Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= F45E1_2
         (411 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17567723|ref|NP_509344.1| histone, 3 (his-71) [Caenorhabditis...   265   2e-70
gi|39594220|emb|CAE70330.1| Hypothetical protein CBG16863 [Caeno...   265   2e-70
gi|17556046|ref|NP_499608.1| histone (15.4 kD) (his-72) [Caenorh...   264   3e-70
gi|4504279|ref|NP_002098.1| H3 histone, family 3A [Homo sapiens]...   263   4e-70
gi|48427895|sp|Q8WSF1|H33_TRIPS Histone H3.3 >gnl|BL_ORD_ID|6775...   262   1e-69
gi|45384744|gb|AAS59415.1| histone H3.3B [Chinchilla lanigera]        262   1e-69
gi|27718971|ref|XP_235304.1| similar to H3 histone, family 3B [R...   262   1e-69
gi|1079199|pir||S50140 histone H3.3 - sea urchin (Paracentrotus ...   262   1e-69
gi|18255537|gb|AAH21768.1| H3 histone, family 3B [Mus musculus]       261   2e-69
gi|2119012|pir||I50244 histone 3.3A - chicken >gnl|BL_ORD_ID|329...   261   2e-69
gi|31210957|ref|XP_314445.1| ENSANGP00000016056 [Anopheles gambi...   261   3e-69
gi|47085683|ref|NP_998161.1| zgc:56193 [Danio rerio] >gnl|BL_ORD...   261   3e-69
gi|31210959|ref|XP_314446.1| ENSANGP00000016066 [Anopheles gambi...   261   3e-69
gi|31239843|ref|XP_320335.1| ENSANGP00000014183 [Anopheles gambi...   261   3e-69
gi|2119013|pir||I49395 histone H3.2 protein - shrew mouse >gnl|B...   258   1e-68
gi|41106724|ref|XP_372795.1| similar to histone protein Hist2h3c...   258   2e-68
gi|34876364|ref|XP_344596.1| similar to CG31613-PA [Rattus norve...   258   2e-68
gi|34858254|ref|XP_227460.2| similar to histone protein Hist2h3c...   258   2e-68
gi|50728592|ref|XP_416193.1| PREDICTED: similar to histone prote...   258   2e-68
gi|34858260|ref|XP_227461.2| similar to histone protein Hist2h3c...   258   2e-68
gi|7305139|ref|NP_038576.1| histone 1, H3f; histone H3; histone ...   258   2e-68
gi|30061401|ref|NP_835734.1| H3 histone, family 2; histone 2, H3...   258   2e-68
gi|484530|pir||JQ1983 H3.3 like histone MH921 - mouse                 258   2e-68
gi|50729226|ref|XP_425464.1| PREDICTED: similar to histone prote...   258   2e-68
gi|34876394|ref|XP_225387.2| similar to histone protein Hist2h3c...   258   2e-68
gi|103198|pir||S10097 histone H3 - fruit fly (Drosophila melanog...   258   2e-68
gi|27661370|ref|XP_215175.1| similar to H3 histone, family 3B [R...   258   2e-68
gi|484441|pir||JN0687 histone H3 - sea squirt (Styela plicata)        257   4e-68
gi|9506767|ref|NP_062342.1| H3 histone, family 2; histone 2, H3c...   257   4e-68
gi|422606|pir||S32638 histone H3.l - African clawed frog >gnl|BL...   256   5e-68
gi|33114094|gb|AAP94665.1| histone H3 [Mytilus chilensis]             256   5e-68
gi|122088|sp|P02298|H3_PSAMI Histone H3, embryonic >gnl|BL_ORD_I...   256   5e-68
gi|7415982|dbj|BAA93627.1| histone H3 [Drosophila erecta]             256   5e-68
gi|38564127|dbj|BAD02413.1| histone 3 [Drosophila pseudoobscura]      256   5e-68
gi|2119011|pir||I48092 histone H3.2 - long-tailed hamster >gnl|B...   256   5e-68
gi|34876396|ref|XP_225393.2| similar to H3 histone family, membe...   256   7e-68
gi|47481388|gb|AAH69305.1| HIST1H3H protein [Homo sapiens]            256   7e-68
gi|26800901|emb|CAD38827.1| histone h3.1 [Oikopleura dioica]          256   7e-68
gi|15236103|ref|NP_195713.1| histone H3.2 [Arabidopsis thaliana]...   256   7e-68
gi|4504281|ref|NP_003520.1| H3 histone family, member A [Homo sa...   256   7e-68
gi|31196267|ref|XP_307081.1| ENSANGP00000001387 [Anopheles gambi...   256   7e-68
gi|211855|gb|AAA48795.1| histone H3                                   256   9e-68
gi|30268544|emb|CAD89679.1| Xenopus laevis-like histone H3 [Expr...   256   9e-68
gi|15232146|ref|NP_189372.1| histone H3 [Arabidopsis thaliana] >...   255   1e-67
gi|122087|sp|P02300|H3_PEA Histone H3 >gnl|BL_ORD_ID|337775 gi|8...   255   1e-67
gi|122079|sp|P22843|H3_ACRFO Histone H3 >gnl|BL_ORD_ID|142053 gi...   255   1e-67
gi|38564129|dbj|BAD02414.1| histone 3 [Drosophila persimilis]         255   1e-67
gi|2116601|dbj|BAA20144.1| Histone H3 [Drosophila simulans]           255   2e-67
gi|18698662|gb|AAL78367.1| disease-resistent-related protein [Or...   254   2e-67
gi|70747|pir||HSUR3M histone H3, embryonic - sea urchin (Psammec...   254   2e-67
gi|122083|sp|P08903|H3_ENCAL Histone H3 >gnl|BL_ORD_ID|1541633 g...   254   2e-67
gi|70749|pir||HSBO3 histone H3 - bovine >gnl|BL_ORD_ID|512205 gi...   254   3e-67
gi|39593568|emb|CAE61860.1| Hypothetical protein CBG05838 [Caeno...   254   3e-67
gi|166384|gb|AAA32655.1| histone H3 (H3-1.1)                          254   3e-67
gi|27573729|pdb|1KX3|A Chain A, X-Ray Structure Of The Nucleosom...   254   3e-67
gi|39581587|emb|CAE58372.1| Hypothetical protein CBG01499 [Caeno...   253   5e-67
gi|33114092|gb|AAP94664.1| histone H3 [Mytilus californianus]         253   5e-67
gi|47551071|ref|NP_999712.1| histone H3 [Strongylocentrotus purp...   253   5e-67
gi|13919643|gb|AAK21963.1| histone H3 [Trichinella spiralis]          253   5e-67
gi|1362108|pir||S56707 histone H3 homolog - common tobacco            253   5e-67
gi|7522681|gb|AAB27669.2| H3 histone [Styela plicata]                 253   5e-67
gi|70753|pir||HSPM3 histone H3 - garden pea (tentative sequence)...   253   5e-67
gi|161319|gb|AAA30003.1| histone H3                                   253   6e-67
gi|45768281|gb|AAH67493.1| HIST1H3H protein [Homo sapiens]            253   6e-67
gi|18202621|sp|Q93081|H3B_HUMAN Histone H3/b >gnl|BL_ORD_ID|9936...   253   8e-67
gi|11513397|pdb|1F66|A Chain A, 2.6 A Crystal Structure Of A Nuc...   253   8e-67
gi|45768640|gb|AAH67494.1| HIST1H3H protein [Homo sapiens]            253   8e-67
gi|386772|gb|AAA52651.1| histone H3                                   253   8e-67
gi|45219796|gb|AAH66884.1| HIST1H3H protein [Homo sapiens]            252   1e-66
gi|17532993|ref|NP_496899.1| histone (his-42) [Caenorhabditis el...   252   1e-66
gi|484531|pir||JQ1984 H3.3 like histone MH321 - mouse                 252   1e-66
gi|122070|sp|P08860|H32_ORYSA Histone H3 >gnl|BL_ORD_ID|1830601 ...   251   2e-66
gi|27671651|ref|XP_220509.1| similar to H3 histone family, membe...   251   2e-66
gi|6686276|sp|P08898|H3_CAEEL Histone H3                              251   2e-66
gi|70748|pir||HSUR3P histone H3, embryonic - sea urchin (Strongy...   251   2e-66
gi|159967|gb|AAA75395.1| histone H3                                   251   2e-66
gi|4504299|ref|NP_003484.1| H3 histone family, member T [Homo sa...   251   3e-66
gi|28192620|gb|AAO23911.1| histone H3 [Toxoplasma gondii]             250   4e-66
gi|19880141|gb|AAM00267.1| histone 3 [Eimeria tenella]                250   4e-66
gi|48427860|sp|Q9HDN1|H3_MORAP Histone H3 >gnl|BL_ORD_ID|1822441...   250   5e-66
gi|47551065|ref|NP_999709.1| histone H3 (partial) (3AA) [Strongy...   249   7e-66
gi|122074|sp|P02302|H32_XENLA Histone H3.2                            249   9e-66
gi|28948510|pdb|1M18|A Chain A, Ligand Binding Alters The Struct...   249   9e-66
gi|46015095|pdb|1P3B|A Chain A, Crystallographic Studies Of Nucl...   248   1e-65
gi|19112349|ref|NP_595557.1| histone H3.1 [Schizosaccharomyces p...   248   2e-65
gi|46432310|gb|EAK91799.1| hypothetical protein CaO19.9411 [Cand...   248   3e-65
gi|32394681|gb|AAN39007.1| histone H3 [Griffithsia japonica]          248   3e-65
gi|10732809|gb|AAG22548.1| histone H3 [Rubus idaeus]                  247   3e-65
gi|22476750|gb|AAM95790.1| histone H3.3 variant; TgH3.3 [Toxopla...   247   3e-65
gi|122090|sp|P08437|H3_VOLCA Histone H3 >gnl|BL_ORD_ID|1118537 g...   247   3e-65
gi|70755|pir||HSXL32 histone H3.2 - African clawed frog               247   3e-65
gi|15222297|ref|NP_177690.1| histone H3.2, putative [Arabidopsis...   247   4e-65
gi|33772147|gb|AAQ54510.1| histone 3 [Malus x domestica]              247   4e-65
gi|17565064|ref|NP_506164.1| histone 3.3 (15.3 kD) (5N140) [Caen...   246   6e-65
gi|32401023|gb|AAP80717.1| putative histone H3 protein [Griffith...   246   6e-65
gi|46015135|pdb|1P3K|A Chain A, Crystallographic Studies Of Nucl...   246   6e-65
gi|46015085|pdb|1P3A|A Chain A, Crystallographic Studies Of Nucl...   246   6e-65
gi|422605|pir||S32621 histone H3.r - African clawed frog >gnl|BL...   246   7e-65
gi|46015075|pdb|1P34|A Chain A, Crystallographic Studies Of Nucl...   246   7e-65
gi|2119018|pir||S59592 histone H3 (clone CH-I) - Chlamydomonas r...   246   7e-65
gi|46015155|pdb|1P3M|A Chain A, Crystallographic Studies Of Nucl...   246   7e-65
gi|49074852|ref|XP_401531.1| H3_EMENI Histone H3 [Ustilago maydi...   246   1e-64
gi|44890574|gb|AAH66906.1| Unknown (protein for MGC:87082) [Homo...   246   1e-64
gi|46015145|pdb|1P3L|A Chain A, Crystallographic Studies Of Nucl...   246   1e-64
gi|46226955|gb|EAK87921.1| histone H3 [Cryptosporidium parvum]        245   1e-64
gi|50408553|ref|XP_456791.1| unnamed protein product [Debaryomyc...   245   1e-64
gi|15238430|ref|NP_201338.1| histone H3 [Arabidopsis thaliana] >...   245   2e-64
gi|122076|sp|P10651|H33_SCHPO Histone H3.3 >gnl|BL_ORD_ID|103203...   245   2e-64
gi|23479592|gb|EAA16379.1| histone 3 [Plasmodium yoelii yoelii] ...   245   2e-64
gi|21542072|sp|Q9U7D1|H3_MASBA Histone H3 >gnl|BL_ORD_ID|83598 g...   245   2e-64
gi|39581923|emb|CAE72885.1| Hypothetical protein CBG20198 [Caeno...   244   3e-64
gi|122080|sp|P23753|H3_EMENI Histone H3 >gnl|BL_ORD_ID|1506742 g...   244   3e-64
gi|21555021|gb|AAM63756.1| histone H3 protein, putative [Arabido...   244   3e-64
gi|46441602|gb|EAL00898.1| hypothetical protein CaO19.14083 [Can...   244   3e-64
gi|20870491|ref|XP_127613.1| similar to Histone H3.3 [Mus musculus]   244   3e-64
gi|50255718|gb|EAL18450.1| hypothetical protein CNBJ0920 [Crypto...   244   4e-64
gi|32415189|ref|XP_328074.1| HISTONE H3 [Neurospora crassa] >gnl...   244   4e-64
gi|1708109|sp|P50564|H3_CHLRE Histone H3 >gnl|BL_ORD_ID|724380 g...   244   4e-64
gi|32401039|gb|AAP80725.1| histone H3.3 protein [Griffithsia jap...   243   5e-64
gi|46228167|gb|EAK89066.1| histone H3 [Cryptosporidium parvum]        243   5e-64
gi|50423783|ref|XP_460476.1| unnamed protein product [Debaryomyc...   243   6e-64
gi|15222272|ref|NP_172794.1| histone H3, putative [Arabidopsis t...   243   8e-64
gi|26800908|emb|CAD38833.1| histone h3.2 [Oikopleura dioica]          242   1e-63
gi|48427861|sp|Q9P427|H3_AJECA Histone H3 >gnl|BL_ORD_ID|474583 ...   242   1e-63
gi|83767|pir||S07350 histone H3 - Neurospora crassa >gnl|BL_ORD_...   242   1e-63
gi|49072070|ref|XP_400324.1| H3_DROME Histone H3 [Ustilago maydi...   242   1e-63
gi|559807|gb|AAA85673.1| histone H3 >gnl|BL_ORD_ID|1938805 gi|23...   241   2e-63
gi|6686555|emb|CAB64685.1| putative H3 histone [Asellus aquaticus]    241   3e-63
gi|30156584|ref|XP_293312.2| similar to H3 histone, family 3B [H...   241   3e-63
gi|23612258|ref|NP_703838.1| histone h3 [Plasmodium falciparum 3D7]   240   4e-63
gi|6319482|ref|NP_009564.1| One of two identical histone H3 prot...   240   4e-63
gi|50308671|ref|XP_454338.1| unnamed protein product [Kluyveromy...   240   4e-63
gi|488571|gb|AAB36495.1| histone H3.2                                 239   7e-63
gi|1053047|gb|AAB03538.1| histone H3 >gnl|BL_ORD_ID|430654 gi|10...   238   2e-62
gi|38090036|ref|XP_194481.2| similar to H3 histone, family 3B [M...   238   2e-62
gi|48427892|sp|Q8NJS5|H32_CANGA Histone H3.2 >gnl|BL_ORD_ID|1440...   238   2e-62
gi|49085508|ref|XP_404870.1| H3_EMENI Histone H3 [Aspergillus ni...   238   2e-62
gi|45439479|gb|AAS64341.1| histone H3 [Saccharomyces cerevisiae]...   238   2e-62
gi|1053057|gb|AAB03542.1| histone H3                                  238   3e-62
gi|50259668|gb|EAL22338.1| hypothetical protein CNBB5130 [Crypto...   237   4e-62
gi|15988132|pdb|1ID3|A Chain A, Crystal Structure Of The Yeast N...   237   4e-62
gi|1053045|gb|AAB03537.1| histone H3                                  236   6e-62
gi|46116896|ref|XP_384466.1| H3_NEUCR Histone H3 [Gibberella zea...   236   6e-62
gi|27923411|gb|AAN46681.1| histone 3 [Gromphadorhina portentosa]...   236   8e-62
gi|47190613|emb|CAF87097.1| unnamed protein product [Tetraodon n...   235   1e-61
gi|1053059|gb|AAB03543.1| histone H3                                  234   2e-61
gi|27923429|gb|AAN46690.1| histone 3 [Grylloblatta campodeiformis]    234   2e-61
gi|122077|sp|P06902|H34_CAIMO Histone H3.4 >gnl|BL_ORD_ID|140393...   234   2e-61
gi|38085079|ref|XP_357664.1| similar to H3 histone, family 3B [M...   234   2e-61
gi|488573|gb|AAB36496.1| histone H3.2 precursor [Medicago sativa]     234   3e-61
gi|529954|gb|AAA20819.1| histone H3                                   234   3e-61
gi|729676|sp|P15511|H31_TETPY Histone H3.1 >gnl|BL_ORD_ID|128782...   233   5e-61
gi|27923495|gb|AAN46723.1| histone 3 [Tropidoderus childrenii]        233   8e-61
gi|27923457|gb|AAN46704.1| histone 3 [Extatosoma tiaratum] >gnl|...   233   8e-61
gi|20908581|ref|XP_127461.1| similar to H3 histone, family 3B [M...   231   2e-60
gi|84329|pir||A28852 histone H3.1 - Tetrahymena pyriformis >gnl|...   231   2e-60
gi|19611|emb|CAA31966.1| histone H3 (AA 1-123) [Medicago sativa]...   231   2e-60
gi|20138105|sp|P90543|H3_EUPCR Histone H3 >gnl|BL_ORD_ID|1285689...   231   2e-60
gi|27923431|gb|AAN46691.1| histone 3 [Nasutitermes sp. IS06]          229   9e-60
gi|15223698|ref|NP_173418.1| histone H3, putative [Arabidopsis t...   229   1e-59
gi|122066|sp|P15512|H32_TETPY Histone H3.2 >gnl|BL_ORD_ID|802894...   228   2e-59
gi|2253615|gb|AAB63013.1| histone H3 [Dictyostelium discoideum]       228   2e-59
gi|729677|sp|P41353|H33_TETTH Histone H3.3 (HV2) >gnl|BL_ORD_ID|...   227   4e-59
gi|556612|gb|AAC46613.1| histone H3                                   226   6e-59
gi|352175|prf||1006235B histone H3(2)                                 226   6e-59
gi|14582752|gb|AAK69621.1| histone H3 [Fusarium proliferatum] >g...   226   6e-59
gi|25404986|pir||B96786 protein F10A5.19 [imported] - Arabidopsi...   226   1e-58
gi|6010083|emb|CAB57248.1| histone H3 [Entodinium caudatum]           226   1e-58
gi|44885675|dbj|BAD11819.1| histone H3 [Lentinula edodes]             224   2e-58
gi|6010043|emb|CAB57230.1| histone H3 [Entodinium caudatum]           224   2e-58
gi|27923453|gb|AAN46702.1| histone 3 [Orxines macklottii] >gnl|B...   224   3e-58
gi|38102691|gb|EAA49501.1| hypothetical protein MG01159.4 [Magna...   224   4e-58
gi|38083273|ref|XP_355041.1| similar to calreticulin 3 [Mus musc...   224   4e-58
gi|81850|pir||S04521 histone H3 (clone pH3c-1) - alfalfa (fragme...   223   5e-58
gi|50556960|ref|XP_505888.1| hypothetical protein [Yarrowia lipo...   223   9e-58
gi|37549909|ref|XP_293943.2| similar to histone (15.4 kD) (his-7...   222   1e-57
gi|27923451|gb|AAN46701.1| histone 3 [Oreophoetes peruana] >gnl|...   221   2e-57
gi|7439810|pir||T04411 histone H3 - barley (fragment) >gnl|BL_OR...   221   3e-57
gi|20347073|ref|XP_111200.1| similar to H3 histone, family 3B [M...   221   3e-57
gi|27923463|gb|AAN46707.1| histone 3 [Aretaon asperrimus] >gnl|B...   221   3e-57
gi|27923499|gb|AAN46725.1| histone 3 [Sungaya inexpectata]            221   3e-57
gi|27923483|gb|AAN46717.1| histone 3 [Neohirasea sp. WS29] >gnl|...   221   3e-57
gi|85000|pir||A02630 histone H3 - fruit fly (Drosophila melanoga...   220   6e-57
gi|34013708|gb|AAQ56017.1| histone 3 [Machilis sp. AR01] >gnl|BL...   219   1e-56
gi|39592224|emb|CAE75445.1| Hypothetical protein CBG23439 [Caeno...   219   1e-56
gi|4761212|gb|AAD29277.1| histone H3.3 [Squalus acanthias]            218   2e-56
gi|41147170|ref|XP_373079.1| similar to histone (15.4 kD) (his-7...   218   2e-56
gi|34898304|ref|NP_910498.1| histone H3 [Oryza sativa (japonica ...   218   2e-56
gi|34013740|gb|AAQ56033.1| histone 3 [Anthopotamus sp. Eph22]         218   2e-56
gi|122078|sp|P02301|H34_MOUSE Histone H3.4 (Embryonic) >gnl|BL_O...   218   3e-56
gi|3745758|pdb|1AOI|A Chain A, X-Ray Structure Of The Nucleosome...   217   4e-56
gi|1360625|emb|CAA66646.1| histone H3-1 [Trichomonas vaginalis]       217   5e-56
gi|1731925|emb|CAA71083.1| histone H3 [Anopheles gambiae]             217   5e-56
gi|34013738|gb|AAQ56032.1| histone 3 [Caenis sp. Eph19]               217   5e-56
gi|1197519|emb|CAA64881.1| histone H3 [Narcissus pseudonarcissus]     217   5e-56
gi|38073801|ref|XP_193164.2| similar to H3 histone, family 3B [M...   216   6e-56
gi|4574208|gb|AAD23951.1| histone H3 [Tortula ruralis]                216   8e-56
gi|70760|pir||HSMS34 histone H3.4 - mouse                             216   1e-55
gi|27808202|gb|AAO24266.1| histone [Alternaria arborescens] >gnl...   216   1e-55
gi|30140414|emb|CAD24558.1| histone H3 [Paranemertes sp. 249]         215   2e-55
gi|17552868|ref|NP_497811.1| histone (his-69) [Caenorhabditis el...   214   4e-55
gi|27808292|gb|AAO24311.1| histone [Lewia infectoria]                 213   5e-55
gi|24581849|ref|NP_723056.1| CG5825-PB [Drosophila melanogaster]...   213   7e-55
gi|27923479|gb|AAN46715.1| histone 3 [Gratidia hispidula]             213   7e-55
gi|12745561|gb|AAK07097.1| histone H3 [Fusarium cerealis] >gnl|B...   212   1e-54
gi|38607216|gb|AAR25515.1| histone H3 [Cryptoplax japonica]           212   1e-54
gi|38607188|gb|AAR25501.1| histone H3 [Lepidozona mertensii]          212   2e-54
gi|38607178|gb|AAR25496.1| histone H3 [Nuttallochiton mirandus]       211   2e-54
gi|27923513|gb|AAN46732.1| histone 3 [Phobaeticus heusii]             211   2e-54
gi|27808278|gb|AAO24304.1| histone [Lewia infectoria]                 211   3e-54
gi|21667246|gb|AAM73999.1| histone H3p [Euplotes octocarinatus]       210   4e-54
gi|30139734|emb|CAD24544.1| histone H3 [Amphiporus angulatus] >g...   209   8e-54
gi|37654350|gb|AAQ96274.1| H3L-like histone [Mus musculus] >gnl|...   209   1e-53
gi|30139740|emb|CAD24547.1| histone H3 [Amphiporus lactifloreus]      209   1e-53
gi|37654354|gb|AAQ96276.1| H3L-like histone [Ciona intestinalis]...   209   1e-53
gi|41353897|gb|AAS01408.1| histone H3 [Poecilasma inaequilaterale]    208   2e-53
gi|30140416|emb|CAD24560.1| histone H3 [Poseidonemertes sp. 508]      208   2e-53
gi|4883735|gb|AAD31614.1| histone H3 [Euperipatoides leuckartii]...   208   2e-53
gi|30140264|emb|CAD24553.1| histone H3 [Nemertellina yamaokai] >...   208   2e-53
gi|30140298|emb|CAD24581.1| histone H3 [Hubrechtella dubia]           208   2e-53
gi|38505248|gb|AAL75875.2| histone H3 [Corbicula fluminea] >gnl|...   207   3e-53
gi|30140418|emb|CAD24562.1| histone H3 [Tetrastemma elegans]          207   3e-53
gi|30140432|emb|CAD24576.1| histone H3 [Ramphogordius sanguineus]     207   3e-53
gi|12745587|gb|AAK07110.1| histone H3 [Gibberella zeae]               207   4e-53
gi|30140280|emb|CAD24567.1| histone H3 [Nectonemertes mirabilis]      207   4e-53
gi|38607200|gb|AAR25507.1| histone H3 [Plaxiphora albida]             207   4e-53
gi|38607166|gb|AAR25490.1| histone H3 [Callochiton septemvalvis]      207   4e-53
gi|1870700|gb|AAB48833.1| cleavage stage histone H3 [Psammechinu...   207   4e-53
gi|4883756|gb|AAD31635.1| histone H3 [Triops australiensis] >gnl...   207   5e-53
gi|38505229|gb|AAL75856.2| histone H3 [Lepidopleurus cajetanus] ...   207   5e-53
gi|30725238|gb|AAP37654.1| histone H3 [Cleosiphon aspergillus]        207   5e-53
gi|30140420|emb|CAD24563.1| histone H3 [Tetrastemma wilsoni]          206   6e-53
gi|4883748|gb|AAD31627.1| histone H3 [Archisotoma sp.]                206   6e-53
gi|38505239|gb|AAL75866.2| histone H3 [Limaria hians]                 206   6e-53
gi|30140434|emb|CAD24578.1| histone H3 [Riserius pugetensis]          206   6e-53
gi|37654352|gb|AAQ96275.1| H3L-like histone [Homo sapiens]            206   6e-53
gi|21238540|gb|AAL79640.1| histone H3 [Lepthyphantes minutus]         206   6e-53
gi|16118767|gb|AAL14586.1| histone 3 [Anadara grandis] >gnl|BL_O...   206   8e-53
gi|4883745|gb|AAD31624.1| histone H3 [Unixenus mjobergi]              206   8e-53
gi|45545250|gb|AAS67475.1| histone 3 [Stagmomantis limbata]           206   8e-53
gi|4883741|gb|AAD31620.1| histone H3 [Cormocephalus sp.] >gnl|BL...   206   8e-53
gi|45545186|gb|AAS67443.1| histone 3 [Blattidae sp. B02]              206   8e-53
gi|38607260|gb|AAR25537.1| histone H3 [Architeuthis dux]              206   1e-52
gi|30725214|gb|AAP37642.1| histone H3 [Phascolosoma granulatum]       206   1e-52
gi|38607218|gb|AAR25516.1| histone H3 [Prochaetoderma sp. AO-2003]    206   1e-52
gi|30140292|emb|CAD24577.1| histone H3 [Parborlasia corrugatus]       206   1e-52
gi|41353887|gb|AAS01403.1| histone H3 [Verruca stroemia]              206   1e-52
gi|38607168|gb|AAR25491.1| histone H3 [Lepidochitona cinerea]         205   1e-52
gi|4883753|gb|AAD31632.1| histone H3 [Hutchinsoniella macracantha]    205   1e-52
gi|45545282|gb|AAS67491.1| histone 3 [Statilia apicalis]              205   2e-52
gi|38607228|gb|AAR25521.1| histone H3 [Epimenia australis]            205   2e-52
gi|4883747|gb|AAD31626.1| histone H3 [Nipponentomon sp.]              205   2e-52
gi|12745583|gb|AAK07108.1| histone H3 [Gibberella zeae]               205   2e-52
gi|38607214|gb|AAR25514.1| histone H3 [Cryptochiton stelleri]         204   2e-52
gi|38607190|gb|AAR25502.1| histone H3 [Stenoplax alata]               204   2e-52
gi|33086766|gb|AAP79082.1| histone H3A [Rugathodes sexpunctatus]      204   2e-52
gi|15986559|gb|AAL11667.1| histone H3 [Callibaetis ferrugineus]       204   2e-52
gi|4883752|gb|AAD31631.1| histone H3 [Atalophlebia sp.]               204   2e-52
gi|38607196|gb|AAR25505.1| histone H3 [Lorica volvox]                 204   2e-52
gi|12745585|gb|AAK07109.1| histone H3 [Gibberella zeae]               204   2e-52
gi|37654356|gb|AAQ96277.1| H3L-like histone [Oryctolagus cuniculus]   204   3e-52
gi|30140426|emb|CAD24569.1| histone H3 [Protopelagonemertes sp. ...   204   3e-52
gi|45545248|gb|AAS67474.1| histone 3 [Ima sp. MN030]                  204   3e-52
gi|4883734|gb|AAD31613.1| histone H3 [Oroperipatus corrodai]          204   3e-52
gi|27923517|gb|AAN46734.1| histone 3 [Agathemera crassa]              204   3e-52
gi|4883744|gb|AAD31623.1| histone H3 [Epicyliosoma sp. AMcL-1999]     204   4e-52
gi|33086772|gb|AAP79085.1| histone H3A [Steatoda bipunctata]          203   5e-52
gi|4883751|gb|AAD31630.1| histone H3 [Petrobiinae gen. sp.]           203   5e-52
gi|4883762|gb|AAD31641.1| histone H3 [Lychas marmoreus]               203   7e-52
gi|4883749|gb|AAD31628.1| histone H3 [Tricholepidion gertschi]        202   9e-52
gi|33086784|gb|AAP79091.1| histone H3A [Tidarren sisyphoides]         202   9e-52
gi|4883746|gb|AAD31625.1| histone H3 [Campodea tillyardi]             202   9e-52
gi|4883743|gb|AAD31622.1| histone H3 [Pauropodinae gen. sp.]          202   9e-52
gi|34875728|ref|XP_346042.1| similar to H3 histone, family 3B [R...   202   1e-51
gi|38607238|gb|AAR25526.1| histone H3 [Rhabdus rectius]               202   1e-51
gi|38505231|gb|AAL75858.2| histone H3 [Rhabdus rectius]               202   2e-51
gi|12847552|dbj|BAB27616.1| unnamed protein product [Mus musculus]    189   2e-51
gi|1814238|gb|AAC47441.1| developmental-specific histone H3 [Eup...   201   3e-51
gi|34869736|ref|XP_223966.2| similar to H3 histone, family 3B [R...   201   3e-51
gi|21304608|gb|AAM45431.1| histone H3 [Cryphonectria cubensis] >...   201   4e-51
gi|15986565|gb|AAL11670.1| histone H3 [Balanus balanus] >gnl|BL_...   201   4e-51
gi|4883754|gb|AAD31633.1| histone H3 [Lasionectes exleyi]             200   5e-51
gi|7329709|emb|CAB82768.1| histone H3 [Fucus serratus]                200   6e-51
gi|27923511|gb|AAN46731.1| histone 3 [Oncotophasma martini]           199   8e-51
gi|4883733|gb|AAD31612.1| histone H3 [Tasmanipatus barretti]          199   8e-51
gi|4883759|gb|AAD31638.1| histone H3 [Kempina mikado]                 199   8e-51
gi|27674585|ref|XP_223924.1| similar to H3 histone, family 3B [R...   199   1e-50
gi|4883736|gb|AAD31615.1| histone H3 [Craterostigmus tasmanianus]     199   1e-50
gi|30140278|emb|CAD24566.1| histone H3 [Pelagonemertes sp. 545]       199   1e-50
gi|15986561|gb|AAL11668.1| histone H3 [Periplaneta americana] >g...   198   2e-50
gi|4883760|gb|AAD31639.1| histone H3 [Ammothella biunguiculata]       198   2e-50
gi|20983318|ref|XP_141658.1| similar to H3.3 like histone MH321 ...   198   2e-50
gi|4883739|gb|AAD31618.1| histone H3 [Lithobius sydneyensis]          197   4e-50
gi|4883755|gb|AAD31634.1| histone H3 [Nebalia sp.]                    197   5e-50
gi|27923459|gb|AAN46705.1| histone 3 [Ctenomorphodes briareus]        196   9e-50
gi|4883737|gb|AAD31616.1| histone H3 [Schizoribautia sp.]             196   9e-50
gi|34013748|gb|AAQ56037.1| histone 3 [Chaquihua sp. Eph80]            196   1e-49
gi|4883758|gb|AAD31637.1| histone H3 [Branchianella sp. 3]            195   1e-49
gi|27685707|ref|XP_225322.1| similar to H3 histone, family 3B [R...   195   2e-49
gi|4883740|gb|AAD31619.1| histone H3 [Allothereua maculata]           194   3e-49
gi|45545196|gb|AAS67448.1| histone 3 [Tenodera aridifolia]            194   3e-49
gi|5918714|gb|AAD56099.1| histone H3 [Fusarium oxysporum] >gnl|B...   194   4e-49
gi|38082327|ref|XP_139915.2| similar to H3 histone, family 3B [M...   193   6e-49
gi|45545292|gb|AAS67496.1| histone 3 [Cliomantis sp. MN055]           193   7e-49
gi|33086764|gb|AAP79081.1| histone H3A [Robertus neglectus]           192   1e-48
gi|5918752|gb|AAD56137.1| histone H3 [Fusarium proliferatum] >gn...   192   1e-48
gi|47496935|dbj|BAD20005.1| putative histone H3.2 [Oryza sativa ...   191   2e-48
gi|30725208|gb|AAP37639.1| histone H3 [Phascolion strombi]            191   2e-48
gi|29421778|gb|AAO84429.1| histone H3 [Fusarium subglutinans]         191   2e-48
gi|3219790|sp|P81198|H34_STYLE Histone H3-4 >gnl|BL_ORD_ID|15102...   191   4e-48
gi|34013728|gb|AAQ56027.1| histone 3 [Polyplocia sp. Eph132]          191   4e-48
gi|38505232|gb|AAL75859.2| histone H3 [Haliotis tuberculata]          191   4e-48
gi|12957226|gb|AAK09086.1| histone H3 [Fusarium subglutinans] >g...   190   5e-48
gi|13812129|ref|NP_113256.1| Histone H3 [Guillardia theta] >gnl|...   190   6e-48
gi|17552870|ref|NP_497812.1| histone (his-70) [Caenorhabditis el...   189   1e-47
gi|47225158|emb|CAF98785.1| unnamed protein product [Tetraodon n...   189   2e-47
gi|6049770|gb|AAF02723.1| histone H3 [Idanthyrsus pennatus] >gnl...   187   3e-47
gi|45545272|gb|AAS67486.1| histone 3 [Tarachina sp. MN043]            187   4e-47
gi|6049801|gb|AAF02754.1| histone H3 [Lumbricus terrestris]           187   4e-47
gi|28189276|dbj|BAC56329.1| similar to H3 histone, family 3A [Bo...   187   4e-47
gi|3219789|sp|P81197|H33_STYLE Histone H3-3 >gnl|BL_ORD_ID|18013...   187   4e-47
gi|34101261|gb|AAQ57668.1| histone H3-D [Amphicarpaea bracteata]...   187   5e-47
gi|19850230|gb|AAL99606.1| histone H3 [Amaeana trilobata]             186   7e-47
gi|15239940|ref|NP_196795.1| histone H3, putative [Arabidopsis t...   186   9e-47
gi|30140272|emb|CAD24557.1| histone H3 [Paranemertes peregrina]       186   9e-47
gi|6049773|gb|AAF02726.1| histone H3 [Owenia fusiformis]              186   1e-46
gi|6049780|gb|AAF02733.1| histone H3 [Amphitritides harpa]            186   1e-46
gi|29421746|gb|AAO84413.1| histone H3 [Fusarium subglutinans] >g...   186   1e-46
gi|6049800|gb|AAF02753.1| histone H3 [Scoloplos simplex]              186   1e-46
gi|46562286|gb|AAT01279.1| histone H3 [Phyllodoce sp. AMEBU14763...   186   1e-46
gi|3219792|sp|P81200|H36_STYLE Histone H3-6 >gnl|BL_ORD_ID|12519...   186   1e-46
gi|6049771|gb|AAF02724.1| histone H3 [Amphiglena terebro]             185   2e-46
gi|6049775|gb|AAF02728.1| histone H3 [Glycera sp. AMW196835]          185   2e-46
gi|15425972|gb|AAK97636.1| histone 3 [Ophiostoma novo-ulmi subsp...   184   3e-46
gi|3219791|sp|P81199|H35_STYLE Histone H3-5 >gnl|BL_ORD_ID|79979...   184   3e-46
gi|3219788|sp|P81195|H31_STYLE Histone H3-1 >gnl|BL_ORD_ID|15288...   184   3e-46
gi|6049795|gb|AAF02748.1| histone H3 [Euclymene trinalis]             184   3e-46
gi|12641619|emb|CAC27454.1| histone H3 [Beta vulgaris subsp. vul...   184   3e-46
gi|6049785|gb|AAF02738.1| histone H3 [Mesochaetopterus sp. AMW22...   184   3e-46
gi|3219803|sp|P81196|H39_STYLE Histone H3-2 >gnl|BL_ORD_ID|40610...   184   4e-46
gi|3219805|sp|P81202|H38_STYLE Histone H3-8 >gnl|BL_ORD_ID|10758...   183   8e-46
gi|29421760|gb|AAO84420.1| histone H3 [Fusarium subglutinans] >g...   183   8e-46
gi|45545294|gb|AAS67497.1| histone 3 [Gyromantis occidentalis]        182   1e-45
gi|2909431|emb|CAA76324.1| histone 3 [Stylonychia lemnae]             182   1e-45
gi|38505249|gb|AAL75876.2| histone H3 [Sphaerium striatinum]          182   1e-45
gi|45545284|gb|AAS67492.1| histone 3 [Statilia apicalis]              182   1e-45
gi|45545234|gb|AAS67467.1| histone 3 [Stagmomantis carolina]          182   1e-45
gi|39593571|emb|CAE61863.1| Hypothetical protein CBG05841 [Caeno...   136   1e-45
gi|1762791|gb|AAB39569.1| developmental-specific histone H3 prot...   181   3e-45
gi|19850226|gb|AAL99604.1| histone H3 [Amphicteis dalmatica]          181   3e-45
gi|34101298|gb|AAQ57676.1| histone H3-D [Amphicarpaea bracteata]      181   3e-45
gi|50740770|ref|XP_426116.1| PREDICTED: similar to Histone H3.3 ...   181   4e-45
gi|38607212|gb|AAR25513.1| histone H3 [Acanthochitona crinita]        180   5e-45
gi|6049796|gb|AAF02749.1| histone H3 [Mediomastus australiensis]      180   5e-45
gi|23304734|emb|CAC27521.2| histone H3.3 [Platichthys flesus]         180   6e-45
gi|45545256|gb|AAS67478.1| histone 3 [Heterochaetula sp. MN034] ...   179   1e-44
gi|19850232|gb|AAL99607.1| histone H3 [Lysilla pacifica]              179   1e-44
gi|34101265|gb|AAQ57670.1| histone H3-D [Amphicarpaea bracteata]      179   1e-44
gi|47496932|dbj|BAD20002.1| putative histone H3.2 [Oryza sativa ...   177   4e-44
gi|34101270|gb|AAQ57671.1| histone H3-D [Amphicarpaea bracteata]      176   9e-44
gi|45545230|gb|AAS67465.1| histone 3 [Calofulcinia australis]         176   1e-43
gi|33086774|gb|AAP79086.1| histone H3A [Styposis selis]               176   1e-43
gi|27663164|ref|XP_234084.1| similar to H3 histone, family 3B [R...   176   1e-43
gi|4139869|pdb|1HIO|C Chain C, Histone Octamer (Chicken), Chromo...   174   3e-43
gi|28189807|dbj|BAC56518.1| similar to H3 histone, family 3A [Bo...   174   4e-43
gi|34866976|ref|XP_345844.1| similar to Histone H3.3A CG5825-PB ...   174   4e-43
gi|6049797|gb|AAF02750.1| histone H3 [Notomastus torquatus]           173   8e-43
gi|38505230|gb|AAL75857.2| histone H3 [Acanthochitona crinita]        172   2e-42
gi|3002595|gb|AAC08759.1| histone H3 [Aplysia cf. juliana] >gnl|...   171   3e-42
gi|1881601|gb|AAB49451.1| histone H3 [Drosophila virilis]             171   4e-42
gi|28189338|dbj|BAC56360.1| similar to H3 histone, family 3A [Bo...   171   4e-42
gi|47196914|emb|CAF87474.1| unnamed protein product [Tetraodon n...   171   4e-42
gi|34871964|ref|XP_345589.1| similar to H3 histone, family 3B [R...   170   5e-42
gi|39594533|emb|CAE72111.1| Hypothetical protein CBG19204 [Caeno...   170   5e-42
gi|15420394|gb|AAK97370.1| histone H3 [Fusarium oxysporum f. sp....   170   7e-42
gi|3002633|gb|AAC08778.1| histone H3 [Ischnochiton australis]         170   7e-42
gi|3002597|gb|AAC08760.1| histone H3 [Austrocochlea porcata] >gn...   169   9e-42
gi|3002657|gb|AAC08790.1| histone H3 [Onchidium sp.] >gnl|BL_ORD...   169   1e-41
gi|3002643|gb|AAC08783.1| histone H3 [Notocrater houbricki]           169   1e-41
gi|12621989|gb|AAC08785.2| histone H3 [Nerita atramentosa]            169   1e-41
gi|23612186|ref|NP_703766.1| histone H3, putative [Plasmodium fa...   169   1e-41
gi|20898426|ref|XP_138832.1| similar to H3 histone, family 3B [M...   169   1e-41
gi|4883738|gb|AAD31617.1| histone H3 [Mecistocephalus sp. AM-1999]    168   2e-41
gi|3002635|gb|AAC08779.1| histone H3 [Lepetodrilus fucensis]          168   3e-41
gi|46562288|gb|AAT01280.1| histone H3 [Hyboscolex sp. AMEBU14762]     167   4e-41
gi|3002637|gb|AAC08780.1| histone H3 [Leptopoma perlucida]            167   4e-41
gi|3002613|gb|AAC08768.1| histone H3 [Conus miles]                    167   6e-41
gi|1723293|sp|Q10460|YB21_CAEEL Hypothetical histone 3-like prot...   166   7e-41
gi|3002663|gb|AAC08793.1| histone H3 [Perotrochus midas]              166   1e-40
gi|20903697|ref|XP_139579.1| similar to Histone H3.3 [Mus musculus]   166   1e-40
gi|19173103|ref|NP_597654.1| HISTONE H3 [Encephalitozoon cunicul...   166   1e-40
gi|1881594|gb|AAB49448.1| histone H3 [Drosophila virilis]             166   1e-40
gi|1085858|pir||S42066 histone H3.3 - Leptothorax acervorum (fra...   166   1e-40
gi|38074671|ref|XP_357183.1| similar to Histone H3.3 [Mus musculus]   165   2e-40
gi|3002621|gb|AAC08772.1| histone H3 [Cancellaria undulata]           164   3e-40
gi|45545224|gb|AAS67462.1| histone 3 [Rhombodera stalii]              164   3e-40
gi|3002649|gb|AAC08786.1| histone H3 [Nassarius burchardi]            164   4e-40
gi|50260752|gb|EAL23402.1| hypothetical protein CNBA0520 [Crypto...   163   8e-40
gi|3002603|gb|AAC08763.1| histone H3 [Bellamya heudi guangdungen...   162   1e-39
gi|14537622|gb|AAK66643.1| histone [Seiridium unicorne] >gnl|BL_...   160   5e-39
gi|462241|sp|Q06196|H3_ENTHI Histone H3 >gnl|BL_ORD_ID|1799202 g...   159   9e-39
gi|1085857|pir||S42065 histone H3.1 - Leptothorax acevorum (frag...   159   2e-38
gi|41147172|ref|XP_373080.1| similar to ENSANGP00000014197 [Homo...   157   4e-38
gi|41151698|ref|XP_373368.1| similar to Histone H3.3 [Homo sapiens]   155   2e-37
gi|29250015|gb|EAA41516.1| GLP_623_54801_54232 [Giardia lamblia ...   155   2e-37
gi|6006739|gb|AAF00592.1| histone H3 [Giardia intestinalis] >gnl...   155   2e-37
gi|47183951|emb|CAF87058.1| unnamed protein product [Tetraodon n...   154   5e-37
gi|34864663|ref|XP_236308.2| similar to H3 histone, family 3B [R...   154   5e-37
gi|2829296|gb|AAC00522.1| histone H3 [Leishmania braziliensis]        150   5e-36
gi|7544110|dbj|BAA94295.1| Histone H3 [Leishmania mexicana amazo...   149   9e-36
gi|7544111|dbj|BAA94296.1| Histone H3 [Leishmania mexicana amazo...   149   1e-35
gi|1360627|emb|CAA66647.1| histone H3-2 [Trichomonas vaginalis]       149   1e-35
gi|122084|sp|P06353|H3_HORVU Histone H3 >gnl|BL_ORD_ID|1183501 g...   147   4e-35
gi|34851973|ref|XP_344782.1| similar to H3 histone, family 3B [R...   145   1e-34
gi|30725206|gb|AAP37638.1| histone H3 [Thysanocardia nigra]           145   2e-34
gi|14009913|gb|AAK51836.1| early histone H3 [Tetrapygus niger]        143   7e-34
gi|2119014|pir||I51443 histone H3 - African clawed frog (fragmen...   143   9e-34
gi|31873198|emb|CAD97571.1| histone H3 [Paramecium tetraurelia]       143   9e-34
gi|729678|sp|P40285|H3_LEIIN Histone H3 >gnl|BL_ORD_ID|1867470 g...   142   1e-33
gi|4388695|emb|CAA26808.1| unnamed protein product [Xenopus laevis]   142   1e-33
gi|31873195|emb|CAD97569.1| histone H3 [Paramecium tetraurelia]       142   1e-33
gi|49078188|ref|XP_402872.1| hypothetical protein UM05257.1 [Ust...   141   3e-33
gi|32403236|ref|XP_322231.1| hypothetical protein [Neurospora cr...   140   4e-33
gi|38607194|gb|AAR25504.1| histone H3 [Schizochiton incisus]          140   6e-33
gi|46431874|gb|EAK91396.1| hypothetical protein CaO19.6163 [Cand...   140   7e-33
gi|39592227|emb|CAE75448.1| Hypothetical protein CBG23442 [Caeno...   139   2e-32
gi|34860015|ref|XP_345261.1| similar to Histone H3.3 [Rattus nor...   137   4e-32
gi|17536823|ref|NP_496797.1| histone (his-73) [Caenorhabditis el...   137   6e-32
gi|630475|pir||S42521 histone H3-I - Tetrahymena thermophila (fr...   136   1e-31
gi|10129812|emb|CAC08231.1| histone H3-like protein [Stylonychia...   136   1e-31
gi|45185312|ref|NP_983029.1| ABR083Cp [Eremothecium gossypii] >g...   134   3e-31
gi|19113265|ref|NP_596473.1| probable histone h3 variant [Schizo...   134   4e-31
gi|27882323|gb|AAH44483.1| Seph protein [Danio rerio]                 134   4e-31
gi|50407281|ref|XP_456699.1| unnamed protein product [Debaryomyc...   134   5e-31
gi|25992799|emb|CAD53117.2| histone H3, probable [Trypanosoma br...   134   5e-31
gi|578470|emb|CAA24382.1| unnamed protein product [Psammechinus ...   132   2e-30
gi|50546747|ref|XP_500843.1| hypothetical protein [Yarrowia lipo...   130   4e-30
gi|19173166|ref|NP_596969.1| HISTONE H3 [Encephalitozoon cunicul...   130   4e-30
gi|34853810|ref|XP_344816.1| similar to Histone H3.3 [Rattus nor...   130   4e-30
gi|34874665|ref|XP_346010.1| similar to H3 histone, family 3B [R...   130   6e-30
gi|34857261|ref|XP_345206.1| similar to H3.3 like histone MH321 ...   130   6e-30
gi|5869895|emb|CAB55516.1| histone H3 [Leishmania major]              129   1e-29
gi|38569184|emb|CAD40837.3| OSJNBa0086B14.9 [Oryza sativa (japon...   124   1e-29
gi|47225995|emb|CAG04369.1| unnamed protein product [Tetraodon n...   129   2e-29
gi|40365140|gb|AAR85315.1| centromeric histone 3 [Oryza sativa (...   129   2e-29
gi|27808712|ref|NP_012875.2| Centromere protein that resembles h...   126   1e-28
gi|539123|pir||S37870 chromatin-associated protein CSE4 - yeast ...   126   1e-28
gi|27902589|gb|AAO24601.1| histone H3 variant [Trypanosoma bruce...   125   1e-28
gi|21668094|gb|AAM74226.1| centromeric histone h3-like protein [...   125   1e-28
gi|99980|pir||A38309 histone H3.1 - alfalfa (fragments)               125   2e-28
gi|23619278|ref|NP_705240.1| histone h3, putative [Plasmodium fa...   125   2e-28
gi|50305593|ref|XP_452757.1| unnamed protein product [Kluyveromy...   124   4e-28
gi|442456|gb|AAA61706.1| histone H3 >gnl|BL_ORD_ID|1577462 gi|44...   124   5e-28
gi|23487718|gb|EAA21128.1| histone h3 [Plasmodium yoelii yoelii]      123   9e-28
gi|47210320|emb|CAF91168.1| unnamed protein product [Tetraodon n...   122   1e-27
gi|3153156|emb|CAA64751.1| histone 3 [Leishmania infantum]            120   5e-27
gi|2253166|emb|CAA95893.1| HHT2 [Saccharomyces cerevisiae]            120   6e-27
gi|1076583|pir||S51664 histone H3.3 - tomato (fragment)               120   6e-27
gi|33146140|dbj|BAC79430.1| histone H3 like protein [Arabis gemm...   120   8e-27
gi|50295008|ref|XP_449915.1| unnamed protein product [Candida gl...   120   8e-27
gi|19338706|gb|AAL86777.1| centromeric histone H3 HTR12 [Arabido...   118   2e-26
gi|33146142|dbj|BAC79431.1| histone H3 like protein [Arabis gemm...   118   2e-26
gi|19338704|gb|AAL86776.1| centromeric histone H3 HTR12 [Arabido...   118   2e-26
gi|33146136|dbj|BAC79428.1| histone H3 like protein [Arabis gemm...   118   3e-26
gi|32346218|gb|AAN85430.1| histone H3 [Pyrocystis lunula]             117   7e-26
gi|630476|pir||S42522 histone H3-II - Tetrahymena thermophila (f...   116   1e-25
gi|37499718|gb|AAP40821.1| centromere protein A [Gallus gallus]       115   1e-25
gi|10880586|gb|AAG24294.1| histone H3-D [Glycine tomentella] >gn...   114   3e-25
gi|10880616|gb|AAG24309.1| histone H3-D [Glycine tabacina]            114   4e-25
gi|33146144|dbj|BAC79432.1| histone H3 like protein [Arabis glabra]   114   4e-25
gi|10880594|gb|AAG24298.1| histone H3-D [Glycine tabacina]            114   6e-25
gi|10880640|gb|AAG24321.1| histone H3-D [Glycine tabacina]            114   6e-25
gi|19909214|gb|AAM03165.1| histone H3-D [Glycine tomentella] >gn...   114   6e-25
gi|10880602|gb|AAG24302.1| histone H3-D [Glycine tabacina]            114   6e-25
gi|10880596|gb|AAG24299.1| histone H3-D [Glycine tabacina] >gnl|...   114   6e-25
gi|34866255|ref|XP_345695.1| similar to macrophage migration inh...   114   6e-25
gi|10880580|gb|AAG24291.1| histone H3-D [Glycine pindanica]           112   1e-24
gi|10880578|gb|AAG24290.1| histone H3-D [Glycine hirticaulis]         112   1e-24
gi|19909194|gb|AAM03155.1| histone H3-D [Glycine tomentella] >gn...   112   1e-24
gi|19909190|gb|AAM03153.1| histone H3-D [Glycine hirticaulis] >g...   112   1e-24
gi|19909188|gb|AAM03152.1| histone H3-D [Glycine clandestina] >g...   112   1e-24
gi|19909228|gb|AAM03172.1| histone H3-D [Glycine tomentella] >gn...   112   1e-24
gi|10880618|gb|AAG24310.1| histone H3-D [Glycine tabacina]            112   2e-24
gi|10880582|gb|AAG24292.1| histone H3-D [Glycine albicans]            112   2e-24
gi|1208646|gb|AAB50437.1| histone H3 [Glycine aff. tabacina] >gn...   112   2e-24
gi|1208656|gb|AAB50442.1| histone H3 [Glycine falcata]                111   3e-24
gi|1208701|gb|AAB50479.1| histone H3 [Glycine microphylla]            111   4e-24
gi|1208699|gb|AAB50478.1| histone H3 [Glycine max]                    111   4e-24
gi|1208664|gb|AAB50446.1| histone H3 [Glycine tomentella]             110   5e-24
gi|10880606|gb|AAG24304.1| histone H3-D [Glycine tabacina]            110   5e-24
gi|1208658|gb|AAB50443.1| histone H3 [Glycine soja]                   110   5e-24
gi|1213313|gb|AAB50463.1| histone H3 [Glycine soja]                   110   5e-24
gi|1208725|gb|AAB50491.1| histone H3 [Pseudeminia comosa]             110   6e-24
gi|1208668|gb|AAB50448.1| histone H3 [Pseudeminia comosa]             110   6e-24
gi|1213307|gb|AAB50460.1| histone H3 [Glycine max]                    110   6e-24
gi|631693|pir||S45111 histone H3 - mouse >gnl|BL_ORD_ID|1417060 ...   110   8e-24
gi|19614|emb|CAA31968.1| histone H3 (AA 1-58) [Medicago sativa]       110   8e-24
gi|1208642|gb|AAB50435.1| histone H3 [Amphicarpaea bracteata]         110   8e-24
gi|27923216|gb|AAO27521.1| histone H3-D [Acacia suaveolens]           110   8e-24
gi|1208715|gb|AAB50486.1| histone H3 [Teramnus labialis] >gnl|BL...   110   8e-24


>gi|17567723|ref|NP_509344.1| histone, 3 (his-71) [Caenorhabditis
           elegans]
 gi|1708108|sp|Q10453|H33_CAEEL Histone H3.3
 gi|7439813|pir||T16361 hypothetical protein F45E1.6 -
           Caenorhabditis elegans
 gi|860702|gb|AAB04902.1| Hypothetical protein F45E1.6
           [Caenorhabditis elegans]
          Length = 136

 Score =  265 bits (677), Expect = 2e-70
 Identities = 136/136 (100%), Positives = 136/136 (100%)
 Frame = -1

Query: 411 MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRRYQKSTE 232
           MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRRYQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRRYQKSTE 60

Query: 231 LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI 52
           LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI 120

Query: 51  MPKDIQLARRIRGERA 4
           MPKDIQLARRIRGERA
Sbjct: 121 MPKDIQLARRIRGERA 136


>gi|39594220|emb|CAE70330.1| Hypothetical protein CBG16863
           [Caenorhabditis briggsae]
          Length = 136

 Score =  265 bits (676), Expect = 2e-70
 Identities = 135/136 (99%), Positives = 136/136 (99%)
 Frame = -1

Query: 411 MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRRYQKSTE 232
           MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRRYQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRRYQKSTE 60

Query: 231 LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI 52
           LLIRKLPFQRLVREIAQDFKTDLRFQSAA+GALQEASEAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTI 120

Query: 51  MPKDIQLARRIRGERA 4
           MPKDIQLARRIRGERA
Sbjct: 121 MPKDIQLARRIRGERA 136




[DB home][top]