Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= F46A8_5
         (687 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17507361|ref|NP_492885.1| galectin LEC-4 like family member (...   385   e-106
gi|17540564|ref|NP_500492.1| predicted CDS, lectin like family m...   348   6e-95
gi|17507363|ref|NP_492884.1| predicted CDS, galectin like family...   254   1e-66
gi|17540562|ref|NP_500491.1| predicted CDS, galectin LEC-4 like ...   243   4e-65
gi|17507371|ref|NP_492881.1| putative secreted or extracellular ...   236   2e-61
gi|17507365|ref|NP_492883.1| putative secreted or extracellular ...   203   3e-51
gi|17540560|ref|NP_500490.1| galectin like precursor family memb...   175   7e-43
gi|39580340|emb|CAE64495.1| Hypothetical protein CBG09221 [Caeno...    87   2e-16
gi|17505753|ref|NP_492918.1| predicted CDS, galectin LEC-4 like ...    84   3e-15
gi|9857647|dbj|BAB11970.1| galectin LEC-4 [Caenorhabditis elegans]     83   5e-15
gi|17554192|ref|NP_497763.1| galectin (32.4 kD) (lec-4) [Caenorh...    83   5e-15
gi|17508813|ref|NP_493005.1| predicted CDS, galectin family memb...    76   7e-13
gi|17507291|ref|NP_493095.1| galectin LEC-4 like family member (...    70   4e-11
gi|17535117|ref|NP_496159.1| galectin (33.6 kD) (lec-3) [Caenorh...    52   9e-06
gi|17556226|ref|NP_497215.1| galectin (16.0 kD) (3B218) [Caenorh...    52   1e-05
gi|1395154|dbj|BAA09794.1| galectin [Caenorhabditis elegans]           52   1e-05
gi|31228123|ref|XP_318002.1| ENSANGP00000003368 [Anopheles gambi...    52   1e-05
gi|31228118|ref|XP_318001.1| ENSANGP00000010840 [Anopheles gambi...    52   1e-05
gi|31210947|ref|XP_314440.1| ENSANGP00000025083 [Anopheles gambi...    52   1e-05
gi|25326270|pir||F88281 protein ZK892.1 [imported] - Caenorhabdi...    50   4e-05
gi|39587773|emb|CAE67791.1| Hypothetical protein CBG13368 [Caeno...    50   6e-05
gi|31210949|ref|XP_314441.1| ENSANGP00000016074 [Anopheles gambi...    48   2e-04
gi|1644285|emb|CAA93822.1| lectin [Anopheles gambiae]                  48   2e-04
gi|47522622|ref|NP_999097.1| urate transporter/channel protein, ...    47   4e-04
gi|1170759|sp|P08699|LEG3_RAT Galectin-3 (Galactose-specific lec...    47   4e-04
gi|13929190|ref|NP_114020.1| galectin-3; IgE binding protein [Ra...    47   4e-04
gi|4995880|emb|CAB44278.1| urate transporter/channel protein (UA...    47   4e-04
gi|437331|gb|AAA16211.1| beta-galactosides-binding lectin              47   5e-04
gi|33859580|ref|NP_034835.1| galectin-3 [Mus musculus] >gnl|BL_O...    47   5e-04
gi|126679|sp|P16110|LEG3_MOUSE Galectin-3 (Galactose-specific le...    47   5e-04
gi|52851|emb|CAA34206.1| unnamed protein product [Mus sp.]             47   5e-04
gi|387111|gb|AAA37311.1| carbohydrate binding protein 35               47   5e-04
gi|1082938|pir||A49688 lactose-binding lectin L-29 - dog               47   5e-04
gi|1170758|sp|P38486|LEG3_CANFA Galectin-3 (Galactose-specific l...    47   5e-04
gi|1346429|sp|P47845|LEG3_RABIT Galectin-3 (Galactose-specific l...    46   6e-04
gi|47212865|emb|CAF93222.1| unnamed protein product [Tetraodon n...    46   8e-04
gi|7542330|gb|AAF63404.1| galectin [Haemonchus contortus]              45   0.001
gi|47522788|ref|NP_999146.1| L-36 lactose binding protein [Sus s...    45   0.001
gi|204728|gb|AAA41378.1| IgE binding protein                           45   0.001
gi|49457147|emb|CAG46894.1| LGALS3 [Homo sapiens]                      45   0.001
gi|299602|gb|AAB26229.1| carbohydrate binding protein 35; Mac-2;...    45   0.001
gi|4504983|ref|NP_002297.1| galectin-3; galactose-specific lecti...    45   0.001
gi|1196442|gb|AAA88086.1| galactose-specific lectin [Homo sapiens]     45   0.001
gi|3402185|pdb|1A3K|  X-Ray Crystal Structure Of The Human Galec...    45   0.001
gi|45786143|gb|AAH68068.1| Galectin-3 [Homo sapiens]                   45   0.002
gi|33284841|emb|CAE17639.1| SI:dZ122B7.2.2 (novel protein simila...    44   0.003
gi|25815088|emb|CAD57721.1| Hypothetical protein ZK892.1d [Caeno...    44   0.003
gi|49902809|gb|AAH76011.1| Unknown (protein for MGC:92326) [Dani...    44   0.003
gi|49227307|ref|NP_001001817.1| wu:fd20c09 [Danio rerio] >gnl|BL...    44   0.003
gi|33284840|emb|CAE17638.1| SI:dZ122B7.2.1 (novel protein simila...    44   0.003
gi|1916602|gb|AAB51189.1| beta-galactoside binding lectin              44   0.004
gi|13277708|gb|AAH03754.1| Lgals9 protein [Mus musculus]               44   0.004
gi|26985805|emb|CAA91327.2| Hypothetical protein F52H3.7a [Caeno...    44   0.004
gi|25154078|ref|NP_496165.2| galectin (31.3 kD) (lec-2) [Caenorh...    44   0.004
gi|6754536|ref|NP_034838.1| lectin, galactose binding, soluble 9...    44   0.004
gi|7503988|pir||T22523 hypothetical protein F52H3.7 - Caenorhabd...    44   0.004
gi|40288183|gb|AAR84192.1| tandem-repeat galectin Gal9-L1 [Danio...    44   0.004
gi|33284839|emb|CAE17637.1| SI:dZ122B7.3 (novel protein similar ...    43   0.005
gi|1346428|sp|P47953|LEG3_CRILO Galectin-3 (Galactose-specific l...    43   0.005
gi|6806890|ref|NP_033665.1| galectin 9 long isoform [Homo sapien...    43   0.007
gi|18148447|dbj|BAB83259.1| galectin family xgalectin-IVa [Xenop...    43   0.007
gi|41152379|ref|NP_956366.1| Unknown (protein for MGC:73232); wu...    43   0.007
gi|34785121|gb|AAH56859.1| Xgalectin-iva protein [Xenopus laevis]      43   0.007
gi|18148432|dbj|BAB83623.1| galectin-9 [Homo sapiens]                  43   0.007
gi|3299781|dbj|BAA31542.1| ecalectin [Homo sapiens]                    43   0.007
gi|4504987|ref|NP_002299.1| galectin 9 short isoform [Homo sapie...    43   0.007
gi|18148433|dbj|BAB83624.1| galectin-9 [Homo sapiens]                  43   0.007
gi|21218385|gb|AAM44060.1| galectin-4 [Mus musculus]                   42   0.009
gi|3335393|gb|AAC27245.1| galectin-4 [Mus musculus]                    42   0.012
gi|6981156|ref|NP_037109.1| lectin, galactose binding, soluble 9...    42   0.015
gi|1916610|gb|AAB51192.1| 36 kDa beta-galactoside binding lectin       42   0.015
gi|46849705|ref|NP_034836.1| lectin, galactose binding, soluble ...    42   0.015
gi|2851467|sp|P97840|LEG9_RAT Galectin-9 (36 kDa beta-galactosid...    42   0.015
gi|28071074|emb|CAD61918.1| unnamed protein product [Homo sapiens]     41   0.020
gi|46102473|gb|AAS80311.1| galectin 9 [Canis familiaris]               41   0.026
gi|31200823|ref|XP_309359.1| ENSANGP00000015624 [Anopheles gambi...    40   0.033
gi|49522841|gb|AAH73889.1| Unknown (protein for MGC:90361) [Homo...    40   0.044
gi|48099607|ref|XP_394918.1| similar to MSTA protein [Apis melli...    40   0.044
gi|47221302|emb|CAG13238.1| unnamed protein product [Tetraodon n...    40   0.044
gi|6681410|dbj|BAA88670.1| galectin like protein [Oncorhynchus m...    40   0.044
gi|27372937|gb|AAO06842.1| putative salivary galectin [Anopheles...    40   0.044
gi|6900060|emb|CAB71314.1| galectin [Haemonchus contortus]             40   0.057
gi|6981152|ref|NP_037107.1| lectin, galactose binding, soluble 4...    39   0.075
gi|5882169|gb|AAD55242.1| galectin-4 [Oryctolagus cuniculus]           39   0.075
gi|8358152|emb|CAB93851.1| galectin-9 [Homo sapiens]                   39   0.097
gi|39587776|emb|CAE67794.1| Hypothetical protein CBG13371 [Caeno...    39   0.097
gi|3335391|gb|AAC27244.1| galectin-6 [Mus musculus]                    39   0.097
gi|6754534|ref|NP_034837.1| lectin, galactose binding, soluble 6...    39   0.097
gi|7509192|pir||T26325 hypothetical protein W09H1.6b - Caenorhab...    39   0.13
gi|1935060|gb|AAC47547.1| galectin [Teladorsagia circumcincta] >...    39   0.13
gi|1935058|gb|AAC47546.1| galectin [Teladorsagia circumcincta] >...    39   0.13
gi|3341815|gb|AAD11972.1| galectin [Haemonchus contortus]              39   0.13
gi|27884291|dbj|BAC55882.1| galectin family xgalectin-IIb [Xenop...    39   0.13
gi|25153023|ref|NP_496801.2| galectin, beta-galactoside binding ...    39   0.13
gi|18148445|dbj|BAB83258.1| galectin family xgalectin-IIIa [Xeno...    38   0.17
gi|50415315|gb|AAH77487.1| Xgalectin-IIIa protein [Xenopus laevis]     38   0.17
gi|25815087|emb|CAD57720.1| Hypothetical protein ZK892.1c [Caeno...    38   0.22
gi|7506381|pir||T24001 hypothetical protein R07B1.10 - Caenorhab...    38   0.22
gi|17568907|ref|NP_509649.1| galectin (20.4 kD) (lec-8) [Caenorh...    38   0.22
gi|39597215|emb|CAE59442.1| Hypothetical protein CBG02815 [Caeno...    38   0.22
gi|4100353|gb|AAD00843.1| Ov87 [Onchocerca volvulus]                   37   0.28
gi|39586144|emb|CAE69220.1| Hypothetical protein CBG15260 [Caeno...    37   0.28
gi|18148443|dbj|BAB83257.1| galectin family xgalectin-IIa [Xenop...    37   0.37
gi|17226660|gb|AAL37895.1| galectin-14 [Ovis aries]                    37   0.48
gi|48096012|ref|XP_392379.1| similar to galectin family xgalecti...    36   0.63
gi|7019497|ref|NP_037400.1| placental protein 13; galectin-13 [H...    36   0.82
gi|27884297|dbj|BAC55885.1| galectin family xgalectin-VIa [Xenop...    35   1.1
gi|32450320|gb|AAH54324.1| Xgalectin-VIa protein [Xenopus laevis]      35   1.1
gi|7542334|gb|AAF63406.1| galectin [Haemonchus contortus] >gnl|B...    35   1.4
gi|6225602|sp|O44126|LEG1_HAECO 32 kDa beta-galactoside-binding ...    35   1.4
gi|31228128|ref|XP_318003.1| ENSANGP00000010670 [Anopheles gambi...    35   1.4
gi|7542332|gb|AAF63405.1| galectin [Haemonchus contortus]              35   1.4
gi|47551305|ref|NP_999756.1| lectin, galactoside-binding, solubl...    35   1.8
gi|50748894|ref|XP_421447.1| PREDICTED: lectin, galactoside-bind...    35   1.8
gi|1389600|gb|AAB02856.1| galectin-3                                   35   1.8
gi|39590917|emb|CAE58697.1| Hypothetical protein CBG01879 [Caeno...    35   1.8
gi|17942629|pdb|1HDK|A Chain A, Charcot-Leyden Crystal Protein -...    35   1.8
gi|27884293|dbj|BAC55883.1| galectin family xgalectin-IIIb [Xeno...    35   1.8
gi|547870|sp|Q05315|LPPL_HUMAN Eosinophil lysophospholipase (Cha...    35   1.8
gi|20357559|ref|NP_001819.2| Charot-Leyden crystal protein; eosi...    35   1.8
gi|1778169|gb|AAB40658.1| galectin-7 [Rattus norvegicus]               35   1.8
gi|47230311|emb|CAG10725.1| unnamed protein product [Tetraodon n...    34   2.4
gi|1055226|gb|AAB40001.1| putative fiber protein [porcine adenov...    34   2.4
gi|12018232|ref|NP_072104.1| lectin, galactose binding, soluble ...    34   2.4
gi|30583951|gb|AAP36224.1| Homo sapiens lectin, galactoside-bind...    34   2.4
gi|16768442|gb|AAL28440.1| GM04669p [Drosophila melanogaster]          34   2.4
gi|24655134|ref|NP_611349.2| CG5335-PA [Drosophila melanogaster]...    34   2.4
gi|5453712|ref|NP_006140.1| galectin 4; lectin galactoside-bindi...    34   2.4
gi|3915736|sp|P97590|LEG7_RAT Galectin-7 (Gal-7)                       34   2.4
gi|15131494|emb|CAC48362.1| peptide synthetase [Amycolatopsis ba...    34   3.1
gi|7506105|pir||T29184 hypothetical protein M6.2 - Caenorhabditi...    34   3.1
gi|29134776|emb|CAD79473.1| galectin-4 (lectin, galactoside-bind...    33   4.1
gi|6981154|ref|NP_037108.1| lectin, galactose binding, soluble 5...    33   4.1
gi|785053|gb|AAA65445.1| galectin-5                                    33   4.1
gi|39598389|emb|CAE69082.1| Hypothetical protein CBG15100 [Caeno...    33   5.3
gi|34783544|gb|AAH42911.2| LGALS7 protein [Homo sapiens]               33   5.3
gi|50507728|emb|CAA94229.2| Hypothetical protein C53D6.7 [Caenor...    33   5.3
gi|3891470|pdb|3GAL|A Chain A, Crystal Structure Of Human Galect...    33   5.3
gi|4504985|ref|NP_002298.1| galectin 7; lectin galactoside-bindi...    33   5.3
gi|16760472|ref|NP_456089.1| putative membrane protein [Salmonel...    33   7.0
gi|16764789|ref|NP_460404.1| putative inner membrane protein [Sa...    33   7.0
gi|47213104|emb|CAF89524.1| unnamed protein product [Tetraodon n...    33   7.0
gi|39594311|emb|CAE71889.1| Hypothetical protein CBG18946 [Caeno...    32   9.1
gi|3913978|sp|O54974|LEG7_MOUSE Galectin-7 (Gal-7) >gnl|BL_ORD_I...    32   9.1


>gi|17507361|ref|NP_492885.1| galectin LEC-4 like family member
           (1L834) [Caenorhabditis elegans]
 gi|7503511|pir||T22259 hypothetical protein F46A8.3 -
           Caenorhabditis elegans
 gi|3877223|emb|CAB04389.1| Hypothetical protein F46A8.3
           [Caenorhabditis elegans]
          Length = 228

 Score =  385 bits (989), Expect = e-106
 Identities = 186/214 (86%), Positives = 186/214 (86%)
 Frame = -1

Query: 645 SGYFSDNDRKKVKKISIVHYDXXXXXXSEEHRYRPRGGKRPKFDDDSSDDYSXXXXXXXX 466
           SGYFSDNDRKKVKKISIVHYD      SEEHRYRPRGGKRPKFDDDSSDDYS
Sbjct: 15  SGYFSDNDRKKVKKISIVHYDSTSSSSSEEHRYRPRGGKRPKFDDDSSDDYSGRRGGGRQ 74

Query: 465 XXXXXXXXXXXXXXREDWITINGPFTTTLPIPGGYWDTGKIMRIYGIPGSGRWTINLAKS 286
                         REDWITINGPFTTTLPIPGGYWDTGKIMRIYGIPGSGRWTINLAKS
Sbjct: 75  RPPRPPRPAPTPKPREDWITINGPFTTTLPIPGGYWDTGKIMRIYGIPGSGRWTINLAKS 134

Query: 285 QTWVFHFACEPTKGLVARTRHTNGAWEVGETYSENPFQANTQFNVTMVNQPTHIEIHVNG 106
           QTWVFHFACEPTKGLVARTRHTNGAWEVGETYSENPFQANTQFNVTMVNQPTHIEIHVNG
Sbjct: 135 QTWVFHFACEPTKGLVARTRHTNGAWEVGETYSENPFQANTQFNVTMVNQPTHIEIHVNG 194

Query: 105 AFFVNFNHRVPNPSRDYQGIDFQFVAISKVEFSR 4
           AFFVNFNHRVPNPSRDYQGIDFQFVAISKVEFSR
Sbjct: 195 AFFVNFNHRVPNPSRDYQGIDFQFVAISKVEFSR 228




[DB home][top]