Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F46A8_5
(687 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17507361|ref|NP_492885.1| galectin LEC-4 like family member (... 385 e-106
gi|17540564|ref|NP_500492.1| predicted CDS, lectin like family m... 348 6e-95
gi|17507363|ref|NP_492884.1| predicted CDS, galectin like family... 254 1e-66
gi|17540562|ref|NP_500491.1| predicted CDS, galectin LEC-4 like ... 243 4e-65
gi|17507371|ref|NP_492881.1| putative secreted or extracellular ... 236 2e-61
gi|17507365|ref|NP_492883.1| putative secreted or extracellular ... 203 3e-51
gi|17540560|ref|NP_500490.1| galectin like precursor family memb... 175 7e-43
gi|39580340|emb|CAE64495.1| Hypothetical protein CBG09221 [Caeno... 87 2e-16
gi|17505753|ref|NP_492918.1| predicted CDS, galectin LEC-4 like ... 84 3e-15
gi|9857647|dbj|BAB11970.1| galectin LEC-4 [Caenorhabditis elegans] 83 5e-15
gi|17554192|ref|NP_497763.1| galectin (32.4 kD) (lec-4) [Caenorh... 83 5e-15
gi|17508813|ref|NP_493005.1| predicted CDS, galectin family memb... 76 7e-13
gi|17507291|ref|NP_493095.1| galectin LEC-4 like family member (... 70 4e-11
gi|17535117|ref|NP_496159.1| galectin (33.6 kD) (lec-3) [Caenorh... 52 9e-06
gi|17556226|ref|NP_497215.1| galectin (16.0 kD) (3B218) [Caenorh... 52 1e-05
gi|1395154|dbj|BAA09794.1| galectin [Caenorhabditis elegans] 52 1e-05
gi|31228123|ref|XP_318002.1| ENSANGP00000003368 [Anopheles gambi... 52 1e-05
gi|31228118|ref|XP_318001.1| ENSANGP00000010840 [Anopheles gambi... 52 1e-05
gi|31210947|ref|XP_314440.1| ENSANGP00000025083 [Anopheles gambi... 52 1e-05
gi|25326270|pir||F88281 protein ZK892.1 [imported] - Caenorhabdi... 50 4e-05
gi|39587773|emb|CAE67791.1| Hypothetical protein CBG13368 [Caeno... 50 6e-05
gi|31210949|ref|XP_314441.1| ENSANGP00000016074 [Anopheles gambi... 48 2e-04
gi|1644285|emb|CAA93822.1| lectin [Anopheles gambiae] 48 2e-04
gi|47522622|ref|NP_999097.1| urate transporter/channel protein, ... 47 4e-04
gi|1170759|sp|P08699|LEG3_RAT Galectin-3 (Galactose-specific lec... 47 4e-04
gi|13929190|ref|NP_114020.1| galectin-3; IgE binding protein [Ra... 47 4e-04
gi|4995880|emb|CAB44278.1| urate transporter/channel protein (UA... 47 4e-04
gi|437331|gb|AAA16211.1| beta-galactosides-binding lectin 47 5e-04
gi|33859580|ref|NP_034835.1| galectin-3 [Mus musculus] >gnl|BL_O... 47 5e-04
gi|126679|sp|P16110|LEG3_MOUSE Galectin-3 (Galactose-specific le... 47 5e-04
gi|52851|emb|CAA34206.1| unnamed protein product [Mus sp.] 47 5e-04
gi|387111|gb|AAA37311.1| carbohydrate binding protein 35 47 5e-04
gi|1082938|pir||A49688 lactose-binding lectin L-29 - dog 47 5e-04
gi|1170758|sp|P38486|LEG3_CANFA Galectin-3 (Galactose-specific l... 47 5e-04
gi|1346429|sp|P47845|LEG3_RABIT Galectin-3 (Galactose-specific l... 46 6e-04
gi|47212865|emb|CAF93222.1| unnamed protein product [Tetraodon n... 46 8e-04
gi|7542330|gb|AAF63404.1| galectin [Haemonchus contortus] 45 0.001
gi|47522788|ref|NP_999146.1| L-36 lactose binding protein [Sus s... 45 0.001
gi|204728|gb|AAA41378.1| IgE binding protein 45 0.001
gi|49457147|emb|CAG46894.1| LGALS3 [Homo sapiens] 45 0.001
gi|299602|gb|AAB26229.1| carbohydrate binding protein 35; Mac-2;... 45 0.001
gi|4504983|ref|NP_002297.1| galectin-3; galactose-specific lecti... 45 0.001
gi|1196442|gb|AAA88086.1| galactose-specific lectin [Homo sapiens] 45 0.001
gi|3402185|pdb|1A3K| X-Ray Crystal Structure Of The Human Galec... 45 0.001
gi|45786143|gb|AAH68068.1| Galectin-3 [Homo sapiens] 45 0.002
gi|33284841|emb|CAE17639.1| SI:dZ122B7.2.2 (novel protein simila... 44 0.003
gi|25815088|emb|CAD57721.1| Hypothetical protein ZK892.1d [Caeno... 44 0.003
gi|49902809|gb|AAH76011.1| Unknown (protein for MGC:92326) [Dani... 44 0.003
gi|49227307|ref|NP_001001817.1| wu:fd20c09 [Danio rerio] >gnl|BL... 44 0.003
gi|33284840|emb|CAE17638.1| SI:dZ122B7.2.1 (novel protein simila... 44 0.003
gi|1916602|gb|AAB51189.1| beta-galactoside binding lectin 44 0.004
gi|13277708|gb|AAH03754.1| Lgals9 protein [Mus musculus] 44 0.004
gi|26985805|emb|CAA91327.2| Hypothetical protein F52H3.7a [Caeno... 44 0.004
gi|25154078|ref|NP_496165.2| galectin (31.3 kD) (lec-2) [Caenorh... 44 0.004
gi|6754536|ref|NP_034838.1| lectin, galactose binding, soluble 9... 44 0.004
gi|7503988|pir||T22523 hypothetical protein F52H3.7 - Caenorhabd... 44 0.004
gi|40288183|gb|AAR84192.1| tandem-repeat galectin Gal9-L1 [Danio... 44 0.004
gi|33284839|emb|CAE17637.1| SI:dZ122B7.3 (novel protein similar ... 43 0.005
gi|1346428|sp|P47953|LEG3_CRILO Galectin-3 (Galactose-specific l... 43 0.005
gi|6806890|ref|NP_033665.1| galectin 9 long isoform [Homo sapien... 43 0.007
gi|18148447|dbj|BAB83259.1| galectin family xgalectin-IVa [Xenop... 43 0.007
gi|41152379|ref|NP_956366.1| Unknown (protein for MGC:73232); wu... 43 0.007
gi|34785121|gb|AAH56859.1| Xgalectin-iva protein [Xenopus laevis] 43 0.007
gi|18148432|dbj|BAB83623.1| galectin-9 [Homo sapiens] 43 0.007
gi|3299781|dbj|BAA31542.1| ecalectin [Homo sapiens] 43 0.007
gi|4504987|ref|NP_002299.1| galectin 9 short isoform [Homo sapie... 43 0.007
gi|18148433|dbj|BAB83624.1| galectin-9 [Homo sapiens] 43 0.007
gi|21218385|gb|AAM44060.1| galectin-4 [Mus musculus] 42 0.009
gi|3335393|gb|AAC27245.1| galectin-4 [Mus musculus] 42 0.012
gi|6981156|ref|NP_037109.1| lectin, galactose binding, soluble 9... 42 0.015
gi|1916610|gb|AAB51192.1| 36 kDa beta-galactoside binding lectin 42 0.015
gi|46849705|ref|NP_034836.1| lectin, galactose binding, soluble ... 42 0.015
gi|2851467|sp|P97840|LEG9_RAT Galectin-9 (36 kDa beta-galactosid... 42 0.015
gi|28071074|emb|CAD61918.1| unnamed protein product [Homo sapiens] 41 0.020
gi|46102473|gb|AAS80311.1| galectin 9 [Canis familiaris] 41 0.026
gi|31200823|ref|XP_309359.1| ENSANGP00000015624 [Anopheles gambi... 40 0.033
gi|49522841|gb|AAH73889.1| Unknown (protein for MGC:90361) [Homo... 40 0.044
gi|48099607|ref|XP_394918.1| similar to MSTA protein [Apis melli... 40 0.044
gi|47221302|emb|CAG13238.1| unnamed protein product [Tetraodon n... 40 0.044
gi|6681410|dbj|BAA88670.1| galectin like protein [Oncorhynchus m... 40 0.044
gi|27372937|gb|AAO06842.1| putative salivary galectin [Anopheles... 40 0.044
gi|6900060|emb|CAB71314.1| galectin [Haemonchus contortus] 40 0.057
gi|6981152|ref|NP_037107.1| lectin, galactose binding, soluble 4... 39 0.075
gi|5882169|gb|AAD55242.1| galectin-4 [Oryctolagus cuniculus] 39 0.075
gi|8358152|emb|CAB93851.1| galectin-9 [Homo sapiens] 39 0.097
gi|39587776|emb|CAE67794.1| Hypothetical protein CBG13371 [Caeno... 39 0.097
gi|3335391|gb|AAC27244.1| galectin-6 [Mus musculus] 39 0.097
gi|6754534|ref|NP_034837.1| lectin, galactose binding, soluble 6... 39 0.097
gi|7509192|pir||T26325 hypothetical protein W09H1.6b - Caenorhab... 39 0.13
gi|1935060|gb|AAC47547.1| galectin [Teladorsagia circumcincta] >... 39 0.13
gi|1935058|gb|AAC47546.1| galectin [Teladorsagia circumcincta] >... 39 0.13
gi|3341815|gb|AAD11972.1| galectin [Haemonchus contortus] 39 0.13
gi|27884291|dbj|BAC55882.1| galectin family xgalectin-IIb [Xenop... 39 0.13
gi|25153023|ref|NP_496801.2| galectin, beta-galactoside binding ... 39 0.13
gi|18148445|dbj|BAB83258.1| galectin family xgalectin-IIIa [Xeno... 38 0.17
gi|50415315|gb|AAH77487.1| Xgalectin-IIIa protein [Xenopus laevis] 38 0.17
gi|25815087|emb|CAD57720.1| Hypothetical protein ZK892.1c [Caeno... 38 0.22
gi|7506381|pir||T24001 hypothetical protein R07B1.10 - Caenorhab... 38 0.22
gi|17568907|ref|NP_509649.1| galectin (20.4 kD) (lec-8) [Caenorh... 38 0.22
gi|39597215|emb|CAE59442.1| Hypothetical protein CBG02815 [Caeno... 38 0.22
gi|4100353|gb|AAD00843.1| Ov87 [Onchocerca volvulus] 37 0.28
gi|39586144|emb|CAE69220.1| Hypothetical protein CBG15260 [Caeno... 37 0.28
gi|18148443|dbj|BAB83257.1| galectin family xgalectin-IIa [Xenop... 37 0.37
gi|17226660|gb|AAL37895.1| galectin-14 [Ovis aries] 37 0.48
gi|48096012|ref|XP_392379.1| similar to galectin family xgalecti... 36 0.63
gi|7019497|ref|NP_037400.1| placental protein 13; galectin-13 [H... 36 0.82
gi|27884297|dbj|BAC55885.1| galectin family xgalectin-VIa [Xenop... 35 1.1
gi|32450320|gb|AAH54324.1| Xgalectin-VIa protein [Xenopus laevis] 35 1.1
gi|7542334|gb|AAF63406.1| galectin [Haemonchus contortus] >gnl|B... 35 1.4
gi|6225602|sp|O44126|LEG1_HAECO 32 kDa beta-galactoside-binding ... 35 1.4
gi|31228128|ref|XP_318003.1| ENSANGP00000010670 [Anopheles gambi... 35 1.4
gi|7542332|gb|AAF63405.1| galectin [Haemonchus contortus] 35 1.4
gi|47551305|ref|NP_999756.1| lectin, galactoside-binding, solubl... 35 1.8
gi|50748894|ref|XP_421447.1| PREDICTED: lectin, galactoside-bind... 35 1.8
gi|1389600|gb|AAB02856.1| galectin-3 35 1.8
gi|39590917|emb|CAE58697.1| Hypothetical protein CBG01879 [Caeno... 35 1.8
gi|17942629|pdb|1HDK|A Chain A, Charcot-Leyden Crystal Protein -... 35 1.8
gi|27884293|dbj|BAC55883.1| galectin family xgalectin-IIIb [Xeno... 35 1.8
gi|547870|sp|Q05315|LPPL_HUMAN Eosinophil lysophospholipase (Cha... 35 1.8
gi|20357559|ref|NP_001819.2| Charot-Leyden crystal protein; eosi... 35 1.8
gi|1778169|gb|AAB40658.1| galectin-7 [Rattus norvegicus] 35 1.8
gi|47230311|emb|CAG10725.1| unnamed protein product [Tetraodon n... 34 2.4
gi|1055226|gb|AAB40001.1| putative fiber protein [porcine adenov... 34 2.4
gi|12018232|ref|NP_072104.1| lectin, galactose binding, soluble ... 34 2.4
gi|30583951|gb|AAP36224.1| Homo sapiens lectin, galactoside-bind... 34 2.4
gi|16768442|gb|AAL28440.1| GM04669p [Drosophila melanogaster] 34 2.4
gi|24655134|ref|NP_611349.2| CG5335-PA [Drosophila melanogaster]... 34 2.4
gi|5453712|ref|NP_006140.1| galectin 4; lectin galactoside-bindi... 34 2.4
gi|3915736|sp|P97590|LEG7_RAT Galectin-7 (Gal-7) 34 2.4
gi|15131494|emb|CAC48362.1| peptide synthetase [Amycolatopsis ba... 34 3.1
gi|7506105|pir||T29184 hypothetical protein M6.2 - Caenorhabditi... 34 3.1
gi|29134776|emb|CAD79473.1| galectin-4 (lectin, galactoside-bind... 33 4.1
gi|6981154|ref|NP_037108.1| lectin, galactose binding, soluble 5... 33 4.1
gi|785053|gb|AAA65445.1| galectin-5 33 4.1
gi|39598389|emb|CAE69082.1| Hypothetical protein CBG15100 [Caeno... 33 5.3
gi|34783544|gb|AAH42911.2| LGALS7 protein [Homo sapiens] 33 5.3
gi|50507728|emb|CAA94229.2| Hypothetical protein C53D6.7 [Caenor... 33 5.3
gi|3891470|pdb|3GAL|A Chain A, Crystal Structure Of Human Galect... 33 5.3
gi|4504985|ref|NP_002298.1| galectin 7; lectin galactoside-bindi... 33 5.3
gi|16760472|ref|NP_456089.1| putative membrane protein [Salmonel... 33 7.0
gi|16764789|ref|NP_460404.1| putative inner membrane protein [Sa... 33 7.0
gi|47213104|emb|CAF89524.1| unnamed protein product [Tetraodon n... 33 7.0
gi|39594311|emb|CAE71889.1| Hypothetical protein CBG18946 [Caeno... 32 9.1
gi|3913978|sp|O54974|LEG7_MOUSE Galectin-7 (Gal-7) >gnl|BL_ORD_I... 32 9.1
>gi|17507361|ref|NP_492885.1| galectin LEC-4 like family member
(1L834) [Caenorhabditis elegans]
gi|7503511|pir||T22259 hypothetical protein F46A8.3 -
Caenorhabditis elegans
gi|3877223|emb|CAB04389.1| Hypothetical protein F46A8.3
[Caenorhabditis elegans]
Length = 228
Score = 385 bits (989), Expect = e-106
Identities = 186/214 (86%), Positives = 186/214 (86%)
Frame = -1
Query: 645 SGYFSDNDRKKVKKISIVHYDXXXXXXSEEHRYRPRGGKRPKFDDDSSDDYSXXXXXXXX 466
SGYFSDNDRKKVKKISIVHYD SEEHRYRPRGGKRPKFDDDSSDDYS
Sbjct: 15 SGYFSDNDRKKVKKISIVHYDSTSSSSSEEHRYRPRGGKRPKFDDDSSDDYSGRRGGGRQ 74
Query: 465 XXXXXXXXXXXXXXREDWITINGPFTTTLPIPGGYWDTGKIMRIYGIPGSGRWTINLAKS 286
REDWITINGPFTTTLPIPGGYWDTGKIMRIYGIPGSGRWTINLAKS
Sbjct: 75 RPPRPPRPAPTPKPREDWITINGPFTTTLPIPGGYWDTGKIMRIYGIPGSGRWTINLAKS 134
Query: 285 QTWVFHFACEPTKGLVARTRHTNGAWEVGETYSENPFQANTQFNVTMVNQPTHIEIHVNG 106
QTWVFHFACEPTKGLVARTRHTNGAWEVGETYSENPFQANTQFNVTMVNQPTHIEIHVNG
Sbjct: 135 QTWVFHFACEPTKGLVARTRHTNGAWEVGETYSENPFQANTQFNVTMVNQPTHIEIHVNG 194
Query: 105 AFFVNFNHRVPNPSRDYQGIDFQFVAISKVEFSR 4
AFFVNFNHRVPNPSRDYQGIDFQFVAISKVEFSR
Sbjct: 195 AFFVNFNHRVPNPSRDYQGIDFQFVAISKVEFSR 228