Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= F46B6_6
         (1407 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17561038|ref|NP_505523.1| GTP-binding protein like (5K258) [C...   885   0.0
gi|39594674|emb|CAE72253.1| Hypothetical protein CBG19372 [Caeno...   704   0.0
gi|47214135|emb|CAG01393.1| unnamed protein product [Tetraodon n...   231   2e-59
gi|50730366|ref|XP_416868.1| PREDICTED: similar to pseudoautosom...   230   5e-59
gi|50418397|gb|AAH78122.1| Unknown (protein for MGC:83645) [Xeno...   217   6e-55
gi|24650079|ref|NP_651399.2| CG5116-PA [Drosophila melanogaster]...   206   1e-51
gi|17946430|gb|AAL49248.1| RE67480p [Drosophila melanogaster]         204   3e-51
gi|34873076|ref|XP_344119.1| similar to Pseudoautosomal GTP-bind...   197   5e-49
gi|32880121|gb|AAP88891.1| Pseudoautosomal GTP-binding protein-l...   193   9e-48
gi|6912588|ref|NP_036359.1| pseudoautosomal GTP-binding protein-...   192   1e-47
gi|31230632|ref|XP_318421.1| ENSANGP00000014224 [Anopheles gambi...   186   9e-46
gi|17935351|ref|NP_532141.1| GTP-binding protein HFLX [Agrobacte...   181   3e-44
gi|15965218|ref|NP_385571.1| PUTATIVE GTP-BINDING PROTEIN [Sinor...   179   1e-43
gi|17826711|emb|CAC82171.1| putative GTP binding protein [Mus mu...   176   1e-42
gi|16125990|ref|NP_420554.1| GTP-binding protein HflX [Caulobact...   169   1e-40
gi|15888777|ref|NP_354458.1| AGR_C_2676p [Agrobacterium tumefaci...   166   1e-39
gi|46202523|ref|ZP_00053076.2| COG2262: GTPases [Magnetospirillu...   164   5e-39
gi|27379603|ref|NP_771132.1| GTP-binding protein HFLX [Bradyrhiz...   164   6e-39
gi|39935664|ref|NP_947940.1| GTP binding protein-like [Rhodopseu...   160   7e-38
gi|13470637|ref|NP_102206.1| GTP binding protein-like [Mesorhizo...   159   1e-37
gi|46192080|ref|ZP_00007384.2| COG2262: GTPases [Rhodobacter sph...   157   8e-37
gi|45917113|ref|ZP_00196248.2| COG2262: GTPases [Mesorhizobium s...   151   3e-35
gi|17987156|ref|NP_539790.1| GTP-BINDING PROTEIN HFLX [Brucella ...   151   4e-35
gi|23956274|ref|NP_660129.1| pseudoautosomal GTP binding protein...   150   7e-35
gi|23501988|ref|NP_698115.1| GTP-binding protein, putative [Bruc...   150   9e-35
gi|49475521|ref|YP_033562.1| GTP-binding protein hflX [Bartonell...   148   4e-34
gi|48764114|ref|ZP_00268666.1| COG2262: GTPases [Rhodospirillum ...   147   6e-34
gi|49474155|ref|YP_032197.1| GTP-binding protein hflX [Bartonell...   145   2e-33
gi|23011756|ref|ZP_00052024.1| COG2262: GTPases [Magnetospirillu...   145   2e-33
gi|48849305|ref|ZP_00303548.1| COG2262: GTPases [Novosphingobium...   144   7e-33
gi|48831748|ref|ZP_00288802.1| COG2262: GTPases [Magnetococcus s...   141   3e-32
gi|21231170|ref|NP_637087.1| GTP-binding protein [Xanthomonas ca...   130   6e-29
gi|20807587|ref|NP_622758.1| GTPases [Thermoanaerobacter tengcon...   130   1e-28
gi|15605103|ref|NP_219888.1| GTP Binding Protein [Chlamydia trac...   129   2e-28
gi|48094773|ref|XP_394260.1| similar to CG5116-PA [Apis mellifera]    127   6e-28
gi|21242485|ref|NP_642067.1| GTP-binding protein [Xanthomonas ax...   127   6e-28
gi|16799830|ref|NP_470098.1| similar to ATP/GTP-binding protein ...   127   6e-28
gi|46907001|ref|YP_013390.1| conserved hypothetical protein [Lis...   127   8e-28
gi|23024273|ref|ZP_00063490.1| COG2262: GTPases [Leuconostoc mes...   126   1e-27
gi|16802804|ref|NP_464289.1| similar to ATP/GTP-binding protein ...   126   1e-27
gi|25028389|ref|NP_738443.1| putative GTP-binding protein HflX [...   125   2e-27
gi|15835273|ref|NP_297032.1| GTP-binding protein HflX [Chlamydia...   125   3e-27
gi|46120678|ref|ZP_00171906.2| COG2262: GTPases [Methylobacillus...   124   5e-27
gi|23508334|ref|NP_701003.1| hypothetical protein [Plasmodium fa...   123   9e-27
gi|41326118|emb|CAF20281.1| GTPase [Corynebacterium glutamicum A...   122   2e-26
gi|23308879|ref|NP_601147.2| GTPase [Corynebacterium glutamicum ...   122   2e-26
gi|38234020|ref|NP_939787.1| Putative GTP-binding protein [Coryn...   122   3e-26
gi|46363692|ref|ZP_00226408.1| COG2262: GTPases [Kineococcus rad...   122   3e-26
gi|20257541|gb|AAM15935.1| HflX-like protein [Gluconacetobacter ...   122   3e-26
gi|30019905|ref|NP_831536.1| GTP-binding protein hflX [Bacillus ...   121   4e-26
gi|49481110|ref|YP_036006.1| GTP-binding protein [Bacillus thuri...   121   4e-26
gi|45656474|ref|YP_000560.1| GTP-binding protein; protease modul...   121   5e-26
gi|24216333|ref|NP_713814.1| GTP-binding protein [Leptospira int...   121   5e-26
gi|29376669|ref|NP_815823.1| GTP-binding protein [Enterococcus f...   121   5e-26
gi|46447400|ref|YP_008765.1| conserved hypothetical protein [Par...   121   5e-26
gi|42780985|ref|NP_978232.1| GTP-binding protein [Bacillus cereu...   120   6e-26
gi|21399708|ref|NP_655693.1| FeoB, Ferrous iron transport protei...   120   6e-26
gi|15600136|ref|NP_253630.1| probable GTP-binding protein [Pseud...   120   8e-26
gi|47565556|ref|ZP_00236597.1| GTP-binding protein hflX [Bacillu...   120   1e-25
gi|23481929|gb|EAA18064.1| Y14391 GTP-binding protein [Plasmodiu...   119   1e-25
gi|37523711|ref|NP_927088.1| glr4142 [Gloeobacter violaceus PCC ...   119   2e-25
gi|16078806|ref|NP_389625.1| ynbA [Bacillus subtilis subsp. subt...   119   2e-25
gi|15229604|ref|NP_190542.1| pentatricopeptide (PPR) repeat-cont...   118   4e-25
gi|15242912|ref|NP_200604.1| GTP-binding family protein [Arabido...   118   4e-25
gi|15836693|ref|NP_297381.1| GTP-binding protein [Xylella fastid...   117   5e-25
gi|21674206|ref|NP_662271.1| GTP-binding protein HflX [Chlorobiu...   117   5e-25
gi|29829012|ref|NP_823646.1| putative ATP/GTP-binding protein [S...   117   9e-25
gi|48824047|ref|ZP_00285479.1| COG2262: GTPases [Enterococcus fa...   116   1e-24
gi|22997910|ref|ZP_00042119.1| COG2262: GTPases [Xylella fastidi...   116   1e-24
gi|48866010|ref|ZP_00319867.1| COG2262: GTPases [Oenococcus oeni...   116   1e-24
gi|15900573|ref|NP_345177.1| GTP-binding protein HflX [Streptoco...   116   1e-24
gi|42523316|ref|NP_968696.1| GTP-binding protein HflX [Bdellovib...   116   1e-24
gi|22973841|ref|ZP_00020315.1| hypothetical protein [Chloroflexu...   115   2e-24
gi|18310941|ref|NP_562875.1| GTP binding protein [Clostridium pe...   115   3e-24
gi|28198002|ref|NP_778316.1| GTP-binding protein [Xylella fastid...   115   3e-24
gi|42782784|ref|NP_980031.1| GTP-binding protein [Bacillus cereu...   115   3e-24
gi|16800402|ref|NP_470670.1| conserved hypothetical protein simi...   115   3e-24
gi|11280477|pir||T44592 ATP/GTP-binding protein [imported] - Str...   114   4e-24
gi|47096921|ref|ZP_00234498.1| GTP-binding domain protein [Liste...   114   4e-24
gi|48836575|ref|ZP_00293571.1| COG2262: GTPases [Thermobifida fu...   114   4e-24
gi|15794350|ref|NP_284172.1| hypothetical protein NMA1445 [Neiss...   114   4e-24
gi|48869633|ref|ZP_00322382.1| COG2262: GTPases [Pediococcus pen...   114   6e-24
gi|21224141|ref|NP_629920.1| conserved hypothetical protein SC4H...   114   6e-24
gi|46907522|ref|YP_013911.1| GTP-binding domain protein [Listeri...   114   6e-24
gi|47094277|ref|ZP_00231984.1| GTP-binding domain protein [Liste...   114   7e-24
gi|15606930|ref|NP_214311.1| GTP-binding protein HflX [Aquifex a...   114   7e-24
gi|19745984|ref|NP_607120.1| putative GTP-binding protein [Strep...   113   1e-23
gi|46191061|ref|ZP_00120704.2| COG2262: GTPases [Bifidobacterium...   113   1e-23
gi|16803336|ref|NP_464821.1| conserved hypothetical protein simi...   113   1e-23
gi|24372195|ref|NP_716237.1| GTP-binding protein HflX [Shewanell...   113   1e-23
gi|33597405|ref|NP_885048.1| putative GTP-binding protein [Borde...   112   2e-23
gi|46188766|ref|ZP_00125239.2| COG2262: GTPases [Pseudomonas syr...   112   2e-23
gi|26991571|ref|NP_746996.1| GTP-binding protein HflX [Pseudomon...   112   2e-23
gi|21910171|ref|NP_664439.1| putative GTP-binding protein [Strep...   112   2e-23
gi|50591415|ref|ZP_00332727.1| COG2262: GTPases [Streptococcus s...   112   2e-23
gi|15674942|ref|NP_269116.1| putative GTP-binding protein [Strep...   112   2e-23
gi|28896129|ref|NP_802479.1| putative GTP-binding protein [Strep...   112   2e-23
gi|23465868|ref|NP_696471.1| GTP-binding protein [Bifidobacteriu...   112   2e-23
gi|29654314|ref|NP_820006.1| GTP-binding protein [Coxiella burne...   112   2e-23
gi|28211828|ref|NP_782772.1| GTP-binding protein hflX [Clostridi...   112   2e-23
gi|34498987|ref|NP_903202.1| GTP-binding protein hflX [Chromobac...   112   2e-23
gi|28872055|ref|NP_794674.1| GTP-binding protein HflX [Pseudomon...   112   2e-23
gi|33593196|ref|NP_880840.1| putative GTP-binding protein [Borde...   112   2e-23
gi|23104557|ref|ZP_00091021.1| COG2262: GTPases [Azotobacter vin...   112   2e-23
gi|23099103|ref|NP_692569.1| GTP-binding protein protease modula...   112   2e-23
gi|48861770|ref|ZP_00315669.1| COG2262: GTPases [Microbulbifer d...   112   2e-23
gi|15678003|ref|NP_274075.1| GTP-binding protein [Neisseria meni...   111   4e-23
gi|50842504|ref|YP_055731.1| GTP-binding protein [Propionibacter...   111   4e-23
gi|47569228|ref|ZP_00239914.1| GTP-binding protein [Bacillus cer...   111   4e-23
gi|49186555|ref|YP_029807.1| GTP-binding protein [Bacillus anthr...   111   4e-23
gi|15614925|ref|NP_243228.1| BH2362~unknown conserved protein [B...   111   4e-23
gi|30249265|ref|NP_841335.1| GTP-binding protein HflX [Nitrosomo...   111   4e-23
gi|30263711|ref|NP_846088.1| GTP-binding protein [Bacillus anthr...   111   4e-23
gi|49479206|ref|YP_037773.1| GTP-binding protein (hflX) [Bacillu...   111   4e-23
gi|30021804|ref|NP_833435.1| GTP-binding protein hflX [Bacillus ...   111   5e-23
gi|25332240|pir||G86652 GTP-binding protein HflX [imported] - La...   110   6e-23
gi|34763693|ref|ZP_00144617.1| GTP-binding protein hflX [Fusobac...   110   6e-23
gi|30023980|ref|NP_266379.2| HflX [Lactococcus lactis subsp. lac...   110   6e-23
gi|27364695|ref|NP_760223.1| GTPase [Vibrio vulnificus CMCP6] >g...   110   8e-23
gi|28377728|ref|NP_784620.1| GTPase [Lactobacillus plantarum WCF...   110   8e-23
gi|48732166|ref|ZP_00265909.1| COG2262: GTPases [Pseudomonas flu...   110   8e-23
gi|48769577|ref|ZP_00273922.1| COG2262: GTPases [Ralstonia metal...   110   8e-23
gi|33241830|ref|NP_876771.1| GTP binding protein hflX [Chlamydop...   110   8e-23
gi|19704158|ref|NP_603720.1| GTP-binding protein hflX [Fusobacte...   110   1e-22
gi|37528399|ref|NP_931744.1| GTP-binding protein [Photorhabdus l...   110   1e-22
gi|48844770|ref|ZP_00299068.1| COG2262: GTPases [Geobacter metal...   109   1e-22
gi|46198506|ref|YP_004173.1| GTP-binding protein hflX [Thermus t...   109   2e-22
gi|32474584|ref|NP_867578.1| GTP-binding protein Hflx [Pirellula...   108   2e-22
gi|16752564|ref|NP_444826.1| GTP-binding protein HflX, putative ...   108   2e-22
gi|15618389|ref|NP_224674.1| GTP Binding Protein [Chlamydophila ...   108   2e-22
gi|29840032|ref|NP_829138.1| GTP-binding protein HflX, putative ...   108   3e-22
gi|33866698|ref|NP_898257.1| putative GTP-binding protein, trans...   108   3e-22
gi|48859479|ref|ZP_00313413.1| COG2262: GTPases [Clostridium the...   108   3e-22
gi|50877807|emb|CAG37647.1| related to GTP-binding protein HflX ...   108   3e-22
gi|23130678|ref|ZP_00112491.1| COG2262: GTPases [Nostoc punctifo...   107   5e-22
gi|23474349|ref|ZP_00129643.1| COG2262: GTPases [Desulfovibrio d...   107   5e-22
gi|15804762|ref|NP_290803.1| GTP - binding subunit of protease s...   107   7e-22
gi|26251065|ref|NP_757105.1| GTP-binding protein hflX [Escherich...   107   7e-22
gi|15895566|ref|NP_348915.1| Predicted GTPase, HflX [Clostridium...   107   9e-22
gi|28899590|ref|NP_799195.1| GTP-binding protein HflX [Vibrio pa...   106   1e-21
gi|16131995|ref|NP_418594.1| GTP - binding subunit of protease s...   106   1e-21
gi|16763181|ref|NP_458798.1| HflX protein, putative GTP-binding ...   106   1e-21
gi|41408937|ref|NP_961773.1| HflX [Mycobacterium avium subsp. pa...   106   2e-21
gi|16767608|ref|NP_463223.1| putative GTP-ase [Salmonella typhim...   106   2e-21
gi|15609862|ref|NP_217241.1| hflX [Mycobacterium tuberculosis H3...   105   2e-21
gi|39996112|ref|NP_952063.1| GTP-binding protein [Geobacter sulf...   105   2e-21
gi|15842263|ref|NP_337300.1| GTP-binding protein [Mycobacterium ...   105   2e-21
gi|24115528|ref|NP_710038.1| GTP - binding subunit of protease s...   105   2e-21
gi|15805178|ref|NP_293865.1| GTP-binding protein HflX [Deinococc...   105   3e-21
gi|21282918|ref|NP_646006.1| ORFID:MW1189~hypothetical protein, ...   105   3e-21
gi|50122853|ref|YP_052020.1| putative GTP-binding phage-related ...   105   3e-21
gi|2145853|pir||S72938 hflX protein - Mycobacterium leprae >gnl|...   104   4e-21
gi|15827476|ref|NP_301739.1| possible ATP/GTP-binding protein [M...   104   4e-21
gi|17545940|ref|NP_519342.1| CONSERVED HYPOTHETICAL PROTEIN [Ral...   104   4e-21
gi|15924297|ref|NP_371831.1| hypothetical protein SAV1307 [Staph...   104   4e-21
gi|23003000|ref|ZP_00046671.1| COG2262: GTPases [Lactobacillus g...   104   6e-21
gi|15643293|ref|NP_228337.1| conserved hypothetical protein [The...   104   6e-21
gi|49483469|ref|YP_040693.1| conserved hypothetical protein [Sta...   104   6e-21
gi|16120709|ref|NP_404022.1| GTP-binding protein [Yersinia pesti...   104   6e-21
gi|42519726|ref|NP_965656.1| hypothetical protein LJ0599 [Lactob...   103   8e-21
gi|48787770|ref|ZP_00283749.1| COG2262: GTPases [Burkholderia fu...   103   1e-20
gi|15640375|ref|NP_230002.1| GTP-binding protein HflX [Vibrio ch...   103   1e-20
gi|42524625|ref|NP_970005.1| GTPase [Bdellovibrio bacteriovorus ...   103   1e-20
gi|46914870|emb|CAG21647.1| putative GTP-binding protein HflX [P...   103   1e-20
gi|47933919|gb|AAT39525.1| HflX [Vibrio harveyi]                      102   2e-20
gi|46130520|ref|ZP_00165421.2| COG2262: GTPases [Synechococcus e...   102   2e-20
gi|15602772|ref|NP_245844.1| HflX [Pasteurella multocida Pm70] >...   102   2e-20
gi|47575402|ref|ZP_00245437.1| COG2262: GTPases [Rubrivivax gela...   102   2e-20
gi|33863893|ref|NP_895453.1| putative GTP-binding protein, trans...   102   2e-20
gi|25011333|ref|NP_735728.1| Unknown [Streptococcus agalactiae N...   101   4e-20
gi|23466970|ref|ZP_00122555.1| COG2262: GTPases [Haemophilus som...   101   4e-20
gi|45531146|ref|ZP_00182215.1| COG2262: GTPases [Exiguobacterium...   101   5e-20
gi|50086023|ref|YP_047533.1| GTP-binding protein [Acinetobacter ...   101   5e-20
gi|34541492|ref|NP_905971.1| GTP-binding protein HflX [Porphyrom...   100   6e-20
gi|42528250|ref|NP_973348.1| GTP-binding protein HflX, truncatio...   100   6e-20
gi|22537370|ref|NP_688221.1| GTP-binding protein HflX [Streptoco...   100   6e-20
gi|46315515|ref|ZP_00216097.1| COG2262: GTPases [Burkholderia ce...   100   6e-20
gi|46581638|ref|YP_012446.1| GTP-binding protein HflX [Desulfovi...   100   1e-19
gi|46323590|ref|ZP_00223954.1| COG2262: GTPases [Burkholderia ce...   100   1e-19
gi|41719361|ref|ZP_00148256.1| COG2262: GTPases [Methanococcoide...    99   2e-19
gi|33338590|gb|AAQ13917.1| HflX [Pasteurella multocida]                99   2e-19
gi|48854200|ref|ZP_00308363.1| COG2262: GTPases [Cytophaga hutch...    99   3e-19
gi|24379871|ref|NP_721826.1| putative GTP-binding protein [Strep...    99   3e-19
gi|14590961|ref|NP_143036.1| GTP-binding protein hflX [Pyrococcu...    98   4e-19
gi|33151908|ref|NP_873261.1| GTP-binding protein HflX [Haemophil...    97   7e-19
gi|46916505|emb|CAG23270.1| conserved hypothetical protein [Phot...    97   1e-18
gi|18977549|ref|NP_578906.1| GTP-binding protein, gtp1/obg famil...    96   2e-18
gi|23129638|ref|ZP_00111464.1| COG2262: GTPases [Nostoc punctifo...    95   4e-18
gi|21401684|ref|NP_657669.1| FeoB, Ferrous iron transport protei...    95   4e-18
gi|17231354|ref|NP_487902.1| GTP-binding protein [Nostoc sp. PCC...    95   5e-18
gi|11356533|pir||T44348 GTP binding protein [imported] - Clostri...    94   6e-18
gi|46141378|ref|ZP_00146617.2| COG2262: GTPases [Psychrobacter s...    93   1e-17
gi|15669313|ref|NP_248118.1| GTP-binding protein, member of GTP1...    93   2e-17
gi|23112454|ref|ZP_00097933.1| COG2262: GTPases [Desulfitobacter...    92   2e-17
gi|34498295|ref|NP_902510.1| probable GTP-binding protein [Chrom...    92   3e-17
gi|45526162|ref|ZP_00177373.1| COG2262: GTPases [Crocosphaera wa...    92   3e-17
gi|50428705|gb|AAT77056.1| putative GTP-binding protein [Oryza s...    92   3e-17
gi|48893896|ref|ZP_00327094.1| COG2262: GTPases [Trichodesmium e...    90   1e-16
gi|27467902|ref|NP_764539.1| GTP-binding protein proteinase modu...    90   1e-16
gi|16554491|ref|NP_444215.1| GTPase [Halobacterium sp. NRC-1]          89   2e-16
gi|16330625|ref|NP_441353.1| GTP-binding protein; HflX [Synechoc...    88   6e-16
gi|48840108|ref|ZP_00297036.1| COG2262: GTPases [Methanosarcina ...    87   1e-15
gi|14521287|ref|NP_126762.1| gtp-binding protein hflx [Pyrococcu...    86   2e-15
gi|29347668|ref|NP_811171.1| GTP-binding protein [Bacteroides th...    86   2e-15
gi|47214136|emb|CAG01394.1| unnamed protein product [Tetraodon n...    84   8e-15
gi|20093894|ref|NP_613741.1| GTPase of the HflX family [Methanop...    84   8e-15
gi|45515477|ref|ZP_00167032.1| COG2262: GTPases [Ralstonia eutro...    83   1e-14
gi|45546203|ref|ZP_00186299.1| COG2262: GTPases [Rubrobacter xyl...    82   4e-14
gi|25410008|pir||H84282 GTP-binding protein [imported] - Halobac...    80   9e-14
gi|21226612|ref|NP_632534.1| GTP-binding protein [Methanosarcina...    80   1e-13
gi|20092422|ref|NP_618497.1| GTP-binding protein [Methanosarcina...    80   1e-13
gi|18312175|ref|NP_558842.1| conserved protein (possible hflX) [...    80   2e-13
gi|14601780|ref|NP_148321.1| GTP-binding protein [Aeropyrum pern...    77   1e-12
gi|15791345|ref|NP_281169.1| GTP-binding protein; HflX1 [Halobac...    77   1e-12
gi|33519558|ref|NP_878390.1| HflX protein, putative GTP-binding ...    77   1e-12
gi|15920531|ref|NP_376200.1| 350aa long hypothetical GTP-binding...    70   2e-10
gi|15897212|ref|NP_341817.1| GTP-binding protein (hflX) [Sulfolo...    66   2e-09
gi|29423764|gb|AAO73477.1| putative GTP-binding protein [Sulfolo...    64   7e-09
gi|41724194|ref|ZP_00151060.1| COG2262: GTPases [Dechloromonas a...    57   8e-07
gi|48106863|ref|XP_396172.1| similar to ENSANGP00000007751 [Apis...    53   2e-05
gi|28209869|ref|NP_780813.1| thiophene and furan oxidation prote...    49   2e-04
gi|39997324|ref|NP_953275.1| GTP-binding protein Era [Geobacter ...    49   3e-04
gi|8134431|sp|Q49884|ENGA_MYCLE GTP-binding protein engA >gnl|BL...    49   4e-04
gi|15827717|ref|NP_301980.1| possible GTP-binding protein [Mycob...    49   4e-04
gi|45523190|ref|ZP_00174579.1| COG0536: Predicted GTPase [Crocos...    48   6e-04
gi|15608851|ref|NP_216229.1| hypothetical protein Rv1713 [Mycoba...    47   8e-04
gi|46445853|ref|YP_007218.1| probable to GTP binding protein [Pa...    47   8e-04
gi|23025074|ref|ZP_00064251.1| COG0536: Predicted GTPase [Leucon...    47   0.001
gi|23025266|ref|ZP_00064409.1| COG0536: Predicted GTPase [Leucon...    47   0.001
gi|49235962|ref|ZP_00330025.1| COG0536: Predicted GTPase [Moorel...    47   0.001
gi|48893802|ref|ZP_00327000.1| COG0536: Predicted GTPase [Tricho...    46   0.002
gi|16800640|ref|NP_470908.1| conserved GTP binding protein [List...    45   0.003
gi|23099497|ref|NP_692963.1| Spo0B-associated GTP-binding protei...    45   0.003
gi|41407513|ref|NP_960349.1| hypothetical protein MAP1415 [Mycob...    45   0.004
gi|16079844|ref|NP_390670.1| GTPase activity [Bacillus subtilis ...    45   0.004
gi|27367951|ref|NP_763478.1| ABC-type hemin transport system, AT...    45   0.004
gi|31544654|ref|NP_853232.1| Obg [Mycoplasma gallisepticum R] >g...    45   0.004
gi|50842690|ref|YP_055917.1| putative GTP binding protein [Propi...    45   0.004
gi|17934943|ref|NP_531733.1| GTP-binding protein, Era family [Ag...    45   0.005
gi|15888378|ref|NP_354059.1| AGR_C_1909p [Agrobacterium tumefaci...    45   0.005
gi|50725362|dbj|BAD34434.1| putative translation initiation fact...    45   0.005
gi|16803577|ref|NP_465062.1| conserved GTP binding protein [List...    45   0.005
gi|15792285|ref|NP_282108.1| putative thiophene and furan oxidat...    44   0.007
gi|15643037|ref|NP_228080.1| thiophene oxidation protein ThdF-re...    44   0.009
gi|15964826|ref|NP_385179.1| PROBABLE GTP-BINDING PROTEIN [Sinor...    44   0.012
gi|41281653|ref|NP_598399.1| GTP binding protein 3 (mitochondria...    44   0.012
gi|14249126|ref|NP_116009.1| GTP binding protein 3 (mitochondria...    44   0.012
gi|48764277|ref|ZP_00268829.1| COG1159: GTPase [Rhodospirillum r...    43   0.016
gi|37676079|ref|NP_936475.1| ABC-type hemin transport system, AT...    43   0.016
gi|17231231|ref|NP_487779.1| GTP-binding protein [Nostoc sp. PCC...    43   0.016
gi|23124543|ref|ZP_00106525.1| COG0536: Predicted GTPase [Nostoc...    43   0.016
gi|22299896|ref|NP_683143.1| GTP-binding protein [Thermosynechoc...    43   0.016
gi|23465316|ref|NP_695919.1| probable GTP binding protein [Bifid...    43   0.021
gi|34877544|ref|XP_224716.2| similar to GTP binding protein 3 [R...    43   0.021
gi|33863811|ref|NP_895371.1| GTP1/OBG family:Hemolysin-type calc...    43   0.021
gi|41689125|ref|ZP_00145660.1| COG0486: Predicted GTPase [Psychr...    43   0.021
gi|46191228|ref|ZP_00206719.1| COG1160: Predicted GTPases [Bifid...    43   0.021
gi|30248601|ref|NP_840671.1| conserved hypothetical protein [Nit...    43   0.021
gi|48841018|ref|ZP_00297944.1| COG1163: Predicted GTPase [Methan...    42   0.027
gi|15606987|ref|NP_214369.1| GTP-binding protein Era [Aquifex ae...    42   0.027
gi|46141577|ref|ZP_00146869.2| COG0532: Translation initiation f...    42   0.027
gi|40674073|gb|AAH64977.1| MTIF2 protein [Homo sapiens]                42   0.027
gi|27370954|gb|AAH39848.1| Similar to mitochondrial translationa...    42   0.027
gi|48846893|ref|ZP_00301152.1| COG1159: GTPase [Geobacter metall...    42   0.027
gi|4505277|ref|NP_002444.1| mitochondrial translational initiati...    42   0.027
gi|15903028|ref|NP_358578.1| GTP-binding protein [Streptococcus ...    42   0.035
gi|19703615|ref|NP_603177.1| GTP-binding protein era [Fusobacter...    42   0.035
gi|24158881|pdb|1LNZ|A Chain A, Structure Of The Obg Gtp-Binding...    42   0.035
gi|16329540|ref|NP_440268.1| GTP-binding protein [Synechocystis ...    42   0.035
gi|13650157|gb|AAK37568.1| mitochondrial GTP-binding protein 1 [...    42   0.035
gi|24372927|ref|NP_716969.1| GTP-binding protein Era [Shewanella...    42   0.046
gi|15594853|ref|NP_212642.1| GTP-binding protein [Borrelia burgd...    42   0.046
gi|33239698|ref|NP_874640.1| Predicted GTPase [Prochlorococcus m...    42   0.046
gi|15613776|ref|NP_242079.1| GTP-binding protein involved in ini...    42   0.046
gi|15900948|ref|NP_345552.1| GTP-binding protein, GTP1/Obg famil...    42   0.046
gi|48859628|ref|ZP_00313560.1| COG0486: Predicted GTPase [Clostr...    42   0.046
gi|26553646|ref|NP_757580.1| GTP-binding protein Obg [Mycoplasma...    42   0.046
gi|34764123|ref|ZP_00144997.1| GTP binding protein [Fusobacteriu...    41   0.060
gi|46105915|ref|ZP_00186303.2| COG1160: Predicted GTPases [Rubro...    41   0.060
gi|48864917|ref|ZP_00318787.1| COG0536: Predicted GTPase [Oenoco...    41   0.079
gi|41720466|ref|ZP_00149279.1| COG1163: Predicted GTPase [Methan...    41   0.079
gi|46129600|ref|ZP_00164101.2| COG0536: Predicted GTPase [Synech...    41   0.079
gi|42525170|ref|NP_970550.1| GTP-binding protein [Bdellovibrio b...    41   0.079
gi|19705223|ref|NP_602718.1| SPO0B-associated GTP-binding protei...    41   0.079
gi|15669110|ref|NP_247915.1| GTP-binding protein homologue (yphC...    41   0.079
gi|48477951|ref|YP_023657.1| GTP-binding protein [Picrophilus to...    41   0.079
gi|48870693|ref|ZP_00323412.1| COG0536: Predicted GTPase [Pedioc...    41   0.079
gi|24379258|ref|NP_721213.1| putative GTP-binding protein [Strep...    40   0.10
gi|29376092|ref|NP_815246.1| GTP-binding protein [Enterococcus f...    40   0.10
gi|48823773|ref|ZP_00285267.1| COG0536: Predicted GTPase [Entero...    40   0.10
gi|15235996|ref|NP_194885.1| expressed protein [Arabidopsis thal...    40   0.10
gi|15679616|ref|NP_276733.1| GTP-binding protein, GTP1/OBG famil...    40   0.10
gi|33322856|gb|AAQ07164.1| GTP-binding protein hflX [Lactobacill...    40   0.10
gi|15924634|ref|NP_372168.1| Spo0B-associated GTP-binding protei...    40   0.10
gi|23003540|ref|ZP_00047200.1| COG0486: Predicted GTPase [Lactob...    40   0.13
gi|49235452|ref|ZP_00329521.1| COG1160: Predicted GTPases [Moore...    40   0.13
gi|19552644|ref|NP_600646.1| predicted GTPase [Corynebacterium g...    40   0.13
gi|49476318|ref|YP_034359.1| Thiophene and furan oxidizer [Barto...    40   0.13
gi|34558325|ref|NP_908140.1| PUTATIVE GTP-BINDING PROTEIN [Wolin...    40   0.13
gi|26006713|sp|Q8NQK6|ENGA_CORGL GTP-binding protein engA >gnl|B...    40   0.13
gi|45658262|ref|YP_002348.1| GTP-binding protein [Leptospira int...    40   0.13
gi|24214003|ref|NP_711484.1| Probable GTP-binding protein engA [...    40   0.13
gi|48851972|ref|ZP_00306165.1| COG1084: Predicted GTPase [Ferrop...    40   0.13
gi|16125809|ref|NP_420373.1| GTP-binding protein Era [Caulobacte...    40   0.13
gi|13959353|sp|P58071|ERA_CAUCR GTP-binding protein era homolog        40   0.13
gi|38233787|ref|NP_939554.1| Putative GTP-binding protein [Coryn...    40   0.13
gi|17939531|gb|AAH19261.1| GTP binding protein 3 (mitochondrial)...    40   0.13
gi|37999700|sp|Q8FTK5|ENGA_COREF GTP-binding protein engA              40   0.18
gi|46119647|ref|ZP_00177010.2| COG0370: Fe2+ transport system pr...    40   0.18
gi|25028117|ref|NP_738171.1| conserved hypothetical protein [Cor...    40   0.18
gi|50421481|ref|XP_459291.1| unnamed protein product [Debaryomyc...    40   0.18
gi|49483888|ref|YP_041112.1| Spo0B-associated GTP-binding protei...    40   0.18
gi|16271988|ref|NP_438186.1| GTP-binding protein [Haemophilus in...    40   0.18
gi|27904840|ref|NP_777966.1| GTP-binding protein [Buchnera aphid...    39   0.23
gi|27262240|gb|AAN87401.1| SPO0B-associated GTP-binding protein ...    39   0.23
gi|23002852|ref|ZP_00046524.1| COG0536: Predicted GTPase [Lactob...    39   0.23
gi|34762112|ref|ZP_00143120.1| SPO0B-associated GTP-binding prot...    39   0.23
gi|48831512|ref|ZP_00288573.1| COG0486: Predicted GTPase [Magnet...    39   0.23
gi|33591923|ref|NP_879567.1| probable GTP-binding protein [Borde...    39   0.23
gi|13358024|ref|NP_078298.1| GTP-binding protein [Ureaplasma par...    39   0.23
gi|20808283|ref|NP_623454.1| Selenocysteine-specific translation...    39   0.23
gi|15607036|ref|NP_214418.1| GTP-binding protein [Aquifex aeolic...    39   0.30
gi|21227149|ref|NP_633071.1| GTP-binding protein [Methanosarcina...    39   0.30
gi|33866460|ref|NP_898019.1| GTP1/Obg family GTP-binding protein...    39   0.30
gi|46914627|emb|CAG21404.1| putative GTP-binding protein Era [Ph...    39   0.30
gi|50591407|ref|ZP_00332720.1| COG0536: Predicted GTPase [Strept...    39   0.30
gi|45684313|ref|ZP_00195744.1| COG0536: Predicted GTPase [Mesorh...    39   0.30
gi|48824692|ref|ZP_00286036.1| COG1159: GTPase [Enterococcus fae...    39   0.30
gi|13357944|ref|NP_078218.1| conserved hypothetical ATP/GTP-bind...    39   0.30
gi|27262166|gb|AAN87364.1| GTP-binding protein [Heliobacillus mo...    39   0.39
gi|20093139|ref|NP_619214.1| GTP-binding protein [Methanosarcina...    39   0.39
gi|34540645|ref|NP_905124.1| thiophene and furan oxidation prote...    39   0.39
gi|12045245|ref|NP_073056.1| GTP-binding protein (obg) [Mycoplas...    39   0.39
gi|16124570|ref|NP_419134.1| GTP-binding protein CgtA [Caulobact...    39   0.39
gi|42518996|ref|NP_964926.1| Spo0B-associated GTP-binding protei...    39   0.39
gi|23489867|gb|EAA21775.1| translation initiation factor IF-2-re...    39   0.39
gi|46577356|sp|Q7MVZ2|TRME_PORGI tRNA modification GTPase trmE         39   0.39
gi|49070026|ref|XP_399302.1| hypothetical protein UM01687.1 [Ust...    39   0.39
gi|17986290|ref|NP_538924.1| THIOPHENE AND FURAN OXIDATION PROTE...    39   0.39
gi|6573766|gb|AAF17686.1| F28K19.23 [Arabidopsis thaliana]             39   0.39
gi|33414589|ref|NP_115933.2| GTP binding protein 3 [Mus musculus...    39   0.39
gi|15606250|ref|NP_213628.1| cell division protein FtsY [Aquifex...    38   0.51
gi|29376905|ref|NP_816059.1| GTP-binding protein Era [Enterococc...    38   0.51
gi|50364829|ref|YP_053254.1| tRNA modification GTPase [Mesoplasm...    38   0.51
gi|23100099|ref|NP_693565.1| hypothetical protein OB2644 [Oceano...    38   0.51
gi|6323665|ref|NP_013736.1| May play a part in mitochondrial tra...    38   0.51
gi|4006|emb|CAA49238.1| GTPase [Saccharomyces cerevisiae]              38   0.51
gi|11499729|ref|NP_070971.1| GTP-binding protein [Archaeoglobus ...    38   0.51
gi|31544923|ref|NP_853501.1| ThdF [Mycoplasma gallisepticum R] >...    38   0.51
gi|47217399|emb|CAG00759.1| unnamed protein product [Tetraodon n...    38   0.51
gi|46133650|ref|ZP_00203222.1| COG1159: GTPase [Haemophilus infl...    38   0.51
gi|16082451|ref|NP_394940.1| GTP-binding protein [Thermoplasma a...    38   0.51
gi|11277016|pir||T43254 GTP-binding protein - Thermoplasma acido...    38   0.51
gi|23112909|ref|ZP_00098333.1| COG3276: Selenocysteine-specific ...    38   0.67
gi|17227979|ref|NP_484527.1| GTP binding protein [Nostoc sp. PCC...    38   0.67
gi|48853834|ref|ZP_00308000.1| COG0536: Predicted GTPase [Cytoph...    38   0.67
gi|23502910|ref|NP_699037.1| tRNA modification GTPase TrmE [Bruc...    38   0.67
gi|50285461|ref|XP_445159.1| unnamed protein product [Candida gl...    38   0.67
gi|27806007|ref|NP_776818.1| mitochondrial translational initiat...    38   0.67
gi|15669516|ref|NP_248326.1| GTP-binding protein, member of GTP1...    38   0.67
gi|18312780|ref|NP_559447.1| GTP-binding protein [Pyrobaculum ae...    38   0.67
gi|23011471|ref|ZP_00051819.1| COG1160: Predicted GTPases [Magne...    38   0.67
gi|49474829|ref|YP_032871.1| Thiophene and furan oxidizer [Barto...    37   0.87
gi|15606936|ref|NP_214317.1| GTP binding protein Era [Aquifex ae...    37   0.87
gi|46191754|ref|ZP_00206977.1| COG0486: Predicted GTPase [Rhodob...    37   0.87
gi|15790864|ref|NP_280688.1| bacterial-like IF2; InfB [Halobacte...    37   0.87
gi|13507747|ref|NP_109696.1| thiophene and furan oxidation prote...    37   0.87
gi|29833066|ref|NP_827700.1| putative GTP-binding protein [Strep...    37   0.87
gi|18447544|gb|AAL68333.1| RE72863p [Drosophila melanogaster]          37   1.1
gi|46308678|ref|ZP_00210870.1| COG1159: GTPase [Ehrlichia canis ...    37   1.1
gi|48861812|ref|ZP_00315711.1| COG0532: Translation initiation f...    37   1.1
gi|33861837|ref|NP_893398.1| GTP-binding protein ERA homolog [Pr...    37   1.1
gi|48852927|ref|ZP_00307109.1| COG1163: Predicted GTPase [Ferrop...    37   1.1
gi|20129375|ref|NP_609218.1| CG13390-PA [Drosophila melanogaster...    37   1.1
gi|15642873|ref|NP_227914.1| conserved hypothetical protein [The...    37   1.1
gi|7531150|sp|O93625|IF2P_HALSA Probable translation initiation ...    37   1.1
gi|21221053|ref|NP_626832.1| GTP-binding protein [Streptomyces c...    37   1.1
gi|22971878|ref|ZP_00018795.1| hypothetical protein [Chloroflexu...    37   1.1
gi|34557648|ref|NP_907463.1| PUTATIVE TRNA MODIFICATION GTPASE T...    37   1.1
gi|45359006|ref|NP_988563.1| GTP1/OBG family:ATP/GTP-binding sit...    37   1.1
gi|33944473|ref|XP_340384.1| hypothetical protein Tb927.2.2860 [...    37   1.1
gi|13476158|ref|NP_107728.1| GTP-binding protei [Mesorhizobium l...    37   1.1
gi|32266240|ref|NP_860272.1| selenocysteine-specific elongation ...    37   1.1
gi|48860515|ref|ZP_00314440.1| COG0536: Predicted GTPase [Clostr...    37   1.1
gi|45510503|ref|ZP_00162835.1| COG1160: Predicted GTPases [Anaba...    37   1.5
gi|50424111|ref|XP_460640.1| unnamed protein product [Debaryomyc...    37   1.5
gi|23619062|ref|NP_705024.1| translation initiation factor if-2,...    37   1.5
gi|20095000|ref|NP_614847.1| Translation initiation factor 2, GT...    37   1.5
gi|26554267|ref|NP_758201.1| thiophene and furan oxidation prote...    37   1.5
gi|46113059|ref|ZP_00182241.2| COG0536: Predicted GTPase [Exiguo...    37   1.5
gi|46365049|ref|ZP_00227565.1| COG1160: Predicted GTPases [Kineo...    37   1.5
gi|37525271|ref|NP_928615.1| Glutamate/aspartate transport ATP-b...    37   1.5
gi|33860778|ref|NP_892339.1| GTP1/OBG family [Prochlorococcus ma...    37   1.5
gi|20094840|ref|NP_614687.1| Translation elongation factor, GTPa...    37   1.5
gi|16264869|ref|NP_437661.1| putative GTP-binding protein [Sinor...    37   1.5
gi|27468245|ref|NP_764882.1| Spo0B-associated GTP-binding protei...    37   1.5
gi|37523944|ref|NP_927321.1| glr4375 [Gloeobacter violaceus PCC ...    36   1.9
gi|26006737|sp|Q9EWW8|ENGA_STRCO GTP-binding protein engA              36   1.9
gi|15674224|ref|NP_268399.1| ThdF [Lactococcus lactis subsp. lac...    36   1.9
gi|15606214|ref|NP_213591.1| thiophene and furan oxidation prote...    36   1.9
gi|7448684|pir||T00126 hypothetical protein 4 - Leptospira inter...    36   1.9
gi|50365015|ref|YP_053440.1| GTP-binding protein, cell cycle con...    36   1.9
gi|33146858|dbj|BAC79856.1| putative GTP-binding protein DRG [Or...    36   1.9
gi|38087483|ref|XP_357778.1| similar to hypothetical protein [Mu...    36   1.9
gi|45656065|ref|YP_000151.1| tRNA modification GTPase [Leptospir...    36   1.9
gi|21220251|ref|NP_626030.1| putative GTP binding protein [Strep...    36   1.9
gi|34913186|ref|NP_917940.1| putative GTP-binding protein [Oryza...    36   1.9
gi|46358378|ref|NP_796187.2| ATP-binding cassette transporter su...    36   1.9
gi|45507432|ref|ZP_00159776.1| COG2262: GTPases [Anabaena variab...    36   1.9
gi|48845064|ref|ZP_00299353.1| COG0536: Predicted GTPase [Geobac...    36   2.5
gi|39997323|ref|NP_953274.1| GTP-binding protein Era, putative [...    36   2.5
gi|23473155|ref|ZP_00128451.1| COG1160: Predicted GTPases [Desul...    36   2.5
gi|7494181|pir||T28160 hypothetical protein - malaria parasite (...    36   2.5
gi|50308583|ref|XP_454294.1| unnamed protein product [Kluyveromy...    36   2.5
gi|29347247|ref|NP_810750.1| putative GTP-binding protein, putat...    36   2.5
gi|23612553|ref|NP_704114.1| exported serine/threonine protein k...    36   2.5
gi|30688739|ref|NP_850353.1| GTP-binding family protein [Arabido...    36   2.5
gi|47566631|ref|ZP_00237453.1| GTP-binding protein [Bacillus cer...    36   2.5
gi|42783578|ref|NP_980825.1| spo0B-associated GTP-binding protei...    36   2.5
gi|49481594|ref|YP_038491.1| spo0B-associated GTP-binding protei...    36   2.5
gi|30022515|ref|NP_834146.1| GTP-binding protein [Bacillus cereu...    36   2.5
gi|21402487|ref|NP_658472.1| GTP1_OBG, GTP1/OBG family [Bacillus...    36   2.5
gi|23619515|ref|NP_705477.1| GTP-binding protein, putative [Plas...    36   2.5
gi|21242599|ref|NP_642181.1| ferrous iron transport protein B [X...    36   2.5
gi|21231283|ref|NP_637200.1| ferrous iron transport protein B [X...    36   2.5
gi|32472944|ref|NP_865938.1| cell division protein FtsY [Pirellu...    36   2.5
gi|24374819|ref|NP_718862.1| GTP-binding protein EngA [Shewanell...    36   2.5
gi|7484843|pir||T02470 hypothetical protein At2g45770 [imported]...    36   2.5
gi|15900887|ref|NP_345491.1| thiophene and furan oxidation prote...    36   2.5
gi|15828484|ref|NP_325844.1| THIOPHENE AND FURAN OXIDATION PROTE...    36   2.5
gi|13812180|ref|NP_113310.1| eukaryotic translation initiation f...    36   2.5
gi|15924587|ref|NP_372121.1| conserved hypothetical protein [Sta...    36   2.5
gi|16329334|ref|NP_440062.1| unknown protein [Synechocystis sp. ...    36   2.5
gi|15606325|ref|NP_213704.1| elongation factor SelB [Aquifex aeo...    35   3.3
gi|13508302|ref|NP_110252.1| small GTPase OBG involved in cell g...    35   3.3
gi|585301|sp|Q08810|IF2C_GALSU Translation initiation factor IF-...    35   3.3
gi|48477308|ref|YP_023014.1| GTP binding protein [Picrophilus to...    35   3.3
gi|13540832|ref|NP_110520.1| Predicted GTPase [Thermoplasma volc...    35   3.3
gi|28378716|ref|NP_785608.1| GTP-binding protein [Lactobacillus ...    35   3.3
gi|48855235|ref|ZP_00309394.1| COG1159: GTPase [Cytophaga hutchi...    35   3.3
gi|50546703|ref|XP_500821.1| hypothetical protein [Yarrowia lipo...    35   3.3
gi|29349959|ref|NP_813462.1| putative GTPase, ThdF family [Bacte...    35   3.3
gi|11245962|gb|AAG32538.1| SalT [Streptococcus salivarius]             35   3.3
gi|21910546|ref|NP_664814.1| putative GTP-binding protein [Strep...    35   3.3
gi|21399823|ref|NP_655808.1| ABC_tran, ABC transporter [Bacillus...    35   3.3
gi|23126950|ref|ZP_00108830.1| COG1160: Predicted GTPases [Nosto...    35   3.3
gi|18978135|ref|NP_579492.1| GTP-binding protein, gtp1/obg famil...    35   3.3
gi|22537613|ref|NP_688464.1| GTP-binding protein, GTP1/Obg famil...    35   3.3
gi|28895761|ref|NP_802111.1| putative GTP-binding protein [Strep...    35   3.3
gi|19746308|ref|NP_607444.1| putative GTP-binding protein [Strep...    35   3.3
gi|15892851|ref|NP_360565.1| probable GTP-binding protein [Ricke...    35   3.3
gi|34581439|ref|ZP_00142919.1| probable GTP-binding protein [Ric...    35   4.3
gi|15892081|ref|NP_359795.1| GTP-binding protein Era [Rickettsia...    35   4.3
gi|15612410|ref|NP_224063.1| putative thiophene/furan oxidation ...    35   4.3
gi|34580888|ref|ZP_00142368.1| GTP-binding protein Era [Ricketts...    35   4.3
gi|48834681|ref|ZP_00291687.1| COG1160: Predicted GTPases [Therm...    35   4.3
gi|48730237|ref|ZP_00263985.1| COG1160: Predicted GTPases [Pseud...    35   4.3
gi|48771549|ref|ZP_00275891.1| COG0486: Predicted GTPase [Ralsto...    35   4.3
gi|34866949|ref|XP_216982.2| similar to GTP binding protein 1 [R...    35   4.3
gi|15226227|ref|NP_178241.1| ABC transporter family protein [Ara...    35   4.3
gi|46200176|ref|YP_005843.1| GTP-binding protein era [Thermus th...    35   4.3
gi|13605839|gb|AAK32905.1| At2g01320/F10A8.20 [Arabidopsis thali...    35   4.3
gi|42563304|ref|NP_177924.3| tRNA modification GTPase, putative ...    35   4.3
gi|15677493|ref|NP_274649.1| hypothetical protein NMB1644 [Neiss...    35   4.3
gi|50877828|emb|CAG37668.1| Probable GTP-binding protein (EngA) ...    35   4.3
gi|24375519|ref|NP_719562.1| conserved hypothetical protein [She...    35   4.3
gi|30677907|ref|NP_849922.1| ABC transporter family protein [Ara...    35   4.3
gi|20808046|ref|NP_623217.1| predicted GTPases [Thermoanaerobact...    35   4.3
gi|23014919|ref|ZP_00054713.1| COG0370: Fe2+ transport system pr...    35   4.3
gi|48854524|ref|ZP_00308686.1| COG1217: Predicted membrane GTPas...    35   4.3
gi|33240483|ref|NP_875425.1| Membrane associated GTPase [Prochlo...    35   4.3
gi|7305117|ref|NP_038846.1| GTP binding protein 1 [Mus musculus]...    35   4.3
gi|7513669|pir||JC5292 GTP-binding protein GP-1 - mouse                35   4.3
gi|28278296|gb|AAH46228.1| Gtpbp1 protein [Mus musculus]               35   4.3
gi|29349796|ref|NP_813299.1| GTP-binding protein [Bacteroides th...    35   4.3
gi|50085654|ref|YP_047164.1| GTP-binding protein,16S rRNA-bindin...    35   4.3
gi|50306503|ref|XP_453225.1| unnamed protein product [Kluyveromy...    35   4.3
gi|15603631|ref|NP_246705.1| SelB [Pasteurella multocida Pm70] >...    35   4.3
gi|47228156|emb|CAF97785.1| unnamed protein product [Tetraodon n...    35   4.3
gi|30677905|ref|NP_849921.1| ABC transporter family protein [Ara...    35   4.3
gi|15794783|ref|NP_284605.1| putative integral membrane protein ...    35   4.3
gi|4758490|ref|NP_004277.1| GTP binding protein 1; G-protein 1 [...    35   4.3
gi|23015371|ref|ZP_00055149.1| COG1160: Predicted GTPases [Magne...    35   4.3
gi|7512475|pir||JC5291 GTP-binding protein GP-1 - human                35   4.3
gi|17544724|ref|NP_518126.1| PROBABLE THIOPHENE AND FURAN OXIDAT...    35   4.3
gi|34540100|ref|NP_904579.1| translation initiation factor IF-2 ...    35   4.3
gi|48832871|ref|ZP_00289898.1| COG1160: Predicted GTPases [Magne...    35   4.3
gi|46141392|ref|ZP_00146634.2| COG1159: GTPase [Psychrobacter sp...    35   4.3
gi|50286275|ref|XP_445566.1| unnamed protein product [Candida gl...    35   4.3
gi|47678533|emb|CAG30387.1| GTPBP1 [Homo sapiens]                      35   4.3
gi|15646061|ref|NP_208243.1| thiophene and furan oxidizer (tdhF)...    35   5.6
gi|21228472|ref|NP_634394.1| GTP-binding protein [Methanosarcina...    35   5.6
gi|48767605|ref|ZP_00271959.1| COG0536: Predicted GTPase [Ralsto...    35   5.6
gi|33519572|ref|NP_878404.1| probable GTP-binding protein [Candi...    35   5.6
gi|50876578|emb|CAG36418.1| probable GTP-binding protein Era hom...    35   5.6
gi|24379853|ref|NP_721808.1| mutator protein, pyrophosphohydrola...    35   5.6
gi|32474656|ref|NP_867650.1| ferrous iron transport protein B [P...    35   5.6
gi|15616653|ref|NP_239865.1| cell division protein FtsY [Buchner...    35   5.6
gi|46912238|emb|CAG19033.1| putative initiation factor IF-2 [Pho...    35   5.6
gi|50083629|ref|YP_045139.1| protein chain initiation factor IF-...    35   5.6


>gi|17561038|ref|NP_505523.1| GTP-binding protein like (5K258)
            [Caenorhabditis elegans]
 gi|7503540|pir||T22287 hypothetical protein F46B6.4 - Caenorhabditis
            elegans
 gi|3877202|emb|CAA94821.1| Hypothetical protein F46B6.4
            [Caenorhabditis elegans]
          Length = 468

 Score =  885 bits (2286), Expect = 0.0
 Identities = 457/468 (97%), Positives = 457/468 (97%)
 Frame = -1

Query: 1407 MFILRLSRQTVLSFRNLSIGSSEVAAPSAFANDRWSVLVVHPKVRWGSGSASVLKQADRQ 1228
            MFILRLSRQTVLSFRNLSIGSSEVAAPSAFANDRWSVLVVHPKVRWGSGSASVLKQADRQ
Sbjct: 1    MFILRLSRQTVLSFRNLSIGSSEVAAPSAFANDRWSVLVVHPKVRWGSGSASVLKQADRQ 60

Query: 1227 LEEAVALVDNLPNMNAVDSLIMPVDYNTKRKAVWASGNLEKLIARREAARATALMVNVDA 1048
            LEEAVALVDNLPNMNAVDSLIMPVDYNTKRKAVWASGNLEKLIARREAARATALMVNVDA
Sbjct: 61   LEEAVALVDNLPNMNAVDSLIMPVDYNTKRKAVWASGNLEKLIARREAARATALMVNVDA 120

Query: 1047 LSPSQQQELYRIFEVPIFDRYNIVLATFKQFAKTXXXXXXXXXXXIPYIKHRIHALSSKR 868
            LSPSQQQELYRIFEVPIFDRYNIVLATFKQFAKT           IPYIKHRIHALSSKR
Sbjct: 121  LSPSQQQELYRIFEVPIFDRYNIVLATFKQFAKTEEARIQIAIAEIPYIKHRIHALSSKR 180

Query: 867  LHSRPDILHIDSHYSDIDGDLNEILRKREQDLRKELKDVTRKNVGQLGVRNSSDAVVAVV 688
            LHSRPDILHIDSHYSDIDGDLNEILRKREQDLRKELKDVTRKNVGQLGVRNSSDAVVAVV
Sbjct: 181  LHSRPDILHIDSHYSDIDGDLNEILRKREQDLRKELKDVTRKNVGQLGVRNSSDAVVAVV 240

Query: 687  GYTNSGKTSLVKKLTGAASLTPKDQLFATLDTTRHLAKLPSGRSAVFTDTIGFLSDLPMH 508
            GYTNSGKTSLVKKLTGAASLTPKDQLFATLDTTRHLAKLPSGRSAVFTDTIGFLSDLPMH
Sbjct: 241  GYTNSGKTSLVKKLTGAASLTPKDQLFATLDTTRHLAKLPSGRSAVFTDTIGFLSDLPMH 300

Query: 507  LIAAFEATLAHVKSADVIIHLRDISNPDWKAQEEDVLATLKSIGVTDYVLNERIISVDNK 328
            LIAAFEATLAHVKSADVIIHLRDISNPDWKAQEEDVLATLKSIGVTDYVLNERIISVDNK
Sbjct: 301  LIAAFEATLAHVKSADVIIHLRDISNPDWKAQEEDVLATLKSIGVTDYVLNERIISVDNK 360

Query: 327  IDKESAFPTSESNNSVRISCKTGDGMHELIDVINDKVTMVTKCKTIRLRLDARSPVIEWL 148
            IDKESAFPTSESNNSVRISCKTGDGMHELIDVINDKVTMVTKCKTIRLRLDARSPVIEWL
Sbjct: 361  IDKESAFPTSESNNSVRISCKTGDGMHELIDVINDKVTMVTKCKTIRLRLDARSPVIEWL 420

Query: 147  YHNELVVIEPTIDGNYLIFDVVMNESEIGRFRKKFAHLKKKNSQSVSL 4
            YHNELVVIEPTIDGNYLIFDVVMNESEIGRFRKKFAHLKKKNSQSVSL
Sbjct: 421  YHNELVVIEPTIDGNYLIFDVVMNESEIGRFRKKFAHLKKKNSQSVSL 468


>gi|39594674|emb|CAE72253.1| Hypothetical protein CBG19372
            [Caenorhabditis briggsae]
          Length = 1328

 Score =  704 bits (1816), Expect = 0.0
 Identities = 357/463 (77%), Positives = 409/463 (88%), Gaps = 2/463 (0%)
 Frame = -1

Query: 1407 MFILRLSRQTVLSFRNLSIGSSEVAAPSA-FANDRWSVLVVHPKVRWGSGSASVLKQADR 1231
            M   R++R  ++SFR+ SIG  +VA  S+ FANDRWSVLVVHPKVRWGSGSASVLKQADR
Sbjct: 867  MIFRRITR--LISFRSFSIGRPDVATTSSKFANDRWSVLVVHPKVRWGSGSASVLKQADR 924

Query: 1230 QLEEAVALVDNLPNMNAVDSLIMPVDYNTKRKAVWASGNLEKLIARREAARATALMVNVD 1051
            QLEEAVALV+NLPNM AVDSLIMPVDYNTKRK++WA+GNLEKL+ RREAARATALM+NVD
Sbjct: 925  QLEEAVALVNNLPNMIAVDSLIMPVDYNTKRKSIWAAGNLEKLVTRREAARATALMINVD 984

Query: 1050 ALSPSQQQELYRIFEVPIFDRYNIVLATFKQFAKTXXXXXXXXXXXIPYIKHRIHALSSK 871
             LSPSQQ+EL+RIFEVPIFDRYNIVL+TFK+FA+T           IPYIK+RIHALSSK
Sbjct: 985  VLSPSQQEELFRIFEVPIFDRYNIVLSTFKEFAQTDEAQLQIALAEIPYIKNRIHALSSK 1044

Query: 870  RLHSRPDILHIDSHYSDIDGDLNEILRKREQDLRKELKDVTRKNVGQLGVRNSSDAVVAV 691
            RLHSRP+ILHI+  Y++++GDLNEILRKREQDLR++LK++TRK+   +  +NSSDAVVAV
Sbjct: 1045 RLHSRPEILHIEQQYAEVEGDLNEILRKREQDLRRDLKELTRKSSESIKSKNSSDAVVAV 1104

Query: 690  VGYTNSGKTSLVKKLTGAASLTPKDQLFATLDTTRHLAKLPSGRSAVFTDTIGFLSDLPM 511
            VGYTN+GKTSLVK+LTGA+SLTPK+QLFATLDTTRH+AKLPSGRSAVFTDTIGFLSDLPM
Sbjct: 1105 VGYTNAGKTSLVKRLTGASSLTPKNQLFATLDTTRHVAKLPSGRSAVFTDTIGFLSDLPM 1164

Query: 510  HLIAAFEATLAHVKSADVIIHLRDISNPDWKAQEEDVLATLKSIGVTDYVLNERIISVDN 331
            HLI+AFEATLAHVKSADVIIHLRD+SNPDWKAQEEDV+ATLKSIGV + VL ER+I+VDN
Sbjct: 1165 HLISAFEATLAHVKSADVIIHLRDVSNPDWKAQEEDVVATLKSIGVAENVLTERMITVDN 1224

Query: 330  KIDKESAFPTSE-SNNSVRISCKTGDGMHELIDVINDKVTMVTKCKTIRLRLDARSPVIE 154
            KIDKE     ++ +  S+RISCKTGDGM +LID IN KVT+ TKCKTIR RLD RSPVIE
Sbjct: 1225 KIDKEGVENIADATTKSIRISCKTGDGMQDLIDRINQKVTIATKCKTIRFRLDVRSPVIE 1284

Query: 153  WLYHNELVVIEPTIDGNYLIFDVVMNESEIGRFRKKFAHLKKK 25
            WLYHNE VV+EP  DGN LIFDVVM+ESEIGRFRKKF HL+KK
Sbjct: 1285 WLYHNEFVVVEPVADGNNLIFDVVMSESEIGRFRKKFDHLRKK 1327




[DB home][top]