAF96563.1| unnamed protein product [Tetraodon n... 39 0.37
gi|32417742|ref|XP_329349.1| hypothetical protein [Neurospora cr... 39 0.37
gi|39597324|emb|CAE59552.1| Hypothetical protein CBG02948 [Caeno... 39 0.37
gi|23509626|ref|NP_702293.1| hypothetical protein [Plasmodium fa... 39 0.37
gi|8777580|dbj|BAA97098.1| unnamed protein product [Arabidopsis ... 39 0.37
gi|5174725|ref|NP_006064.1| triadin [Homo sapiens] >gnl|BL_ORD_I... 39 0.37
gi|39592272|emb|CAE75493.1| Hypothetical protein CBG23497 [Caeno... 39 0.37
gi|32405850|ref|XP_323538.1| hypothetical protein [Neurospora cr... 39 0.37
gi|16805029|ref|NP_473058.1| hypothetical protein [Plasmodium fa... 39 0.37
gi|47226564|emb|CAG08580.1| unnamed protein product [Tetraodon n... 39 0.37
gi|17507953|ref|NP_491959.1| putative nuclear protein (1H422) [C... 39 0.37
gi|7494217|pir||T18467 hypothetical protein C0465c - malaria par... 38 0.48
gi|5870276|gb|AAD54507.1| MTDM_HUMAN [AA 1- 966]; DNA METHYLTRAN... 38 0.48
gi|17505635|ref|NP_491917.1| putative nuclear protein, with 2 co... 38 0.48
gi|50414757|gb|AAH77771.1| Unknown (protein for IMAGE:4885186) [... 38 0.48
gi|34854659|ref|XP_218237.2| similar to maternal-antigen-that-em... 38 0.48
gi|23489576|gb|EAA21610.1| myosin light chain kinase [Plasmodium... 38 0.48
gi|39595335|emb|CAE60372.1| Hypothetical protein CBG03972 [Caeno... 38 0.48
gi|46108446|ref|XP_381281.1| hypothetical protein FG01105.1 [Gib... 38 0.48
gi|23957752|ref|NP_473225.2| hypothetical protein [Plasmodium fa... 38 0.48
gi|1518277|emb|CAA64003.1| TGN47 [Macaca fascicularis] 38 0.48
gi|105852|pir||S22610 DNA (cytosine-5-)-methyltransferase (EC 2.... 38 0.48
gi|23509190|ref|NP_701858.1| hypothetical protein [Plasmodium fa... 38 0.48
gi|50311997|ref|XP_456030.1| unnamed protein product [Kluyveromy... 38 0.48
gi|4503351|ref|NP_001370.1| DNA (cytosine-5-)-methyltransferase ... 38 0.48
gi|23509352|ref|NP_702019.1| hypothetical protein [Plasmodium fa... 38 0.48
gi|39579838|emb|CAE56847.1| Hypothetical protein CBG24674 [Caeno... 38 0.48
gi|21283815|ref|NP_646903.1| truncated FmtB protein [Staphylococ... 38 0.48
gi|39597356|emb|CAE59584.1| Hypothetical protein CBG02984 [Caeno... 38 0.48
gi|23612818|ref|NP_704357.1| hypothetical protein [Plasmodium fa... 38 0.48
gi|50749422|ref|XP_421630.1| PREDICTED: similar to nucleolus-cyt... 38 0.48
gi|27805831|ref|NP_776728.1| cylicin, basic protein of sperm hea... 38 0.48
gi|19569949|gb|AAL92258.1| similar to Homo sapiens (Human). Hypo... 38 0.63
gi|33668507|emb|CAA92594.3| Hypothetical protein F11A10.3 [Caeno... 38 0.63
gi|15223583|ref|NP_176058.1| expressed protein [Arabidopsis thal... 38 0.63
gi|23479184|gb|EAA16083.1| hypothetical protein [Plasmodium yoel... 38 0.63
gi|25396123|pir||C88854 protein F11A10.3 [imported] - Caenorhabd... 38 0.63
gi|38073487|ref|XP_355243.1| similar to This gene is isolated by... 38 0.63
gi|25009727|gb|AAN71038.1| AT07931p [Drosophila melanogaster] 38 0.63
gi|49084868|ref|XP_404598.1| hypothetical protein AN0461.2 [Aspe... 38 0.63
gi|17505881|ref|NP_492824.1| vamp-associated protein like family... 38 0.63
gi|23613218|ref|NP_703540.1| hypothetical protein [Plasmodium fa... 38 0.63
gi|17505979|ref|NP_492531.1| putative nuclear protein, with a co... 38 0.63
gi|49095082|ref|XP_409002.1| hypothetical protein AN4865.2 [Aspe... 38 0.63
gi|33242070|ref|NP_877011.1| Forkhead domain protein [Chlamydoph... 38 0.63
gi|47222924|emb|CAF99080.1| unnamed protein product [Tetraodon n... 38 0.63
gi|39590442|emb|CAE66182.1| Hypothetical protein CBG11420 [Caeno... 38 0.63
gi|305074|gb|AAA29104.1| K2 38 0.63
gi|23612881|ref|NP_704420.1| hypothetical protein [Plasmodium fa... 38 0.63
gi|16648923|gb|AAL24313.1| Unknown protein [Arabidopsis thaliana] 38 0.63
gi|45656218|ref|YP_000304.1| conserved hypothetical protein [Lep... 38 0.63
gi|27364237|ref|NP_759765.1| Ribosomal S7-like protein [Vibrio v... 38 0.63
gi|46431840|gb|EAK91364.1| hypothetical protein CaO19.188 [Candi... 38 0.63
gi|49119281|gb|AAH73328.1| XNopp180 protein [Xenopus laevis] 38 0.63
gi|17539746|ref|NP_502293.1| cleavage polyadenylation factor spe... 38 0.63
gi|305072|gb|AAA29103.1| K2 38 0.63
gi|7949115|ref|NP_058079.1| Ser/Arg-related nuclear matrix prote... 38 0.63
gi|15081543|ref|NP_150056.1| hypothetical protein PCP63 [Clostri... 38 0.63
gi|15925150|ref|NP_372684.1| FmtB protein [Staphylococcus aureus... 38 0.63
gi|23478899|gb|EAA15864.1| U5 snRNP 100 kD protein [Plasmodium y... 38 0.63
gi|34809533|gb|AAQ82687.1| Epa5p [Candida glabrata] 37 0.82
gi|547644|sp|Q02508|HGV2_HALRO Protein HGV2 >gnl|BL_ORD_ID|13642... 37 0.82
gi|1945332|emb|CAA97180.1| NSR1 [Saccharomyces cerevisiae] 37 0.82
gi|23508562|ref|NP_701231.1| hypothetical protein [Plasmodium fa... 37 0.82
gi|25395621|pir||E88320 protein F07A11.6 [imported] - Caenorhabd... 37 0.82
gi|32563718|ref|NP_496485.2| RNA-binding region RNP-1 family mem... 37 0.82
gi|28830036|gb|AAO52526.1| similar to Xenopus laevis (African cl... 37 0.82
gi|24580684|ref|NP_608540.1| CG2839-PA [Drosophila melanogaster]... 37 0.82
gi|46117256|ref|XP_384646.1| hypothetical protein FG04470.1 [Gib... 37 0.82
gi|15618622|ref|NP_224908.1| FHA domain; (homology to adenylate ... 37 0.82
gi|2498883|sp|Q13435|S3B2_HUMAN Splicing factor 3B subunit 2 (Sp... 37 0.82
gi|23490747|gb|EAA22448.1| hypothetical protein [Plasmodium yoel... 37 0.82
gi|1438951|gb|AAB04133.1| cutinase negative acting protein 37 0.82
gi|32563720|ref|NP_871901.1| RNA-binding region RNP-1 family mem... 37 0.82
gi|48103373|ref|XP_395559.1| similar to CG4124-PB [Apis mellifera] 37 0.82
gi|1082713|pir||A48133 pre-mRNA splicing SRp75 - human >gnl|BL_O... 37 0.82
gi|23488929|gb|EAA21440.1| histidine kinase DhkE [Plasmodium yoe... 37 0.82
gi|33875399|gb|AAH00401.2| SF3B2 protein [Homo sapiens] 37 0.82
gi|23490788|gb|EAA22478.1| erythrocyte membrane protein 3 [Plasm... 37 0.82
gi|32563716|ref|NP_496484.2| RNA-binding region RNP-1 family mem... 37 0.82
gi|32416770|ref|XP_328863.1| predicted protein [Neurospora crass... 37 0.82
gi|7498508|pir||T20531 hypothetical protein F07A11.6a - Caenorha... 37 0.82
gi|32172758|gb|AAH53577.1| SF3B2 protein [Homo sapiens] 37 0.82
gi|11359857|pir||T50652 AP-3 complex beta3A chain [imported] - h... 37 0.82
gi|7498509|pir||T20532 hypothetical protein F07A11.6b - Caenorha... 37 0.82
gi|21430152|gb|AAM50754.1| LD04179p [Drosophila melanogaster] 37 0.82
gi|37541035|ref|XP_290506.2| splicing factor 3B subunit 2 [Homo ... 37 0.82
gi|34872420|ref|XP_216586.2| similar to Msx-2 interacting nuclea... 37 0.82
gi|46228298|gb|EAK89197.1| hypothetical protein with signal pept... 37 0.82
gi|3005587|gb|AAC09321.1| Ser/Arg-related nuclear matrix protein... 37 0.82
gi|23613233|ref|NP_703555.1| hypothetical protein [Plasmodium fa... 37 0.82
gi|6324931|ref|NP_015000.1| Protein of unknown function, require... 37 1.1
gi|50417567|gb|AAH77588.1| K14 protein [Xenopus laevis] 37 1.1
gi|17509337|ref|NP_492100.1| tyrosine phosphatase family member ... 37 1.1
gi|42568737|ref|NP_201160.2| expressed protein [Arabidopsis thal... 37 1.1
gi|49903339|gb|AAH76676.1| Unknown (protein for MGC:79651) [Xeno... 37 1.1
gi|586026|sp|P02976|SPA1_STAAU Immunoglobulin G binding protein ... 37 1.1
gi|22749543|ref|NP_690002.1| hypothetical protein MGC40405 [Homo... 37 1.1
gi|47227437|emb|CAG04585.1| unnamed protein product [Tetraodon n... 37 1.1
gi|42733468|dbj|BAD11331.1| BRI1-KD interacting protein 102 [Ory... 37 1.1
gi|50256008|gb|EAL18737.1| hypothetical protein CNBI3230 [Crypto... 37 1.1
gi|47228736|emb|CAG07468.1| unnamed protein product [Tetraodon n... 37 1.1
gi|24213065|ref|NP_710546.1| unknown protein [Leptospira interro... 37 1.1
gi|27734775|ref|NP_775969.1| hypothetical protein FLJ37659 [Homo... 37 1.1
gi|25990101|gb|AAN75020.1| chromosome scaffold protein p85 [Mone... 37 1.1
gi|28828540|gb|AAO51148.1| similar to Y55B1BR.3.p [Caenorhabditi... 37 1.1
gi|13385336|ref|NP_080130.1| CBF1 interacting corepressor [Mus m... 37 1.1
gi|23482677|gb|EAA18589.1| hypothetical protein [Plasmodium yoel... 37 1.1
gi|39595008|emb|CAE70876.1| Hypothetical protein CBG17666 [Caeno... 37 1.1
gi|28828350|gb|AAL93017.2| hypothetical protein [Dictyostelium d... 37 1.1
gi|23489034|gb|EAA21467.1| maebl [Plasmodium yoelii yoelii] 37 1.1
gi|46226717|gb|EAK87696.1| large low complexity coiled coil prot... 37 1.1
gi|46227226|gb|EAK88176.1| signal peptide containing large prote... 37 1.1
gi|28829620|gb|AAO52137.1| similar to Homo sapiens (Human). Dent... 37 1.4
gi|786117|gb|AAA98076.1| nuclear protein 37 1.4
gi|632015|pir||S41156 wingless protein - red flour beetle (fragm... 37 1.4
gi|50752937|ref|XP_413803.1| PREDICTED: similar to senescence do... 37 1.4
gi|23612521|ref|NP_704082.1| hypothetical protein [Plasmodium fa... 37 1.4
gi|39582489|emb|CAE66580.1| Hypothetical protein CBG11897 [Caeno... 37 1.4
gi|15222009|ref|NP_175322.1| nucleolin, putative [Arabidopsis th... 37 1.4
gi|34913470|ref|NP_918082.1| putative formin binding protein [Or... 37 1.4
gi|33563140|dbj|BAC81713.1| serine-rich protein [Entamoeba histo... 37 1.4
gi|39589616|emb|CAE66851.1| Hypothetical protein CBG12223 [Caeno... 37 1.4
gi|39589581|emb|CAE66816.1| Hypothetical protein CBG12181 [Caeno... 37 1.4
gi|24649262|ref|NP_732846.1| CG6755-PA [Drosophila melanogaster]... 37 1.4
gi|23274133|gb|AAH36187.1| Serine/arginine repetitive matrix 1 [... 37 1.4
gi|42542379|ref|NP_005830.2| serine/arginine repetitive matrix 1... 37 1.4
gi|28380977|gb|AAO41456.1| RE20724p [Drosophila melanogaster] 37 1.4
gi|50786817|ref|XP_427726.1| PREDICTED: similar to senescence do... 37 1.4
gi|50746775|ref|XP_420649.1| PREDICTED: similar to Visual pigmen... 37 1.4
gi|45382587|ref|NP_990577.1| claustrin [Gallus gallus] >gnl|BL_O... 37 1.4
gi|21355587|ref|NP_651135.1| CG6755-PB [Drosophila melanogaster]... 37 1.4
gi|15230232|ref|NP_191274.1| dyskerin, putative / nucleolar prot... 37 1.4
gi|23481348|gb|EAA17653.1| hypothetical protein [Plasmodium yoel... 37 1.4
gi|30794206|ref|NP_084385.1| splicing factor 3b, subunit 2 [Mus ... 37 1.4
gi|23480480|gb|EAA17030.1| O1, putative [Plasmodium yoelii yoelii] 36 1.8
gi|48526360|gb|AAT45385.1| sperm nuclear basic protein PL-I isof... 36 1.8
gi|23479761|gb|EAA16501.1| hypothetical protein [Plasmodium yoel... 36 1.8
gi|39584988|emb|CAE64412.1| Hypothetical protein CBG09105 [Caeno... 36 1.8
gi|50549803|ref|XP_502373.1| hypothetical protein [Yarrowia lipo... 36 1.8
gi|17509191|ref|NP_491919.1| putative nuclear protein, with 3 co... 36 1.8
gi|39579307|emb|CAE56326.1| Hypothetical protein CBG23991 [Caeno... 36 1.8
gi|42734064|gb|AAS38936.1| similar to Plasmodium falciparum (iso... 36 1.8
gi|28571351|ref|NP_788910.1| CG9213-PA [Drosophila melanogaster]... 36 1.8
gi|24652700|ref|NP_610672.1| CG13209-PA [Drosophila melanogaster... 36 1.8
gi|15893500|ref|NP_346849.1| Hypothetical protein, CF-6 family [... 36 1.8
gi|21361282|ref|NP_005617.2| splicing factor, arginine/serine-ri... 36 1.8
gi|39585102|emb|CAE62753.1| Hypothetical protein CBG06917 [Caeno... 36 1.8
gi|46123935|ref|XP_386521.1| hypothetical protein FG06345.1 [Gib... 36 1.8
gi|50305507|ref|XP_452713.1| unnamed protein product [Kluyveromy... 36 1.8
gi|28564139|gb|AAO32448.1| MNN4 [Saccharomyces bayanus] 36 1.8
gi|46370596|gb|AAS90120.1| DNA topoisomerase type 2 [Tetrahymena... 36 1.8
gi|38102071|gb|EAA48955.1| hypothetical protein MG00613.4 [Magna... 36 1.8
gi|23480870|gb|EAA17316.1| hypothetical protein [Plasmodium yoel... 36 1.8
gi|30585347|gb|AAP36946.1| Homo sapiens splicing factor, arginin... 36 1.8
gi|46229652|gb|EAK90470.1| hypothetical low complexity protein w... 36 1.8
gi|46442648|gb|EAL01936.1| hypothetical protein CaO19.11806 [Can... 36 2.4
gi|587472|emb|CAA57229.1| lmp2 [Mycoplasma hominis] 36 2.4
gi|46437481|gb|EAK96827.1| hypothetical protein CaO19.10377 [Can... 36 2.4
gi|1168144|gb|AAB35312.1| SCS1 product [Saccharomyces cerevisiae] 36 2.4
gi|7209719|dbj|BAA92310.1| This gene is isolated by means of dif... 36 2.4
gi|39587535|emb|CAE58473.1| Hypothetical protein CBG01613 [Caeno... 36 2.4
gi|23509641|ref|NP_702308.1| hypothetical protein [Plasmodium fa... 36 2.4
gi|41281874|ref|NP_787061.1| transcription factor ELYS [Homo sap... 36 2.4
gi|50288019|ref|XP_446438.1| unnamed protein product [Candida gl... 36 2.4
gi|46442515|gb|EAL01804.1| hypothetical protein CaO19.4332 [Cand... 36 2.4
gi|15292565|gb|AAK93551.1| SD07741p [Drosophila melanogaster] 36 2.4
gi|50305315|ref|XP_452617.1| unnamed protein product [Kluyveromy... 36 2.4
gi|24653966|ref|NP_725506.1| CG18255-PA [Drosophila melanogaster... 36 2.4
gi|21553077|ref|NP_660107.1| WD repeat domain 9 [Mus musculus] >... 36 2.4
gi|4758860|ref|NP_004732.1| nucleolar and coiled-body phosphopro... 36 2.4
gi|38107150|gb|EAA53365.1| predicted protein [Magnaporthe grisea... 36 2.4
gi|47219750|emb|CAG03377.1| unnamed protein product [Tetraodon n... 36 2.4
gi|48095588|ref|XP_392324.1| similar to ENSANGP00000016540 [Apis... 36 2.4
gi|24650678|ref|NP_733224.1| CG31058-PA [Drosophila melanogaster... 36 2.4
gi|21040255|ref|NP_631907.1| splicing factor, arginine/serine-ri... 36 2.4
gi|50760200|ref|XP_417931.1| PREDICTED: similar to hypothetical ... 36 2.4
gi|11036632|ref|NP_055023.1| dentin sialophosphoprotein prepropr... 36 2.4
gi|34535151|dbj|BAC87222.1| unnamed protein product [Homo sapiens] 36 2.4
gi|14970593|emb|CAC44374.1| WDR protein, form B [Mus musculus] 36 2.4
gi|34871032|ref|XP_238415.2| similar to CDNA sequence BC019977 [... 36 2.4
gi|7481993|pir||T30822 lmp1 protein - Mycoplasma hominis >gnl|BL... 36 2.4
gi|46138029|ref|XP_390705.1| hypothetical protein FG10529.1 [Gib... 36 2.4
gi|587471|emb|CAA57228.1| lmp1 [Mycoplasma hominis] 36 2.4
gi|24653978|ref|NP_725510.1| CG18255-PD [Drosophila melanogaster... 36 2.4
gi|13879574|gb|AAH06769.1| NOLC1 protein [Homo sapiens] 36 2.4
gi|790246|gb|AAA81014.1| Lmp1 36 2.4
gi|23509280|ref|NP_701947.1| hypothetical protein [Plasmodium fa... 36 2.4
gi|50759714|ref|XP_417747.1| PREDICTED: similar to Sfrs4 protein... 36 2.4
gi|38540947|gb|AAH62706.1| Unknown (protein for IMAGE:4686277) [... 36 2.4
gi|5734603|dbj|BAA83379.1| KARP-1-binding protein 2 (KAB2) [Homo... 35 3.1
gi|45198625|ref|NP_985654.1| AFR107Wp [Eremothecium gossypii] >g... 35 3.1
gi|34857960|ref|XP_227409.2| similar to ash1 (absent, small, or ... 35 3.1
gi|25406831|pir||E86185 hypothetical protein [imported] - Arabid... 35 3.1
gi|9558387|emb|CAC00497.1| initiation factor 2 [Streptococcus ag... 35 3.1
gi|49090786|ref|XP_406854.1| hypothetical protein AN2717.2 [Aspe... 35 3.1
gi|532526|gb|AAB38372.1| Rts1p 35 3.1
gi|6324588|ref|NP_014657.1| B-type regulatory subunit of protein... 35 3.1
gi|38111478|gb|EAA57053.1| hypothetical protein MG08022.4 [Magna... 35 3.1
gi|50312163|ref|XP_456113.1| unnamed protein product [Kluyveromy... 35 3.1
gi|40788270|dbj|BAA32315.2| KIAA0470 protein [Homo sapiens] 35 3.1
gi|23343880|gb|AAK67493.1| IE2 protein [Human herpesvirus 6] 35 3.1
gi|19115891|ref|NP_594979.1| putative helicase [Schizosaccharomy... 35 3.1
gi|50554851|ref|XP_504834.1| hypothetical protein [Yarrowia lipo... 35 3.1
gi|39934208|ref|NP_946484.1| unknown protein [Rhodopseudomonas p... 35 3.1
gi|7662142|ref|NP_055627.1| KARP-1-binding protein [Homo sapiens... 35 3.1
gi|47223423|emb|CAG04284.1| unnamed protein product [Tetraodon n... 35 3.1
gi|49106022|ref|XP_411387.1| hypothetical protein AN7250.2 [Aspe... 35 3.1
gi|11358453|pir||T46237 hypothetical protein T9C5.190 - Arabidop... 35 3.1
gi|34526663|dbj|BAC85257.1| unnamed protein product [Homo sapiens] 35 3.1
gi|29500803|gb|AAO75106.1| ComB [Dictyostelium discoideum] 35 3.1
gi|7521940|pir||T31110 extracellular matrix binding protein - Ab... 35 3.1
gi|21355677|ref|NP_651291.1| CG5808-PA [Drosophila melanogaster]... 35 3.1
gi|18858137|ref|NP_572323.1| CG3918-PA [Drosophila melanogaster]... 35 3.1
gi|41944563|gb|AAH65953.1| Unknown (protein for MGC:65775) [Dani... 35 3.1
gi|23479406|gb|EAA16244.1| fimbriae-associated protein Fap1 [Pla... 35 3.1
gi|50405561|ref|XP_456416.1| unnamed protein product [Debaryomyc... 35 3.1
gi|28850410|gb|AAL92314.2| hypothetical protein [Dictyostelium d... 35 3.1
gi|7512995|pir||T00095 hypothetical protein KIAA0470 - human >gn... 35 3.1
gi|47214704|emb|CAG01057.1| unnamed protein product [Tetraodon n... 35 3.1
gi|18699724|ref|NP_116259.1| chromosome 6 open reading frame 111... 35 3.6
gi|17531187|ref|NP_496041.1| putative nuclear protein, with a co... 35 4.1
gi|37993693|gb|AAR06930.1| translation initiation factor B [Stre... 35 4.1
gi|25010490|ref|NP_734885.1| initiation factor 2 [Streptococcus ... 35 4.1
gi|39579837|emb|CAE56846.1| Hypothetical protein CBG24673 [Caeno... 35 4.1
gi|9558369|emb|CAC00485.1| initiation Factor 2 [Streptococcus ag... 35 4.1
gi|9558381|emb|CAC00493.1| initiation factor 2 [Streptococcus ag... 35 4.1
gi|22536564|ref|NP_687415.1| translation initiation factor IF-2 ... 35 4.1
gi|7481992|pir||T18351 lmp1 protein - Mycoplasma hominis >gnl|BL... 35 4.1
gi|34015155|gb|AAQ56351.1| hypothetical protein OSJNBa0017M13.26... 35 4.1
gi|1083716|pir||A56577 microtubule-associated protein MAP 1B - r... 35 4.1
gi|23483652|gb|EAA19253.1| CCAAT-box DNA binding protein subunit... 35 4.1
gi|20070900|gb|AAH26774.1| Nuclear NF-kappaB activating protein ... 35 4.1
gi|41148774|ref|XP_041018.4| KIAA0367 protein [Homo sapiens] 35 4.1
gi|37543028|gb|AAL68925.1| p53-associated cellular protein PACT ... 35 4.1
gi|23619075|ref|NP_705037.1| Plasmodium falciparum asparagine-ri... 35 4.1
gi|47087459|ref|NP_998629.1| zgc:55535 [Danio rerio] >gnl|BL_ORD... 35 4.1
gi|50755721|ref|XP_414870.1| PREDICTED: similar to retinoblastom... 35 4.1
gi|23481592|gb|EAA17823.1| hypothetical protein [Plasmodium yoel... 35 4.1
gi|39591638|emb|CAE71215.1| Hypothetical protein CBG18078 [Caeno... 35 4.1
gi|47575808|ref|NP_001001248.1| hypothetical protein MGC76055 [X... 35 4.1
gi|33620716|ref|NP_061173.1| retinoblastoma-binding protein 6 is... 35 4.1
gi|50259202|gb|EAL21875.1| hypothetical protein CNBC0160 [Crypto... 35 4.1
gi|47226437|emb|CAG08453.1| unnamed protein product [Tetraodon n... 35 4.1
gi|46439069|gb|EAK98391.1| hypothetical protein CaO19.497 [Candi... 35 4.1
gi|34853474|ref|XP_215469.2| similar to Microtubule-associated p... 35 4.1
gi|33620769|ref|NP_008841.2| retinoblastoma-binding protein 6 is... 35 4.1
gi|50257257|gb|EAL19966.1| hypothetical protein CNBF2930 [Crypto... 35 4.1
gi|33563142|dbj|BAC81714.1| serine-rich protein [Entamoeba histo... 35 4.1
gi|44928742|gb|AAD45326.2| glucan synthase [Coccidioides posadasii] 35 4.1
gi|19856246|sp|P15205|MAPB_RAT Microtubule-associated protein 1B... 35 4.1
gi|3860319|emb|CAA10127.1| nucleolar protein [Cicer arietinum] 35 4.1
gi|50306513|ref|XP_453230.1| unnamed protein product [Kluyveromy... 35 4.1
gi|41151617|ref|XP_373339.1| similar to Nucleolar phosphoprotein... 35 4.1
gi|17537523|ref|NP_497064.1| putative nuclear protein, with 2 co... 35 4.1
gi|15705403|gb|AAL05625.1| proliferation potential-related prote... 35 4.1
gi|17569481|ref|NP_509645.1| DumPY : shorter than wild-type DPY-... 35 4.1
gi|48097025|ref|XP_393668.1| similar to P21/Cdc42/Rac1-activated... 35 4.1
gi|28316933|gb|AAO39488.1| SD13756p [Drosophila melanogaster] 35 4.1
gi|39597714|emb|CAE68405.1| Hypothetical protein CBG14180 [Caeno... 35 4.1
gi|32416782|ref|XP_328869.1| hypothetical protein [Neurospora cr... 35 4.1
gi|50753651|ref|XP_425112.1| PREDICTED: similar to hydrocephalus... 35 4.1
gi|16805045|ref|NP_473074.1| DNA helicase, putative [Plasmodium ... 35 4.1
gi|46137137|ref|XP_390260.1| hypothetical protein FG10084.1 [Gib... 35 4.1
gi|50732245|ref|XP_418546.1| PREDICTED: similar to PAX transcrip... 35 5.3
gi|49083986|ref|XP_404229.1| hypothetical protein AN0092.2 [Aspe... 35 5.3
gi|50801336|ref|XP_424168.1| PREDICTED: similar to CBF1 interact... 35 5.3
gi|26449170|dbj|BAC36925.1| unnamed protein product [Mus musculus] 35 5.3
gi|46441058|gb|EAL00358.1| hypothetical protein CaO19.13015 [Can... 35 5.3
gi|46117162|ref|XP_384599.1| hypothetical protein FG04423.1 [Gib... 35 5.3
gi|30681829|ref|NP_850032.1| expressed protein [Arabidopsis thal... 35 5.3
gi|50730402|ref|XP_416886.1| PREDICTED: similar to inositol poly... 35 5.3
gi|17540128|ref|NP_501232.1| chromo domain containing protein (4... 35 5.3
gi|5679712|emb|CAB51808.1| Spo76 protein [Sordaria macrospora] 35 5.3
gi|71549|pir||QFHUH neurofilament triplet H protein - human >gnl... 35 5.3
gi|32483416|ref|NP_066554.2| neurofilament, heavy polypeptide 20... 35 5.3
gi|46107904|ref|XP_381011.1| hypothetical protein FG00835.1 [Gib... 35 5.3
gi|24308067|ref|NP_056261.1| transcription factor ELYS [Homo sap... 35 5.3
gi|23508768|ref|NP_701436.1| hypothetical protein [Plasmodium fa... 35 5.3
gi|601931|gb|AAA57153.1| neurofilament-H 35 5.3
gi|17864374|ref|NP_524764.1| CG11387-PA [Drosophila melanogaster... 35 5.3
gi|39588491|emb|CAE58014.1| Hypothetical protein CBG01084 [Caeno... 35 5.3
gi|42527584|ref|NP_972682.1| conserved hypothetical protein [Tre... 35 5.3
gi|462010|sp|Q03111|ENL_HUMAN ENL protein >gnl|BL_ORD_ID|1738086... 35 5.3
gi|21361272|ref|NP_005925.2| myeloid/lymphoid or mixed-lineage l... 35 5.3
gi|10181126|ref|NP_065612.1| splicing factor, arginine/serine-ri... 35 5.3
gi|6322648|ref|NP_012721.1| Putative positive regulator of manno... 35 5.3
gi|39591417|emb|CAE73471.1| Hypothetical protein CBG20922 [Caeno... 35 5.3
gi|33337998|gb|AAQ13621.1| MSTP108 [Homo sapiens] 35 5.3
gi|23484527|gb|EAA19829.1| retinitis pigmentosa GTPase regulator... 35 5.3
gi|24645646|ref|NP_649988.1| CG3996-PA [Drosophila melanogaster]... 35 5.3
gi|9910564|ref|NP_064477.1| serine-arginine-rich splicing regula... 35 5.3
gi|38348508|ref|NP_941035.1| similar to Nucleolar phosphoprotein... 35 5.3
gi|23479649|gb|EAA16419.1| Late embryogenesis abundant protein, ... 35 5.3
gi|13442965|gb|AAK26242.1| putative chromatin remodeling factor ... 35 5.3
gi|47078482|ref|NP_619620.2| absent, small, or homeotic discs 1;... 35 5.3
gi|7492326|pir||T38348 probable 1,3-beta-glucan synthase compone... 35 5.3
gi|28829868|gb|AAO52365.1| similar to T10C6.5.p [Caenorhabditis ... 35 5.3
gi|24642136|ref|NP_511161.2| CG6146-PA [Drosophila melanogaster]... 35 5.3
gi|33359635|gb|AAQ17065.1| nucleolin 3 [Cyprinus carpio] >gnl|BL... 35 5.3
gi|2980817|emb|CAA82046.1| MNN4 [Saccharomyces cerevisiae] 35 5.3
gi|7108770|gb|AAF36532.1| IF2 protein [Drosophila melanogaster] 35 5.3
gi|23479809|gb|EAA16539.1| putative protein potential transcript... 35 5.3
gi|34764016|ref|ZP_00144904.1| TonB protein [Fusobacterium nucle... 35 5.3
gi|24656849|ref|NP_651974.1| CG10840-PB [Drosophila melanogaster... 35 5.3
gi|7522163|pir||T30888 vitellogenin - Athalia rosae >gnl|BL_ORD_... 35 5.3
gi|39580460|emb|CAE73149.1| Hypothetical protein CBG20540 [Caeno... 35 5.3
gi|23509121|ref|NP_701789.1| hypothetical protein [Plasmodium fa... 35 5.3
gi|24666524|ref|NP_649072.1| CG6843-PA [Drosophila melanogaster]... 35 5.3
gi|18642528|gb|AAL76164.1| SR rich protein [Homo sapiens] 35 5.3
gi|48870355|ref|ZP_00323079.1| hypothetical protein PpenA0100100... 35 5.3
gi|23510019|ref|NP_702685.1| hypothetical protein [Plasmodium fa... 35 5.3
gi|17553260|ref|NP_497928.1| serine/threonine kinase, homolog of... 35 5.3
gi|28898836|ref|NP_798441.1| ribonuclease E [Vibrio parahaemolyt... 35 5.3
gi|46117442|ref|XP_384739.1| hypothetical protein FG04563.1 [Gib... 35 5.3
gi|7512672|pir||T12528 hypothetical protein DKFZp434N093.1 - hum... 35 5.3
gi|19114944|ref|NP_594032.1| putative 1,3-beta-glucan synthase c... 35 5.3
gi|23480440|gb|EAA16998.1| hypothetical protein [Plasmodium yoel... 35 5.3
gi|13506761|gb|AAK28322.1| tight junction protein ZO-1 [Hydra vu... 35 5.3
gi|19387268|gb|AAL87179.1| unknown [Oryza sativa (japonica culti... 34 7.0
gi|17535513|ref|NP_496326.1| homeobox protein (2L101) [Caenorhab... 34 7.0
gi|34899382|ref|NP_911037.1| unknown protein [Oryza sativa (japo... 34 7.0
gi|46228344|gb|EAK89243.1| Cbf5p; centromere-binding factor 5 li... 34 7.0
gi|18857955|ref|NP_572242.1| CG4119-PA [Drosophila melanogaster]... 34 7.0
gi|50287283|ref|XP_446071.1| unnamed protein product [Candida gl... 34 7.0
gi|31213477|ref|XP_315682.1| ENSANGP00000021730 [Anopheles gambi... 34 7.0
gi|2772928|gb|AAB96908.1| hTGN51 [Homo sapiens] 34 7.0
gi|12643559|sp|O43493|TGN2_HUMAN Trans-Golgi network integral me... 34 7.0
>gi|17540434|ref|NP_501809.1| putative nuclear protein family member
(4K789) [Caenorhabditis elegans]
gi|7503376|pir||T22163 hypothetical protein F44D12.8 - Caenorhabditis
elegans
gi|3877155|emb|CAA92604.1| Hypothetical protein F44D12.8
[Caenorhabditis elegans]
Length = 447
Score = 810 bits (2093), Expect = 0.0
Identities = 409/447 (91%), Positives = 409/447 (91%)
Frame = +1
Query: 1 MKSTTNLPIRQNDDNRRRKEGKSQNRRGGPKSKPQPTIVPPRKXXXXXXXXXXXXXIALP 180
MKSTTNLPIRQNDDNRRRKEGKSQNRRGGPKSKPQPTIVPPRK IALP
Sbjct: 1 MKSTTNLPIRQNDDNRRRKEGKSQNRRGGPKSKPQPTIVPPRKTPSPSTVTPLPTVIALP 60
Query: 181 AVSTPSPAQANLLKDPTATSPNVPGRERKAIRRKVTKEKVEKDPPKTTVRKKKNQVNQSL 360
AVSTPSPAQANLLKDPTATSPNVPGRERKAIRRKVTKEKVEKDPPKTTVRKKKNQVNQSL
Sbjct: 61 AVSTPSPAQANLLKDPTATSPNVPGRERKAIRRKVTKEKVEKDPPKTTVRKKKNQVNQSL 120
Query: 361 SAENTNAKTSSDNDERAGSKNDKPKKKNSHTXXXXXXXXXXAEIPSSGSKEDEKSGQKFN 540
SAENTNAKTSSDNDERAGSKNDKPKKKNSHT AEIPSSGSKEDEKSGQKFN
Sbjct: 121 SAENTNAKTSSDNDERAGSKNDKPKKKNSHTSSDSRRRRSSAEIPSSGSKEDEKSGQKFN 180
Query: 541 KDLAKNFFKHVQSQRAQKRSDDARLERMPESSQLNASARAMRKKKTNAPKTSLDSDLFKP 720
KDLAKNFFKHVQSQRAQKRSDDARLERMPESSQLNASARAMRKKKTNAPKTSLDSDLFKP
Sbjct: 181 KDLAKNFFKHVQSQRAQKRSDDARLERMPESSQLNASARAMRKKKTNAPKTSLDSDLFKP 240
Query: 721 NGEPVWVVPERAPGDCEKNDEGVPITNPELVAALAEDNIEIDEKSWFDHIGDYMSCAMPR 900
NGEPVWVVPERAPGDCEKNDEGVPITNPELVAALAEDNIEIDEKSWFDHIGDYMSCAMPR
Sbjct: 241 NGEPVWVVPERAPGDCEKNDEGVPITNPELVAALAEDNIEIDEKSWFDHIGDYMSCAMPR 300
Query: 901 GVTLPENHTFDSLAPRDKLEANSDFVSQETVAYNTVKNLVELSEDAIKRFSMKRDGIDDR 1080
GVTLPENHTFDSLAPRDKLEANSDFVSQETVAYNTVKNLVELSEDAIKRFSMKRDGIDDR
Sbjct: 301 GVTLPENHTFDSLAPRDKLEANSDFVSQETVAYNTVKNLVELSEDAIKRFSMKRDGIDDR 360
Query: 1081 ARPXXXXXXXXXXXXXXXMPLPPVKALSTDTISTTPGKAISFHMKNVVCLSYDRNHPIQS 1260
ARP MPLPPVKALSTDTISTTPGKAISFHMKNVVCLSYDRNHPIQS
Sbjct: 361 ARPTVTQDTTVETTIETTMPLPPVKALSTDTISTTPGKAISFHMKNVVCLSYDRNHPIQS 420
Query: 1261 IRKFRKKMSSKGVMEQSTQPKDSTKEL 1341
IRKFRKKMSSKGVMEQSTQPKDSTKEL
Sbjct: 421 IRKFRKKMSSKGVMEQSTQPKDSTKEL 447