Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= F46F11_3
         (381 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17507391|ref|NP_491641.1| atpase H+ transporting lysosomal (1...   244   4e-64
gi|39598233|emb|CAE68925.1| Hypothetical protein CBG14904 [Caeno...   237   5e-62
gi|48113487|ref|XP_393157.1| similar to ENSANGP00000016262 [Apis...   136   1e-31
gi|31210705|ref|XP_314319.1| ENSANGP00000013212 [Anopheles gambi...   135   1e-31
gi|2493139|sp|Q25532|VATG_MANSE Vacuolar ATP synthase subunit G ...   135   2e-31
gi|41152466|ref|NP_956228.1| ATPase, H+ transporting, V1 subunit...   124   3e-28
gi|38503311|sp|Q862Z6|VAG1_PANTR Vacuolar ATP synthase subunit G...   124   6e-28
gi|47059104|ref|NP_997655.1| ATPase, H+ transporting, V1 subunit...   124   6e-28
gi|12963559|ref|NP_075668.1| ATPase, H+ transporting, V1 subunit...   124   6e-28
gi|12585384|sp|Q9TSV6|VAG2_PIG Vacuolar ATP synthase subunit G 2...   124   6e-28
gi|27806309|ref|NP_776670.1| ATPase, H+ transporting, lysosomal ...   124   6e-28
gi|27714615|ref|XP_216411.1| similar to ATPase, H+ transporting,...   123   7e-28
gi|18497300|ref|NP_569730.1| ATPase, H+ transporting, lysosomal,...   123   7e-28
gi|4757818|ref|NP_004879.1| ATPase, H+ transporting, lysosomal, ...   123   1e-27
gi|15617197|ref|NP_077135.1| ATPase, H+ transporting, V1 subunit...   123   1e-27
gi|33585956|gb|AAH56050.1| Atp6v1g1-prov protein [Xenopus laevis]     122   1e-27
gi|50370159|gb|AAH76701.1| Unknown (protein for MGC:79764) [Xeno...   121   4e-27
gi|17137684|ref|NP_477437.1| CG6213-PA [Drosophila melanogaster]...   120   6e-27
gi|38048343|gb|AAR10074.1| similar to Drosophila melanogaster Vh...   119   1e-26
gi|31241599|ref|XP_321230.1| ENSANGP00000018502 [Anopheles gambi...   117   4e-26
gi|47205252|emb|CAG01695.1| unnamed protein product [Tetraodon n...   117   7e-26
gi|45751557|gb|AAH68023.1| ATP6V1G2 protein [Homo sapiens]            110   9e-24
gi|50750934|ref|XP_422192.1| PREDICTED: similar to ATPase, H+ tr...   106   1e-22
gi|27680617|ref|XP_213980.1| similar to ATPase, H+ transporting,...   103   1e-21
gi|28893577|ref|NP_796371.1| ATPase, H+ transporting, V1 subunit...   102   2e-21
gi|22655516|gb|AAN04090.1| V-ATPase G subunit [Clonorchis sinensis]   102   2e-21
gi|18959206|ref|NP_573569.1| ATPase, H+ transporting, lysosomal,...   101   4e-21
gi|13097720|gb|AAH03564.1| ATP6V1G1 protein [Homo sapiens]             99   2e-20
gi|49075848|ref|XP_401960.1| hypothetical protein UM04345.1 [Ust...    95   4e-19
gi|50257244|gb|EAL19953.1| hypothetical protein CNBF2800 [Crypto...    92   2e-18
gi|46434602|gb|EAK94006.1| hypothetical protein CaO19.1866 [Cand...    89   2e-17
gi|50757468|ref|XP_415525.1| PREDICTED: similar to Atp6v1g1-prov...    86   2e-16
gi|34871228|ref|XP_343879.1| similar to ATPase, H+ transporting,...    82   2e-15
gi|50425509|ref|XP_461348.1| unnamed protein product [Debaryomyc...    81   4e-15
gi|17529569|emb|CAC85693.1| lysosomal ATPase [Rattus norvegicus]       80   7e-15
gi|50287857|ref|XP_446358.1| unnamed protein product [Candida gl...    79   2e-14
gi|19113621|ref|NP_596829.1| vacuolar atp synthase subunit g [Sc...    74   5e-13
gi|34853437|ref|XP_347385.1| hypothetical protein XP_347384 [Rat...    74   5e-13
gi|32407973|ref|XP_324475.1| hypothetical protein [Neurospora cr...    73   2e-12
gi|6321829|ref|NP_011905.1| vacuolar H-ATPase 13 kDa subunit of ...    72   3e-12
gi|38344140|emb|CAE01820.2| OSJNBa0041A02.7 [Oryza sativa (japon...    70   1e-11
gi|45184748|ref|NP_982466.1| AAL076Wp [Eremothecium gossypii] >g...    68   5e-11
gi|34852162|ref|XP_342089.1| similar to vacuolar ATPase NG38 [Ra...    67   6e-11
gi|50305429|ref|XP_452674.1| unnamed protein product [Kluyveromy...    65   3e-10
gi|20357539|ref|NP_612139.1| ATPase, H+ transporting, lysosomal,...    65   4e-10
gi|49134719|ref|XP_413244.1| hypothetical protein AN9107.2 [Aspe...    65   4e-10
gi|15232110|ref|NP_186788.1| vacuolar ATP synthase subunit G 1 (...    63   1e-09
gi|6066455|emb|CAB58396.1| probable G subunit of vacuolar-type H...    63   2e-09
gi|11279179|pir||T51826 hypothetical protein vag2 [imported] - A...    60   8e-09
gi|12585428|sp|O82702|VAG1_TOBAC Vacuolar ATP synthase subunit G...    60   8e-09
gi|12585491|sp|Q9SP55|VATG_CITLI Vacuolar ATP synthase subunit G...    60   1e-08
gi|15236064|ref|NP_194325.1| vacuolar ATP synthase, putative / V...    60   1e-08
gi|15236587|ref|NP_194102.1| vacuolar ATP synthase subunit G 2 (...    60   1e-08
gi|12585429|sp|O82703|VAG2_TOBAC Vacuolar ATP synthase subunit G...    57   7e-08
gi|38104380|gb|EAA50957.1| hypothetical protein MG04716.4 [Magna...    56   1e-07
gi|7861924|gb|AAF70441.1| V-type ATPase subunit G-like protein [...    54   7e-07
gi|26986108|emb|CAD27444.1| vacuolar ATPase subunit G [Mesembrya...    53   1e-06
gi|15642761|ref|NP_232394.1| ATP synthase F0, B subunit [Vibrio ...    45   4e-04
gi|16116636|emb|CAC82708.1| TolA protein [Erwinia chrysanthemi]        44   7e-04
gi|28899847|ref|NP_799452.1| ATP synthase F0, B subunit [Vibrio ...    44   0.001
gi|114632|sp|P12989|ATPF_VIBAL ATP synthase B chain >gnl|BL_ORD_...    44   0.001
gi|23469343|ref|ZP_00124677.1| COG0711: F0F1-type ATP synthase, ...    43   0.001
gi|28829971|gb|AAO52461.1| similar to Plasmodium falciparum. Hyp...    43   0.002
gi|28872702|ref|NP_795321.1| ATP synthase F0, B subunit [Pseudom...    42   0.002
gi|15901571|ref|NP_346175.1| KH domain protein [Streptococcus pn...    42   0.002
gi|15903626|ref|NP_359176.1| Conserved hypothetical protein [Str...    42   0.002
gi|41052683|dbj|BAD07530.1| putative Vacuolar ATP synthase subun...    42   0.004
gi|23380405|gb|AAN17915.1| Erp42 protein [Borrelia burgdorferi]        41   0.005
gi|3560487|gb|AAC34955.1| ElpB1 [Borrelia burgdorferi]                 41   0.005
gi|4505101|ref|NP_003971.1| microtubule-associated protein 7 [Ho...    40   0.011
gi|19343694|gb|AAH25777.1| MAP7 protein [Homo sapiens]                 40   0.011
gi|20127150|ref|NP_061218.2| golgi autoantigen, golgin subfamily...    40   0.011
gi|7513666|pir||T14265 golgin-245 - mouse                              40   0.011
gi|46915089|emb|CAG21864.1| Putative AtpF, ATP synthase F0, B su...    40   0.011
gi|15600751|ref|NP_254245.1| ATP synthase B chain [Pseudomonas a...    40   0.011
gi|26992092|ref|NP_747517.1| ATP synthase F0, B subunit [Pseudom...    40   0.011
gi|24641414|ref|NP_572750.2| CG32662-PA [Drosophila melanogaster...    40   0.011
gi|32043133|ref|ZP_00140395.1| COG0711: F0F1-type ATP synthase, ...    40   0.011
gi|7581970|emb|CAB88030.1| E-MAP-115-95; epithelial microtubule-...    40   0.011
gi|31419321|gb|AAH53000.1| Golga4 protein [Mus musculus]               40   0.011
gi|15292193|gb|AAK93365.1| LD41932p [Drosophila melanogaster]          40   0.011
gi|7581985|emb|CAB88031.1| E-MAP-115-105; epithelial microtubule...    40   0.011
gi|49080382|gb|AAT50011.1| PA5558 [synthetic construct]                40   0.011
gi|16804571|ref|NP_466056.1| highly similar to H+-transporting A...    40   0.014
gi|50120311|ref|YP_049478.1| TolA protein [Erwinia carotovora su...    40   0.014
gi|15233360|ref|NP_192881.1| eukaryotic translation initiation f...    40   0.014
gi|50748620|ref|XP_421329.1| PREDICTED: similar to Golgi autoant...    39   0.018
gi|41581221|emb|CAE47870.1| RNA export mediator gle1 homologue, ...    39   0.018
gi|46908705|ref|YP_015094.1| ATP synthase F0, B subunit [Listeri...    39   0.018
gi|47096956|ref|ZP_00234532.1| ATP synthase F0, B subunit [Liste...    39   0.018
gi|6678948|ref|NP_032661.1| microtubule-associated protein 7 [Mu...    39   0.018
gi|30962907|gb|AAH52637.1| Mtap7 protein [Mus musculus]                39   0.018
gi|19115514|ref|NP_594602.1| putative eukaryotic translation ini...    39   0.018
gi|34907612|ref|NP_915153.1| P0696G06.24 [Oryza sativa (japonica...    39   0.018
gi|39597779|emb|CAE68471.1| Hypothetical protein CBG14270 [Caeno...    39   0.018
gi|38106657|gb|EAA52938.1| hypothetical protein MG06066.4 [Magna...    39   0.024
gi|33598301|ref|NP_885944.1| Proline-rich inner membrane protein...    39   0.024
gi|48731321|ref|ZP_00265066.1| COG0711: F0F1-type ATP synthase, ...    39   0.024
gi|40788346|dbj|BAA34461.2| KIAA0741 protein [Homo sapiens]            39   0.024
gi|20357544|ref|NP_579872.1| ATPase, H+ transporting, lysosomal,...    39   0.024
gi|50759764|ref|XP_417771.1| PREDICTED: similar to CDNA sequence...    39   0.024
gi|4322304|gb|AAD16006.1| translation initiation factor IF2 [Hom...    39   0.024
gi|14195666|sp|O60841|IF2P_HUMAN Eukaryotic translation initiati...    39   0.024
gi|21619657|gb|AAH32639.1| Translation initiation factor IF2 [Ho...    39   0.024
gi|5002645|emb|CAB44357.1| IF2 protein [Homo sapiens]                  39   0.024
gi|15451892|ref|NP_056988.2| translation initiation factor IF2 [...    39   0.024
gi|11360327|pir||T43483 translation initiation factor IF-2 homol...    39   0.024
gi|50257635|gb|EAL20340.1| hypothetical protein CNBF1510 [Crypto...    39   0.032
gi|14044070|gb|AAH07957.1| Chromosome 20 open reading frame 116 ...    39   0.032
gi|13027602|ref|NP_076424.1| chromosome 20 open reading frame 11...    39   0.032
gi|48786687|ref|ZP_00282821.1| COG0810: Periplasmic protein TonB...    39   0.032
gi|24474867|emb|CAD55940.1| dJ1187M17.3.4 (novel protein, varian...    39   0.032
gi|2133394|pir||S61535 nucleotide-binding head-stalk protein 183...    38   0.041
gi|29248170|gb|EAA39711.1| GLP_741_55154_50292 [Giardia lamblia ...    38   0.041
gi|46440978|gb|EAL00279.1| hypothetical protein CaO19.5612 [Cand...    38   0.041
gi|46226717|gb|EAK87696.1| large low complexity coiled coil prot...    38   0.041
gi|31746635|gb|AAP68941.1| Troponin t protein 2, isoform a [Caen...    38   0.041
gi|16801738|ref|NP_472006.1| highly similar to H+-transporting A...    38   0.041
gi|46441098|gb|EAL00398.1| hypothetical protein CaO19.13055 [Can...    38   0.041
gi|17568063|ref|NP_509479.1| troponin T (tnt-2) [Caenorhabditis ...    38   0.041
gi|50555876|ref|XP_505346.1| hypothetical protein [Yarrowia lipo...    38   0.041
gi|39584297|emb|CAE65461.1| Hypothetical protein CBG10426 [Caeno...    38   0.041
gi|13938657|gb|AAH07485.1| Golga4 protein [Mus musculus]               38   0.041
gi|6319994|ref|NP_010074.1| Cytoplasmic nucleoporin required for...    38   0.054
gi|49115503|gb|AAH73415.1| Unknown (protein for MGC:80881) [Xeno...    38   0.054
gi|19074574|ref|NP_586080.1| similarity to ribosomal protein L5 ...    38   0.054
gi|11497062|ref|NP_051200.1| ErpB [Borrelia burgdorferi B31] >gn...    37   0.070
gi|2627270|gb|AAC45969.1| ErpJ [Borrelia burgdorferi]                  37   0.070
gi|29293815|ref|NP_808790.1| slinky [Rattus norvegicus] >gnl|BL_...    37   0.070
gi|47214148|emb|CAG07925.1| unnamed protein product [Tetraodon n...    37   0.070
gi|21227896|ref|NP_633818.1| hypothetical protein MM1794 [Methan...    37   0.070
gi|50556618|ref|XP_505717.1| hypothetical protein [Yarrowia lipo...    37   0.070
gi|33603211|ref|NP_890771.1| Proline-rich inner membrane protein...    37   0.070
gi|13445027|emb|CAC34942.1| apolipoprotein A-I [Cyprinus carpio]       37   0.070
gi|49069258|ref|XP_398918.1| hypothetical protein UM01303.1 [Ust...    37   0.092
gi|47209457|emb|CAF92436.1| unnamed protein product [Tetraodon n...    37   0.092
gi|45184950|ref|NP_982668.1| AAR126Wp [Eremothecium gossypii] >g...    37   0.092
gi|42780752|ref|NP_977999.1| penicillin-binding protein [Bacillu...    37   0.092
gi|39593526|emb|CAE61818.1| Hypothetical protein CBG05788 [Caeno...    37   0.092
gi|28897833|ref|NP_797438.1| TolA protein [Vibrio parahaemolytic...    37   0.092
gi|15641839|ref|NP_231471.1| tolA protein [Vibrio cholerae O1 bi...    37   0.092
gi|49256476|gb|AAH74138.1| Unknown (protein for IMAGE:7008480) [...    37   0.092
gi|37076965|sp|Q80WW9|CTB6_MOUSE Protein C20orf116 homolog precu...    37   0.092
gi|7305095|ref|NP_038775.1| golgi autoantigen, golgin subfamily ...    37   0.092
gi|6649910|gb|AAF21628.1| Sumiko [Mus musculus]                        37   0.092
gi|23619293|ref|NP_705255.1| reticulocyte binding protein 2 homo...    37   0.12
gi|47564949|ref|ZP_00235993.1| hypothetical protein protein [Bac...    37   0.12
gi|13345187|gb|AAK19244.1| reticulocyte binding protein 2 homolo...    37   0.12
gi|2541916|dbj|BAA22853.1| troponin I [Mizuhopecten yessoensis]        37   0.12
gi|30185897|gb|AAH51541.1| 2600009E05Rik protein [Mus musculus]        37   0.12
gi|2541914|dbj|BAA22852.1| troponin I [Mizuhopecten yessoensis]        37   0.12
gi|7511729|pir||JE0233 troponin-I - scallop (Chlamys nipponensis)      37   0.12
gi|47117348|sp|Q7M3Y3|TRI_CHLNI Troponin I (TnI)                       37   0.12
gi|2668408|dbj|BAA23775.1| troponin I [Chlamys nipponensis akazara]    37   0.12
gi|13540714|ref|NP_071796.1| plectin [Rattus norvegicus] >gnl|BL...    37   0.12
gi|34858705|ref|XP_215848.2| similar to chromosome 20 open readi...    37   0.12
gi|437639|gb|AAA72295.1| [Plasmodium falciparum 3' end.], gene p...    37   0.12
gi|37183096|gb|AAQ89348.1| VGPW2523 [Homo sapiens]                     37   0.12
gi|29387027|gb|AAH48220.1| LOC398587 protein [Xenopus laevis]          37   0.12
gi|37680892|ref|NP_935501.1| translation initiation factor 2 [Vi...    37   0.12
gi|27365057|ref|NP_760585.1| Translation initiation factor 2 [Vi...    37   0.12
gi|627059|pir||A45592 liver stage antigen LSA-1 - malaria parasi...    37   0.12
gi|33413776|gb|AAN39446.1| normocyte binding protein 2a [Plasmod...    36   0.16
gi|33413782|gb|AAN39444.1| normocyte binding protein 2a [Plasmod...    36   0.16
gi|38049524|ref|XP_286972.2| similar to KIAA2012 protein [Mus mu...    36   0.16
gi|33413774|gb|AAN39445.1| normocyte binding protein 2a [Plasmod...    36   0.16
gi|39104508|dbj|BAC65744.3| mKIAA1187 protein [Mus musculus]           36   0.16
gi|38106967|gb|EAA53202.1| hypothetical protein MG07479.4 [Magna...    36   0.16
gi|50291675|ref|XP_448270.1| unnamed protein product [Candida gl...    36   0.16
gi|39581674|emb|CAE57182.1| Hypothetical protein CBG00021 [Caeno...    36   0.16
gi|38078938|ref|XP_131769.3| RIKEN cDNA 2900090M10 [Mus musculus]      36   0.16
gi|631623|pir||S44095 intermediate filament-associated protein -...    36   0.16
gi|32403026|ref|XP_322126.1| hypothetical protein [Neurospora cr...    36   0.16
gi|39595259|emb|CAE60296.1| Hypothetical protein CBG03880 [Caeno...    36   0.16
gi|25148570|ref|NP_740973.1| M protein repeat containing protein...    36   0.16
gi|23508398|ref|NP_701067.1| hypothetical protein [Plasmodium fa...    36   0.16
gi|32403722|ref|XP_322474.1| hypothetical protein [Neurospora cr...    36   0.16
gi|50255797|gb|EAL18529.1| hypothetical protein CNBJ1710 [Crypto...    36   0.16
gi|23479661|gb|EAA16427.1| hypothetical protein [Plasmodium yoel...    36   0.20
gi|50730570|ref|XP_425582.1| PREDICTED: similar to Eukaryotic tr...    36   0.20
gi|41281453|ref|NP_055535.2| serine/threonine kinase 2; Ste20-li...    36   0.20
gi|49070144|ref|XP_399361.1| hypothetical protein UM01746.1 [Ust...    36   0.20
gi|47226007|emb|CAG04381.1| unnamed protein product [Tetraodon n...    36   0.20
gi|37805251|gb|AAH60288.1| BC018347 protein [Mus musculus]             36   0.20
gi|31542192|ref|NP_659190.2| cDNA sequence BC019977 [Mus musculu...    36   0.20
gi|27371004|gb|AAH40746.1| BC018347 protein [Mus musculus]             36   0.20
gi|46437637|gb|EAK96980.1| hypothetical protein CaO19.9753 [Cand...    36   0.20
gi|41322919|ref|NP_958784.1| plectin 1 isoform 8; hemidesmosomal...    36   0.20
gi|16359231|gb|AAH16081.1| BC019977 protein [Mus musculus]             36   0.20
gi|41322923|ref|NP_958786.1| plectin 1 isoform 11; hemidesmosoma...    36   0.20
gi|4868447|gb|AAD31321.1| osteoblast translation factor 3F [Gall...    36   0.20
gi|41322916|ref|NP_958782.1| plectin 1 isoform 6; hemidesmosomal...    36   0.20
gi|21324891|dbj|BAB99514.1| Hypothetical protein [Corynebacteriu...    36   0.20
gi|28828775|gb|AAO51370.1| similar to Dictyostelium discoideum (...    36   0.20
gi|32422361|ref|XP_331624.1| predicted protein [Neurospora crass...    36   0.20
gi|28899230|ref|NP_798835.1| initiation factor IF-2 [Vibrio para...    36   0.20
gi|41322910|ref|NP_958783.1| plectin 1 isoform 7; hemidesmosomal...    36   0.20
gi|41322912|ref|NP_958780.1| plectin 1 isoform 2; hemidesmosomal...    36   0.20
gi|18043435|gb|AAH19977.1| BC019977 protein [Mus musculus]             36   0.20
gi|15237622|ref|NP_198947.1| kinesin motor protein-related [Arab...    36   0.20
gi|41322908|ref|NP_958781.1| plectin 1 isoform 3; hemidesmosomal...    36   0.20
gi|9588136|emb|CAC00587.1| bA16H23.1.2 (protein kinase KIAA0204 ...    36   0.20
gi|41322914|ref|NP_958785.1| plectin 1 isoform 10; hemidesmosoma...    36   0.20
gi|19553320|ref|NP_601322.1| hypothetical protein NCgl2040 [Cory...    36   0.20
gi|47607492|ref|NP_000436.2| plectin 1 isoform 1; hemidesmosomal...    36   0.20
gi|7442004|pir||G02520 plectin - human >gnl|BL_ORD_ID|215627 gi|...    36   0.20
gi|24580684|ref|NP_608540.1| CG2839-PA [Drosophila melanogaster]...    35   0.27
gi|24620453|gb|AAN61517.1| 2MDa_1 protein [Caenorhabditis elegans]     35   0.27
gi|28574125|ref|NP_788028.1| CG32955-PE [Drosophila melanogaster...    35   0.27
gi|6942203|gb|AAF32356.1| mitotic kinesin-like motor protein CEN...    35   0.27
gi|7022325|dbj|BAA91557.1| unnamed protein product [Homo sapiens...    35   0.27
gi|23508159|ref|NP_700829.1| liver stage antigen, putative [Plas...    35   0.27
gi|15021829|dbj|BAB62195.1| hypothetical protein [Macaca fascicu...    35   0.27
gi|13508049|ref|NP_109998.1| Cytadherence High Molecular Weight ...    35   0.27
gi|17550052|ref|NP_508635.1| M protein repeat containing protein...    35   0.27
gi|33944865|ref|XP_340580.1| conserved/hypothetical protein [Try...    35   0.27
gi|32406360|ref|XP_323793.1| predicted protein [Neurospora crass...    35   0.27
gi|42559485|sp|Q8MUF6|MYSP_BLOTA Paramyosin (Allergen Blo t 11) ...    35   0.27
gi|20521788|dbj|BAA86501.2| KIAA1187 protein [Homo sapiens]            35   0.27
gi|45501333|gb|AAH67256.1| FLJ10350 protein [Homo sapiens]             35   0.27
gi|30021331|ref|NP_832962.1| surface protein [Bacillus cereus AT...    35   0.27
gi|34871032|ref|XP_238415.2| similar to CDNA sequence BC019977 [...    35   0.27
gi|9633056|ref|NP_050164.1| hypothetical protein phiadhp56 [Lact...    35   0.27
gi|21755300|dbj|BAC04654.1| unnamed protein product [Homo sapiens]     35   0.27
gi|24620455|gb|AAN61519.1| 1MDa_1 protein [Caenorhabditis elegans]     35   0.27
gi|18848204|gb|AAH24178.1| FLJ10094 protein [Homo sapiens]             35   0.27
gi|8922227|ref|NP_060463.1| hypothetical protein FLJ10094 [Homo ...    35   0.27
gi|15669074|ref|NP_247879.1| activator 1 (replication factor C),...    35   0.27
gi|21361781|ref|NP_060537.2| hypothetical protein FLJ10350 [Homo...    35   0.27
gi|24620454|gb|AAN61518.1| 2MDa_2 protein [Caenorhabditis elegans]     35   0.27
gi|7514128|pir||T18532 serine/threoine protein kinase - guinea p...    35   0.27
gi|47087361|ref|NP_998576.1| zgc:66400 [Danio rerio] >gnl|BL_ORD...    35   0.27
gi|49481763|ref|YP_037329.1| surface protein, LPXTG-motif cell w...    35   0.27
gi|20070746|gb|AAH27334.1| Unknown (protein for IMAGE:4389857) [...    35   0.27
gi|21401137|ref|NP_657122.1| V_ATPase_sub_a, V-type ATPase 116kD...    35   0.27
gi|38109002|gb|EAA54936.1| hypothetical protein MG05727.4 [Magna...    35   0.35
gi|45384060|ref|NP_990605.1| MHC mRNA [Gallus gallus] >gnl|BL_OR...    35   0.35
gi|32565466|ref|NP_872036.1| putative protein family member, wit...    35   0.35
gi|3915778|sp|P10587|MYHB_CHICK Myosin heavy chain, gizzard smoo...    35   0.35
gi|9507155|ref|NP_062222.1| serine/threonine kinase 2; STE20-lik...    35   0.35
gi|11558044|emb|CAC17732.1| FYVE-finger containing protein [Mus ...    35   0.35
gi|24585071|ref|NP_609917.2| CG18397-PA [Drosophila melanogaster...    35   0.35
gi|402610|emb|CAA52452.1| SMY2 [Saccharomyces cerevisiae]              35   0.35
gi|13786876|pdb|1I84|S Chain S, Cryo-Em Structure Of The Heavy M...    35   0.35
gi|44680105|ref|NP_149129.2| caldesmon 1 isoform 1 [Homo sapiens]      35   0.35
gi|32565468|ref|NP_872037.1| putative protein family member, wit...    35   0.35
gi|50424713|ref|XP_460946.1| unnamed protein product [Debaryomyc...    35   0.35
gi|50754341|ref|XP_414339.1| PREDICTED: similar to RIKEN cDNA E2...    35   0.35
gi|510184|emb|CAA82975.1| liver stage antigen-1 [Plasmodium falc...    35   0.35
gi|23956178|ref|NP_080666.1| UBX domain containing 2 [Mus muscul...    35   0.35
gi|46105599|ref|XP_380558.1| hypothetical protein FG00382.1 [Gib...    35   0.35
gi|26344511|dbj|BAC35906.1| unnamed protein product [Mus musculus]     35   0.35
gi|34852808|ref|XP_214968.2| similar to microtubule-associated p...    35   0.35
gi|31242801|ref|XP_321831.1| ENSANGP00000020333 [Anopheles gambi...    35   0.35
gi|42784018|ref|NP_981265.1| S-layer homology domain protein [Ba...    35   0.35
gi|45603|emb|CAA46896.1| ATPase b subunit [Propionigenium modest...    35   0.35
gi|26338251|dbj|BAC32811.1| unnamed protein product [Mus musculus]     35   0.35
gi|17534411|ref|NP_495175.1| putative protein family member, wit...    35   0.35
gi|417787|sp|P32909|SMY2_YEAST SMY2 protein >gnl|BL_ORD_ID|13425...    35   0.35
gi|26341772|dbj|BAC34548.1| unnamed protein product [Mus musculus]     35   0.35
gi|34872438|ref|XP_233613.2| similar to KIAA1937 protein [Rattus...    35   0.35
gi|17534413|ref|NP_495176.1| putative protein family member, wit...    35   0.35
gi|27369788|ref|NP_766145.1| RUN and FYVE domain containing 1; F...    35   0.35
gi|49093738|ref|XP_408330.1| hypothetical protein AN4193.2 [Aspe...    35   0.35
gi|18858189|ref|NP_572495.1| CG12109-PB [Drosophila melanogaster...    35   0.35
gi|37362621|ref|NP_009731.2| partial suppressor of myo2-66; Smy2...    35   0.35
gi|34866279|ref|XP_345696.1| similar to RIKEN cDNA 1700025B16 [R...    35   0.35
gi|42782320|ref|NP_979567.1| LPXTG-motif cell wall anchor domain...    35   0.35
gi|46125725|ref|XP_387416.1| hypothetical protein FG07240.1 [Gib...    35   0.35
gi|231608|sp|P21904|ATPF_PROMO ATP synthase B chain, sodium ion ...    35   0.35
gi|40849906|gb|AAR95665.1| plectin 11 [Rattus norvegicus]              35   0.45
gi|40849900|gb|AAR95662.1| plectin 8 [Rattus norvegicus]               35   0.45
gi|41322925|ref|NP_958787.1| plectin 1 isoform 2 [Mus musculus] ...    35   0.45
gi|17137546|ref|NP_477358.1| CG8200-PA [Drosophila melanogaster]...    35   0.45
gi|39596989|emb|CAE59216.1| Hypothetical protein CBG02531 [Caeno...    35   0.45
gi|47217186|emb|CAG11022.1| unnamed protein product [Tetraodon n...    35   0.45
gi|41322931|ref|NP_958791.1| plectin 1 isoform 6 [Mus musculus] ...    35   0.45
gi|22095371|ref|NP_079434.2| RUN and FYVE domain-containing 1 [H...    35   0.45
gi|41322904|ref|NP_035247.1| plectin 1 isoform 1 [Mus musculus] ...    35   0.45
gi|39585211|emb|CAE57454.1| Hypothetical protein CBG00418 [Caeno...    35   0.45
gi|41322927|ref|NP_958789.1| plectin 1 isoform 4 [Mus musculus] ...    35   0.45
gi|37680460|ref|NP_935069.1| outer membrane integrity protein To...    35   0.45
gi|40849898|gb|AAR95661.1| plectin 7 [Rattus norvegicus]               35   0.45
gi|40849904|gb|AAR95664.1| plectin 10 [Rattus norvegicus]              35   0.45
gi|32455302|ref|NP_862652.1| ORF29/ElpB2 [Borrelia burgdorferi] ...    35   0.45
gi|2498204|sp|Q05682|CALD_HUMAN Caldesmon (CDM) >gnl|BL_ORD_ID|3...    35   0.45
gi|33340133|gb|AAQ14554.1| La binding protein 1 [Homo sapiens]         35   0.45
gi|34868040|ref|XP_239866.2| similar to myosin [Rattus norvegicus]     35   0.45
gi|47223994|emb|CAG06171.1| unnamed protein product [Tetraodon n...    35   0.45
gi|41322941|ref|NP_958796.1| plectin 1 isoform 11 [Mus musculus]...    35   0.45
gi|41322935|ref|NP_958793.1| plectin 1 isoform 8 [Mus musculus] ...    35   0.45
gi|41322921|ref|NP_958788.1| plectin 1 isoform 3 [Mus musculus] ...    35   0.45
gi|41322933|ref|NP_958792.1| plectin 1 isoform 7 [Mus musculus] ...    35   0.45
gi|30019697|ref|NP_831328.1| Multimodular transpeptidase-transgl...    35   0.45
gi|38077811|ref|XP_128277.4| similar to plectin [Mus musculus]         35   0.45
gi|26332288|dbj|BAC29874.1| unnamed protein product [Mus musculus]     35   0.45
gi|24653894|ref|NP_725476.1| CG8200-PB [Drosophila melanogaster]...    35   0.45
gi|41281376|ref|NP_005145.2| ubiquitin specific protease 8 [Homo...    35   0.45
gi|34856699|ref|XP_230468.2| similar to RIKEN cDNA 1700025B16 [R...    35   0.45
gi|2367400|gb|AAB69637.1| GrfA [Dictyostelium discoideum]              35   0.45
gi|41322939|ref|NP_958795.1| plectin 1 isoform 10 [Mus musculus]...    35   0.45
gi|46229652|gb|EAK90470.1| hypothetical low complexity protein w...    35   0.45
gi|50552318|ref|XP_503569.1| hypothetical protein [Yarrowia lipo...    35   0.45
gi|40849896|gb|AAR95660.1| plectin 6 [Rattus norvegicus]               35   0.45
gi|40849892|gb|AAR95658.1| plectin 4 [Rattus norvegicus] >gnl|BL...    35   0.45
gi|4741823|gb|AAD28717.1| Ste20-related kinase SMAK [Mus musculus]     35   0.45
gi|28972093|dbj|BAC65500.1| mKIAA0204 protein [Mus musculus]           35   0.45
gi|40849888|gb|AAR95656.1| plectin 2 [Rattus norvegicus]               35   0.45
gi|40849890|gb|AAR95657.1| plectin 3 [Rattus norvegicus]               35   0.45
gi|40849886|gb|AAR95655.1| plectin 1 [Rattus norvegicus]               35   0.45
gi|27365499|ref|NP_761027.1| TolA protein [Vibrio vulnificus CMC...    35   0.45
gi|15677248|ref|NP_274401.1| hypothetical protein NMB1387 [Neiss...    35   0.45
gi|50548923|ref|XP_501932.1| hypothetical protein [Yarrowia lipo...    34   0.59
gi|31235836|ref|XP_319308.1| ENSANGP00000012555 [Anopheles gambi...    34   0.59
gi|39590935|emb|CAE58715.1| Hypothetical protein CBG01900 [Caeno...    34   0.59
gi|26326305|dbj|BAC26896.1| unnamed protein product [Mus musculus]     34   0.59
gi|19551881|ref|NP_599883.1| flotillin-like protein [Corynebacte...    34   0.59
gi|50292427|ref|XP_448646.1| unnamed protein product [Candida gl...    34   0.59
gi|15602624|ref|NP_245696.1| InfB [Pasteurella multocida Pm70] >...    34   0.59
gi|49095256|ref|XP_409089.1| hypothetical protein AN4952.2 [Aspe...    34   0.59
gi|510186|emb|CAA82974.1| liver stage antigen-1 [Plasmodium falc...    34   0.59
gi|15644749|ref|NP_206919.1| hypothetical protein HP0119 [Helico...    34   0.59
gi|40445432|gb|AAR85899.1| Hypothetical protein Y102A11A.2b [Cae...    34   0.59
gi|31235874|ref|XP_319314.1| ENSANGP00000022367 [Anopheles gambi...    34   0.59
gi|41019057|gb|AAR98500.1| ATP synthase B subunit [Pasteuria pen...    34   0.59
gi|31235852|ref|XP_319311.1| ENSANGP00000022605 [Anopheles gambi...    34   0.59
gi|50545281|ref|XP_500178.1| hypothetical protein [Yarrowia lipo...    34   0.59
gi|27374294|gb|AAO01046.1| CG11915-PA [Drosophila pseudoobscura]       34   0.59
gi|47219686|emb|CAG12608.1| unnamed protein product [Tetraodon n...    34   0.59
gi|39582082|emb|CAE63725.1| Hypothetical protein CBG08250 [Caeno...    34   0.59
gi|31235859|ref|XP_319312.1| ENSANGP00000025304 [Anopheles gambi...    34   0.59
gi|29247103|gb|EAA38676.1| GLP_516_1567_2961 [Giardia lamblia AT...    34   0.59
gi|32423105|ref|XP_331990.1| hypothetical protein [Neurospora cr...    34   0.59
gi|40789062|dbj|BAA06225.2| KIAA0055 [Homo sapiens]                    34   0.59
gi|26337331|dbj|BAC32351.1| unnamed protein product [Mus musculus]     34   0.59
gi|17570541|ref|NP_508373.1| putative protein, with a coiled coi...    34   0.59
gi|38086943|ref|XP_136135.2| RIKEN cDNA 5330432J06 [Mus musculus]      34   0.59
gi|31206247|ref|XP_312075.1| ENSANGP00000016767 [Anopheles gambi...    34   0.59
gi|3834586|gb|AAC71019.1| Partner of Numb [Drosophila melanogaster]    34   0.59
gi|7687925|emb|CAB89605.1| hypothetical protein L1177.03 [Leishm...    34   0.59
gi|23508384|ref|NP_701053.1| hypothetical protein [Plasmodium fa...    34   0.59
gi|731046|sp|P40818|UBP8_HUMAN Ubiquitin carboxyl-terminal hydro...    34   0.59
gi|31235848|ref|XP_319310.1| ENSANGP00000024621 [Anopheles gambi...    34   0.59
gi|31235842|ref|XP_319309.1| ENSANGP00000024129 [Anopheles gambi...    34   0.59
gi|6678571|ref|NP_033536.1| villin 2 [Mus musculus] >gnl|BL_ORD_...    34   0.59
gi|31235868|ref|XP_319313.1| ENSANGP00000023782 [Anopheles gambi...    34   0.59
gi|14195008|sp|Q9JI55|PLE1_CRIGR Plectin 1 (PLTN) (PCN) (300-kDa...    34   0.59
gi|31235881|ref|XP_319315.1| ENSANGP00000024583 [Anopheles gambi...    34   0.59
gi|47219280|emb|CAG11742.1| unnamed protein product [Tetraodon n...    34   0.59
gi|34867583|ref|XP_216765.2| similar to RET-II [Rattus norvegicus]     34   0.59
gi|31235885|ref|XP_319316.1| ENSANGP00000023510 [Anopheles gambi...    34   0.59
gi|28571201|ref|NP_788907.1| CG33206-PA [Drosophila melanogaster...    34   0.78
gi|17559578|ref|NP_504584.1| immunoglobulin-like and fibronectin...    34   0.78
gi|13173388|gb|AAK14386.1| lysine/glutamic acid-rich protein [Ca...    34   0.78
gi|46431250|gb|EAK90848.1| hypothetical protein CaO19.2629 [Cand...    34   0.78
gi|22758136|ref|NP_689993.1| hypothetical protein FLJ14503 [Homo...    34   0.78
gi|12963353|gb|AAK11226.1| fenestrated-endothelial linked struct...    34   0.78
gi|48133166|ref|XP_393334.1| similar to myosin heavy chain 2, mu...    34   0.78
gi|13775238|ref|NP_112600.1| plasmalemma vesicle associated prot...    34   0.78
gi|20807074|ref|NP_622245.1| hypothetical protein [Thermoanaerob...    34   0.78
gi|21740019|emb|CAD39027.1| hypothetical protein [Homo sapiens]        34   0.78
gi|50545271|ref|XP_500173.1| hypothetical protein [Yarrowia lipo...    34   0.78
gi|50757442|ref|XP_425338.1| PREDICTED: similar to cis-Golgi mat...    34   0.78
gi|34335083|gb|AAQ65047.1| IKKgamma [Drosophila yakuba]                34   0.78
gi|39582764|emb|CAE74227.1| Hypothetical protein CBG21911 [Caeno...    34   0.78
gi|39594954|emb|CAE70822.1| Hypothetical protein CBG17593 [Caeno...    34   0.78
gi|114630|sp|P09221|ATPF_BACP3 ATP synthase B chain precursor >g...    34   0.78
gi|127751|sp|P02567|MYSD_CAEEL Myosin heavy chain D (MHC D) >gnl...    34   0.78
gi|7498955|pir||T34418 hypothetical protein F12F3.3 - Caenorhabd...    34   0.78
gi|17508449|ref|NP_492053.1| MYOsin heavy chain structural gene,...    34   0.78
gi|50418459|gb|AAH78406.1| Unknown (protein for MGC:91999) [Dani...    34   0.78
gi|477266|pir||A48467 myosin heavy chain - nematode (Brugia mala...    34   0.78
gi|15839147|ref|NP_299835.1| chromosome segregation protein [Xyl...    34   0.78
gi|30047727|gb|AAH50365.1| PLVAP protein [Homo sapiens]                34   0.78
gi|47564442|ref|ZP_00235487.1| putative surface/cell-adhesion pr...    34   0.78
gi|14195007|sp|Q15149|PLE1_HUMAN Plectin 1 (PLTN) (PCN) (Hemides...    34   0.78
gi|40225999|gb|AAH37165.1| FLJ14503 protein [Homo sapiens]             34   0.78
gi|32423201|ref|XP_332038.1| predicted protein [Neurospora crass...    34   0.78
gi|50419029|ref|XP_458036.1| unnamed protein product [Debaryomyc...    34   0.78
gi|17508909|ref|NP_492440.1| FAS1 like (55.8 kD) (1J654) [Caenor...    34   0.78
gi|42559523|sp|Q9BMM8|MYSP_SARSC Paramyosin >gnl|BL_ORD_ID|66920...    34   0.78
gi|48103366|ref|XP_395558.1| similar to CG15792-PA [Apis mellifera]    34   0.78
gi|552070|gb|AAA28120.1| myosin I                                      34   0.78
gi|22299122|ref|NP_682369.1| ORF_ID:tll1579~hypothetical protein...    34   0.78
gi|47212043|emb|CAF92645.1| unnamed protein product [Tetraodon n...    34   0.78
gi|34903276|ref|NP_912985.1| unnamed protein product [Oryza sati...    34   0.78
gi|27462846|gb|AAO15612.1| paramyosin [Sarcoptes scabiei type ho...    34   0.78
gi|28828225|gb|AAO50902.1| hypothetical protein [Dictyostelium d...    34   0.78
gi|28571203|ref|NP_788908.1| CG33206-PB [Drosophila melanogaster...    34   0.78
gi|24639713|ref|NP_525072.2| CG3346-PA [Drosophila melanogaster]...    34   0.78
gi|1708493|sp|P53352|INCE_CHICK Inner centromere protein >gnl|BL...    34   0.78
gi|34866291|ref|XP_229690.2| similar to RIKEN cDNA 1700025B16 [R...    34   0.78
gi|232266|sp|P29556|HMAA_SCHGR Homeobox protein abdominal-A homo...    34   0.78
gi|7106427|ref|NP_033315.1| STE20-like kinase; Ste20-related kin...    33   1.0
gi|28436771|gb|AAH46691.1| Smc1l1-prov protein [Xenopus laevis]        33   1.0
gi|103256|pir||A35815 myosin heavy chain 1, muscle - fruit fly (...    33   1.0
gi|24584714|ref|NP_724009.1| CG17927-PL [Drosophila melanogaster...    33   1.0
gi|103258|pir||B35815 myosin heavy chain 2, muscle - fruit fly (...    33   1.0
gi|24584716|ref|NP_724010.1| CG17927-PM [Drosophila melanogaster...    33   1.0
gi|24584712|ref|NP_724008.1| CG17927-PK [Drosophila melanogaster...    33   1.0
gi|46128951|ref|ZP_00154685.2| COG3264: Small-conductance mechan...    33   1.0
gi|103260|pir||D35815 myosin heavy chain 4, muscle - fruit fly (...    33   1.0
gi|103259|pir||C35815 myosin heavy chain 3, muscle - fruit fly (...    33   1.0
gi|2546937|emb|CAA37309.1| muscle myosin heavy chain [Drosophila...    33   1.0
gi|19746557|ref|NP_607693.1| conserved hypothetical protein [Str...    33   1.0
gi|15675508|ref|NP_269682.1| conserved hypothetical protein [Str...    33   1.0
gi|1828|emb|CAA35992.1| trichohyalin [Ovis sp.]                        33   1.0
gi|15677768|ref|NP_274932.1| ATP synthase F0, B subunit [Neisser...    33   1.0
gi|24899188|dbj|BAC23108.1| KIAA2012 protein [Homo sapiens]            33   1.0
gi|37725922|gb|AAO38039.1| reticulocyte binding-like protein 2b ...    33   1.0
gi|28850410|gb|AAL92314.2| hypothetical protein [Dictyostelium d...    33   1.0
gi|42524115|ref|NP_969495.1| hypothetical protein predicted by G...    33   1.0
gi|12230855|sp|Q99543|ZRF1_HUMAN Zuotin related factor-1 (M-phas...    33   1.0
gi|47221242|emb|CAG13178.1| unnamed protein product [Tetraodon n...    33   1.0
gi|50258198|gb|EAL20892.1| hypothetical protein CNBE2530 [Crypto...    33   1.0
gi|34880553|ref|XP_228973.2| similar to hypothetical protein FLJ...    33   1.0
gi|18076211|emb|CAC81063.1| Lamin [Molgula oculata]                    33   1.0
gi|24584698|ref|NP_724002.1| CG17927-PJ [Drosophila melanogaster...    33   1.0
gi|50419271|ref|XP_458159.1| unnamed protein product [Debaryomyc...    33   1.0
gi|39593040|emb|CAE64509.1| Hypothetical protein CBG09244 [Caeno...    33   1.0
gi|17386168|gb|AAL38630.1| vimentin [Daboia russellii]                 33   1.0
gi|1770454|emb|CAA66913.1| M-phase phosphoprotein 11 [Homo sapiens]    33   1.0
gi|15924276|ref|NP_371810.1| conserved hypothetical protein [Sta...    33   1.0
gi|586122|sp|P22793|TRHY_SHEEP Trichohyalin >gnl|BL_ORD_ID|21738...    33   1.0
gi|29732252|ref|XP_291020.1| similar to KIAA2012 protein [Homo s...    33   1.0
gi|50745053|ref|XP_419962.1| PREDICTED: similar to SMC6 protein ...    33   1.0
gi|24643485|ref|NP_608388.1| CG11734-PB [Drosophila melanogaster...    33   1.0
gi|45478170|gb|AAS66256.1| LRRGT00165 [Rattus norvegicus]              33   1.0
gi|9588137|emb|CAC00588.1| bA16H23.1.1 (protein kinase KIAA0204 ...    33   1.0
gi|482280|pir||A32491 myosin heavy chain 1, muscle - fruit fly (...    33   1.0
gi|48130462|ref|XP_396665.1| similar to hypothetical protein [Ap...    33   1.0
gi|38047743|gb|AAR09774.1| similar to Drosophila melanogaster Mh...    33   1.0
gi|482955|pir||B32491 myosin heavy chain 2, muscle - fruit fly (...    33   1.0
gi|159333|gb|AAA20179.1| glycoprotein 96-92                            33   1.0
gi|4456475|emb|CAB36967.1| rfg5 protein [Homo sapiens]                 33   1.0
gi|24584702|ref|NP_724004.1| CG17927-PD [Drosophila melanogaster...    33   1.0
gi|28574239|ref|NP_523587.4| CG17927-PH [Drosophila melanogaster...    33   1.0
gi|20455497|sp|P05661|MYSA_DROME Myosin heavy chain, muscle            33   1.0
gi|24584706|ref|NP_724006.1| CG17927-PI [Drosophila melanogaster...    33   1.0
gi|42733836|gb|AAS38754.1| hypothetical protein [Dictyostelium d...    33   1.0
gi|24584694|ref|NP_724000.1| CG17927-PG [Drosophila melanogaster...    33   1.0
gi|50742710|ref|XP_419726.1| PREDICTED: similar to Mtap7 protein...    33   1.0
gi|24584700|ref|NP_724003.1| CG17927-PF [Drosophila melanogaster...    33   1.0
gi|24584692|ref|NP_723999.1| CG17927-PC [Drosophila melanogaster...    33   1.0
gi|157892|gb|AAA28687.1| myosin heavy chain                            33   1.0
gi|11276953|pir||A59294 skeletal myosin - nematode (Onchocerca v...    33   1.0
gi|24584696|ref|NP_724001.1| CG17927-PE [Drosophila melanogaster...    33   1.0
gi|157891|gb|AAA28686.1| myosin heavy chain                            33   1.0
gi|24584704|ref|NP_724005.1| CG17927-PA [Drosophila melanogaster...    33   1.0
gi|24584710|ref|NP_724007.1| CG17927-PB [Drosophila melanogaster...    33   1.0
gi|1216293|gb|AAA91763.1| cardiac tropomyosin                          33   1.0
gi|48106436|ref|XP_393062.1| similar to ENSANGP00000005190 [Apis...    33   1.0
gi|21489935|ref|NP_058654.1| keratin complex 1, acidic, gene 14;...    33   1.0
gi|6752395|gb|AAF27708.1| PspA [Streptococcus pneumoniae]              33   1.0
gi|30260188|ref|NP_005104.2| Golgi autoantigen, golgin subfamily...    33   1.0
gi|40788907|dbj|BAA13195.2| KIAA0204 protein [Homo sapiens]            33   1.0
gi|18606388|gb|AAH23021.1| Golgi autoantigen, golgin subfamily a...    33   1.0
gi|32469749|sp|Q8TBA6|GOA5_HUMAN Golgi autoantigen, golgin subfa...    33   1.0
gi|38111544|gb|EAA57110.1| hypothetical protein MG08079.4 [Magna...    33   1.0
gi|46227257|gb|EAK88207.1| Low complexity hypothetical protein [...    33   1.0
gi|46134067|ref|XP_389349.1| hypothetical protein FG09173.1 [Gib...    33   1.0
gi|47086601|ref|NP_997886.1| carnitine deficiency-associated gen...    33   1.0
gi|50554371|ref|XP_504594.1| hypothetical protein [Yarrowia lipo...    33   1.0
gi|17565434|ref|NP_504585.1| fibronectin, type III and M protein...    33   1.0
gi|39586913|emb|CAE62848.1| Hypothetical protein CBG07027 [Caeno...    33   1.0
gi|39593039|emb|CAE64508.1| Hypothetical protein CBG09238 [Caeno...    33   1.0
gi|6754750|ref|NP_034963.1| moesin [Mus musculus] >gnl|BL_ORD_ID...    33   1.0
gi|1944185|dbj|BAA19655.1| hSLK [Homo sapiens]                         33   1.0
gi|37538653|ref|XP_168590.3| zuotin related factor 1 [Homo sapie...    33   1.0
gi|39587947|emb|CAE67966.1| Hypothetical protein CBG13570 [Caeno...    33   1.0
gi|2213830|gb|AAB61579.1| nucleus and microtubule-associated pro...    33   1.0
gi|50732982|ref|XP_418856.1| PREDICTED: similar to Golgi autoant...    33   1.3
gi|48768842|ref|ZP_00273190.1| COG0810: Periplasmic protein TonB...    33   1.3
gi|19114981|ref|NP_594069.1| homolog of yeast SLA2 protein-invol...    33   1.3
gi|32406236|ref|XP_323731.1| hypothetical protein [Neurospora cr...    33   1.3
gi|46116454|ref|XP_384245.1| hypothetical protein FG04069.1 [Gib...    33   1.3
gi|48833180|ref|ZP_00290202.1| COG0532: Translation initiation f...    33   1.3
gi|26345588|dbj|BAC36445.1| unnamed protein product [Mus musculus]     33   1.3
gi|46111807|ref|XP_382961.1| conserved hypothetical protein [Gib...    33   1.3
gi|26325282|dbj|BAC26395.1| unnamed protein product [Mus musculus]     33   1.3
gi|32413483|ref|XP_327221.1| predicted protein [Neurospora crass...    33   1.3
gi|15887468|ref|NP_353149.1| AGR_C_174p [Agrobacterium tumefacie...    33   1.3
gi|50545729|ref|XP_500403.1| hypothetical protein [Yarrowia lipo...    33   1.3
gi|31873716|emb|CAD97828.1| hypothetical protein [Homo sapiens]        33   1.3
gi|48110645|ref|XP_396274.1| similar to O1, putative [Apis melli...    33   1.3
gi|24642928|ref|NP_573264.1| CG15373-PA [Drosophila melanogaster...    33   1.3
gi|31211115|ref|XP_314524.1| ENSANGP00000016258 [Anopheles gambi...    33   1.3
gi|38086939|ref|XP_356365.1| similar to hypothetical protein FLJ...    33   1.3
gi|15606308|ref|NP_213687.1| hypothetical protein aq_1006 [Aquif...    33   1.3
gi|22997161|ref|ZP_00041397.1| COG1196: Chromosome segregation A...    33   1.3
gi|49901389|gb|AAH76604.1| Nol5 protein [Mus musculus]                 33   1.3
gi|2506984|sp|P12957|CALD_CHICK Caldesmon (CDM) >gnl|BL_ORD_ID|7...    33   1.3
gi|26336274|dbj|BAC31822.1| unnamed protein product [Mus musculus]     33   1.3
gi|28199809|ref|NP_780123.1| chromosome segregation protein [Xyl...    33   1.3
gi|22994169|ref|ZP_00038684.1| COG1196: Chromosome segregation A...    33   1.3
gi|50428778|gb|AAT77099.1| myosin 10 [Xenopus laevis]                  33   1.3
gi|15218021|ref|NP_173499.1| calcium-binding EF hand family prot...    33   1.3
gi|50513245|ref|NP_005474.2| chromatin assembly factor 1, subuni...    33   1.3
gi|23118168|ref|ZP_00101844.1| COG0810: Periplasmic protein TonB...    33   1.3
gi|34869750|ref|XP_223980.2| similar to RPGR-interacting protein...    33   1.3


>gi|17507391|ref|NP_491641.1| atpase H+ transporting lysosomal (14.5
           kD) (1G178) [Caenorhabditis elegans]
 gi|3183198|sp|P91303|VATG_CAEEL Probable Vacuolar ATP synthase
           subunit G (V-ATPase G subunit) (Vacuolar proton pump G
           subunit) (V-ATPase 13 kDa subunit)
 gi|7503578|pir||T25764 hypothetical protein F46F11.5 -
           Caenorhabditis elegans
 gi|13384453|gb|AAK21386.1| Hypothetical protein F46F11.5
           [Caenorhabditis elegans]
          Length = 126

 Score =  244 bits (622), Expect = 4e-64
 Identities = 126/126 (100%), Positives = 126/126 (100%)
 Frame = -1

Query: 381 MASQTQGIQQLLAAEKRAAEKINEARKRKLQRTKQAKQEAQAEVEKYKQQREAEFKAFEQ 202
           MASQTQGIQQLLAAEKRAAEKINEARKRKLQRTKQAKQEAQAEVEKYKQQREAEFKAFEQ
Sbjct: 1   MASQTQGIQQLLAAEKRAAEKINEARKRKLQRTKQAKQEAQAEVEKYKQQREAEFKAFEQ 60

Query: 201 QYLGTKEDIESKIRRDTEDQISGMKQSVAGNKQAVIVRLLQLVCDIKPELHHNLTLQKKL 22
           QYLGTKEDIESKIRRDTEDQISGMKQSVAGNKQAVIVRLLQLVCDIKPELHHNLTLQKKL
Sbjct: 61  QYLGTKEDIESKIRRDTEDQISGMKQSVAGNKQAVIVRLLQLVCDIKPELHHNLTLQKKL 120

Query: 21  HGQFAA 4
           HGQFAA
Sbjct: 121 HGQFAA 126




[DB home][top]