Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= F48E8_10
         (864 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|25152554|ref|NP_741138.1| venom allergen 5, LONg body length ...   502   e-141
gi|17553494|ref|NP_498167.1| glioma pathogenesis-related protein...   493   e-138
gi|17553496|ref|NP_498166.1| glioma pathogenesis-related protein...   488   e-137
gi|39580672|emb|CAE61354.1| Hypothetical protein CBG05195 [Caeno...   448   e-125
gi|21357507|ref|NP_650264.1| CG8483-PA [Drosophila melanogaster]...    96   1e-18
gi|31560776|ref|NP_076223.2| RIKEN cDNA 1200009H11 [Mus musculus...    93   9e-18
gi|9558479|dbj|BAB03453.1| cysteine-rich protease inhibitor [Mus...    93   9e-18
gi|50760281|ref|XP_417954.1| PREDICTED: similar to RIKEN cDNA 12...    92   1e-17
gi|34852277|ref|XP_215351.2| similar to cysteine-rich protease i...    92   2e-17
gi|22761577|dbj|BAC11640.1| unnamed protein product [Homo sapiens]     91   2e-17
gi|50728356|ref|XP_416104.1| PREDICTED: similar to Glioma pathog...    91   2e-17
gi|34530413|dbj|BAC85892.1| unnamed protein product [Homo sapiens]     91   2e-17
gi|23503319|ref|NP_699201.1| hypothetical protein MGC45378 [Homo...    90   6e-17
gi|6136165|sp|P81657|VA5_VESMA Venom allergen 5 (Antigen 5) (Ag5...    90   7e-17
gi|37181969|gb|AAQ88788.1| HGSC289 [Homo sapiens]                      88   2e-16
gi|37574025|gb|AAH22399.2| PI16 protein [Homo sapiens]                 88   2e-16
gi|3023562|sp|O19010|CRS3_HORSE Cysteine-rich secretory protein-...    88   2e-16
gi|26189922|emb|CAD31227.1| cysteine-rich secretory protein 3 [E...    88   2e-16
gi|2136189|pir||S68691 neutrophil granules matrix glycoprotein S...    88   3e-16
gi|5174675|ref|NP_006052.1| cysteine-rich secretory protein 3; s...    88   3e-16
gi|11990878|emb|CAC19654.1| dJ417L20.1 (cysteine-rich secretory ...    88   3e-16
gi|48428843|sp|Q8AVA3|CRVP_PSEPO Pseudecin precursor >gnl|BL_ORD...    87   4e-16
gi|1085313|pir||JC4131 glioma pathogenesis-related protein - human     87   4e-16
gi|14042040|dbj|BAB55081.1| unnamed protein product [Homo sapiens]     87   5e-16
gi|48474524|sp|Q8UW11|CRV2_LAPHA Cysteine-rich venom protein 2 p...    87   5e-16
gi|37182699|gb|AAQ89150.1| trypsin inhibitor [Homo sapiens]            87   5e-16
gi|13899332|ref|NP_113664.1| hypothetical protein DKFZp434B044 [...    87   5e-16
gi|38614471|gb|AAH63012.1| Unknown (protein for MGC:74865) [Homo...    87   6e-16
gi|5803151|ref|NP_006842.1| glioma pathogenesis-related protein;...    87   6e-16
gi|27735198|sp|P48060|GLIP_HUMAN Glioma pathogenesis-related pro...    87   6e-16
gi|48474525|sp|Q8UW25|CRV1_LAPHA Cysteine-rich venom protein 1 p...    87   6e-16
gi|24270816|gb|AAA82731.3| glioma pathogenesis-related protein [...    87   6e-16
gi|34851731|ref|XP_346524.1| hypothetical protein XP_346523 [Rat...    86   1e-15
gi|18000269|gb|AAL54896.1| cysteine-rich venom protein precursor...    85   2e-15
gi|48474866|sp|Q8JI38|CRVP_LATSE Latisemin precursor >gnl|BL_ORD...    85   2e-15
gi|465052|sp|Q05108|VA5_DOLAR Venom allergen 5 (Antigen 5) (Ag5)...    85   2e-15
gi|21312072|ref|NP_082884.1| GLI pathogenesis-related 1 (glioma)...    85   2e-15
gi|549184|sp|P35781|VA51_VESCR Venom allergen 5.01 (Antigen 5-1)...    84   3e-15
gi|19924045|ref|NP_612527.1| late gestation lung protein 1 [Ratt...    84   3e-15
gi|2500710|sp|Q60477|CRS2_CAVPO Cysteine-rich secretory protein-...    84   3e-15
gi|549186|sp|P10737|VA53_DOLMA Venom allergen 5.02 precursor (An...    84   5e-15
gi|85299|pir||B31085 antigen 5-3 precursor - bald-faced hornet (...    84   5e-15
gi|549185|sp|P35782|VA52_VESCR Venom allergen 5.02 (Antigen 5-2)...    84   5e-15
gi|552080|gb|AAA28302.1| antigen 5 precursor [Dolichovespula mac...    84   5e-15
gi|24657486|gb|AAH39124.1| 1200009H11Rik protein [Mus musculus]        83   7e-15
gi|47230411|emb|CAF99604.1| unnamed protein product [Tetraodon n...    83   7e-15
gi|32965153|gb|AAP91764.1| HrTT-1-like [Ciona intestinalis]            83   7e-15
gi|50745274|ref|XP_420051.1| PREDICTED: similar to cysteine-rich...    83   9e-15
gi|27229267|ref|NP_084485.1| RIKEN cDNA 1810049K24 [Mus musculus...    82   2e-14
gi|48428841|sp|Q7ZZN8|CRV2_NAJAT Natrin 2 precursor (Cysteine-ri...    82   2e-14
gi|465053|sp|Q05109|VA5_POLAN Venom allergen 5 precursor (Antige...    82   2e-14
gi|549187|sp|P35759|VA5_POLEX Venom allergen 5 (Antigen 5) (Ag5)...    81   3e-14
gi|26329519|dbj|BAC28498.1| unnamed protein product [Mus musculus]     81   3e-14
gi|37182583|gb|AAQ89093.1| ALKN2972 [Homo sapiens]                     80   4e-14
gi|34865667|ref|XP_237257.2| similar to protease inhibitor 15; c...    80   6e-14
gi|26334089|dbj|BAC30762.1| unnamed protein product [Mus musculus]     80   6e-14
gi|16716491|ref|NP_444421.1| protease inhibitor 15; cysteine-ric...    80   6e-14
gi|45383490|ref|NP_989665.1| protease inhibitor 15 [Gallus gallu...    80   6e-14
gi|45382819|ref|NP_989985.1| CocoaCrisp [Gallus gallus] >gnl|BL_...    80   6e-14
gi|48428844|sp|Q8AVA4|CRVP_PSEAU Pseudechetoxin precursor (PsTx)...    80   6e-14
gi|137395|sp|P10736|VA52_DOLMA Venom allergen 5.01 precursor (An...    79   1e-13
gi|22749527|ref|NP_689992.1| hypothetical protein MGC26856 [Homo...    79   1e-13
gi|12838657|dbj|BAB24280.1| unnamed protein product [Mus musculus]     79   1e-13
gi|50728354|ref|XP_416103.1| PREDICTED: similar to Glioma pathog...    79   1e-13
gi|7705676|ref|NP_056970.1| protease inhibitor 15 preproprotein;...    79   1e-13
gi|549190|sp|P35784|VA5_VESGE Venom allergen 5 (Antigen 5) (Ag5)...    79   1e-13
gi|47209394|emb|CAF91962.1| unnamed protein product [Tetraodon n...    79   1e-13
gi|26189920|emb|CAD31226.1| cystein-rich secretory protein 2 [Eq...    79   1e-13
gi|549188|sp|P35780|VA5_POLFU Venom allergen 5 (Antigen 5) (Ag5)...    79   2e-13
gi|4507671|ref|NP_003287.1| testis specific protein 1; glycerald...    78   2e-13
gi|33504575|ref|NP_872425.1| secretory protein LOC348174 [Homo s...    77   5e-13
gi|22760438|dbj|BAC11199.1| unnamed protein product [Homo sapiens]     77   5e-13
gi|33150842|gb|AAP97299.1| hypothetical protein [Homo sapiens]         77   5e-13
gi|549191|sp|P35760|VA5_VESMC Venom allergen 5 (Antigen 5) (Ag5)...    77   5e-13
gi|549192|sp|P35785|VA5_VESPE Venom allergen 5 (Antigen 5) (Ag5)...    77   5e-13
gi|50728450|ref|XP_425443.1| PREDICTED: similar to glioma pathog...    77   5e-13
gi|13676849|ref|NP_112519.1| testis specific protein 1 [Rattus n...    77   6e-13
gi|34874256|ref|XP_346849.1| hypothetical protein XP_346848 [Rat...    77   6e-13
gi|50401874|sp|P79845|CRVP_TRIMU Cysteine-rich venom protein pre...    77   6e-13
gi|549193|sp|P35786|VA5_VESSQ Venom allergen 5 (Antigen 5) (Ag5)...    77   6e-13
gi|417753|sp|Q03401|AEG1_MOUSE Sperm-coating glycoprotein 1 prec...    77   6e-13
gi|6136164|sp|P81656|VA5_POLDO Venom allergen 5 (Antigen 5) (Ag5...    77   6e-13
gi|27718249|ref|XP_216892.1| similar to GLI pathogenesis-related...    77   6e-13
gi|6678423|ref|NP_033446.1| cysteine-rich secretory protein 2; t...    76   8e-13
gi|50418413|gb|AAH78143.1| Secretory protein LOC348174 [Homo sap...    76   8e-13
gi|4826574|emb|CAB42887.1| allergen 5; antigen 5 [Vespula vulgaris]    76   8e-13
gi|2500711|sp|Q91055|HELO_HELHO Helothermine precursor (HLTx) >g...    76   1e-12
gi|37181871|gb|AAQ88739.1| LHPE306 [Homo sapiens]                      76   1e-12
gi|42660902|ref|XP_375369.1| similar to LHPE306 [Homo sapiens]         76   1e-12
gi|27734736|ref|NP_775890.1| hypothetical protein MGC34761 [Homo...    75   1e-12
gi|549189|sp|P35783|VA5_VESFL Venom allergen 5 (Antigen 5) (Ag5)...    75   1e-12
gi|15987513|gb|AAL12003.1| allurin [Xenopus laevis]                    75   1e-12
gi|11514279|pdb|1QNX|A Chain A, Ves V 5, An Allergen From Vespul...    75   2e-12
gi|31981914|ref|NP_033768.2| cysteine-rich secretory protein 1; ...    75   2e-12
gi|465054|sp|Q05110|VA5_VESVU Venom allergen 5 precursor (Antige...    75   2e-12
gi|47117356|sp|Q7Z156|VA5_POLSR Venom allergen 5 (Antigen 5) (Ag...    75   2e-12
gi|31747352|gb|AAP57536.1| venom allergen 5 [Polybia scutellaris]      75   2e-12
gi|18000318|gb|AAL54918.1| cysteine-rich venom protein [Lapemis ...    74   3e-12
gi|49118639|gb|AAH73666.1| Unknown (protein for IMAGE:5570266) [...    74   3e-12
gi|13899303|ref|NP_113649.1| CocoaCrisp [Homo sapiens] >gnl|BL_O...    74   3e-12
gi|41054828|ref|NP_956764.1| hypothetical protein MGC63636 [Dani...    74   4e-12
gi|48096643|ref|XP_392492.1| similar to acetylcholinesterase [Ap...    74   4e-12
gi|33518699|gb|AAQ20832.1| antigen-5-like protein precursor [Rho...    74   4e-12
gi|48428845|sp|Q8JGT9|CRVP_RHATT Tigrin precursor >gnl|BL_ORD_ID...    74   4e-12
gi|12408314|ref|NP_074050.1| epididymal glycoprotein [Rattus nor...    74   4e-12
gi|34865643|ref|XP_237258.2| similar to CocoaCrisp [Rattus norve...    74   4e-12
gi|34851929|ref|XP_226473.2| similar to mannose receptor precurs...    73   7e-12
gi|17540532|ref|NP_502498.1| secreted protein ASP-2 precursor fa...    73   7e-12
gi|13878237|ref|NP_113579.1| Cocoacrisp protein [Mus musculus] >...    73   9e-12
gi|48428837|sp|Q7T1K6|CRV1_NAJAT Natrin 1 precursor (Cysteine-ri...    73   9e-12
gi|50306407|ref|XP_453177.1| unnamed protein product [Kluyveromy...    73   9e-12
gi|25091511|sp|P83377|VA5_POLGA Venom allergen 5 (Antigen 5) (Ag...    73   9e-12
gi|549194|sp|P35787|VA5_VESVI Venom allergen 5 (Antigen 5) (Ag5)...    73   9e-12
gi|39581697|emb|CAE71030.1| Hypothetical protein CBG17870 [Caeno...    72   1e-11
gi|32423812|gb|AAP81292.1| opharin precursor [Ophiophagus hannah]      72   1e-11
gi|48474867|sp|Q8JI39|CRVP_TRIFL Triflin precursor >gnl|BL_ORD_I...    72   1e-11
gi|48428842|sp|Q7ZZN9|CRVP_TRIJE Cysteine-rich venom protein pre...    72   1e-11
gi|29568408|gb|AAO84055.1| cysteine rich secretory protein [Xeno...    72   1e-11
gi|48428838|sp|Q7ZT98|CRVP_OPHHA Ophanin precursor (Opharin) >gn...    72   2e-11
gi|31376251|gb|AAP44113.1| testis-specific protein TPX1 c isofor...    72   2e-11
gi|50753922|ref|XP_414180.1| PREDICTED: similar to hypothetical ...    72   2e-11
gi|48428840|sp|Q7ZTA0|CRVP_AGKPI Piscivorin precursor >gnl|BL_OR...    72   2e-11
gi|33284916|emb|CAE17614.1| SI:bZ1M12.1 (novel protein similar t...    72   2e-11
gi|30425410|ref|NP_848586.1| R3H domain (binds single-stranded n...    72   2e-11
gi|6136163|sp|P35779|VA3_SOLRI Venom allergen III (Allergen Sol ...    71   3e-11
gi|3549887|emb|CAA07160.1| cysteine-rich secretory protein-2 [Eq...    71   3e-11
gi|48428846|sp|Q8JI40|CRVP_AGKHA Ablomin precursor >gnl|BL_ORD_I...    71   3e-11
gi|17539738|ref|NP_502532.1| allergen V5/Tpx-1 related precursor...    71   3e-11
gi|1246085|gb|AAB35899.1| acidic epididymal glycoprotein homolog...    71   3e-11
gi|25121982|ref|NP_001122.2| acidic epididymal glycoprotein-like...    71   3e-11
gi|21998567|emb|CAC86394.2| cystein rich secretory protein 1 [Eq...    71   3e-11
gi|31322514|gb|AAP22987.1| mannose receptor precursor-like isofo...    71   3e-11
gi|31559797|ref|NP_853527.1| mannose receptor-like [Mus musculus...    71   3e-11
gi|31322510|gb|AAP22985.1| mannose receptor precursor-like isofo...    71   3e-11
gi|31322506|gb|AAP22983.1| mannose receptor precursor-like isofo...    71   3e-11
gi|6322383|ref|NP_012457.1| Protein of unknown function, has sim...    71   3e-11
gi|45476808|sp|P60623|CRVP_TRIST Cysteine-rich secretory protein...    70   5e-11
gi|48428839|sp|Q7ZT99|CRVP_CROAT Catrin 1/2 precursor >gnl|BL_OR...    70   6e-11
gi|26996572|gb|AAH40768.1| Cocoacrisp protein [Mus musculus]           70   6e-11
gi|6322382|ref|NP_012456.1| Protein of unknown function, has sim...    70   8e-11
gi|13676427|dbj|BAB41141.1| hypothetical protein [Macaca fascicu...    70   8e-11
gi|12860902|dbj|BAB32077.1| unnamed protein product [Mus musculus]     69   1e-10
gi|3549885|emb|CAA07159.1| cysteine-rich secretory protein-1 [Eq...    69   1e-10
gi|17539076|ref|NP_502506.1| allergen V5/Tpx-1 related precursor...    69   2e-10
gi|7442176|pir||T08154 pathogenesis-related protein PR1 - rape >...    68   3e-10
gi|2696794|dbj|BAA24011.1| HrTT-1 [Halocynthia roretzi]                68   3e-10
gi|47223528|emb|CAF98015.1| unnamed protein product [Tetraodon n...    67   4e-10
gi|1778013|gb|AAB48565.1| prepro-cysteine-rich venom protein [Pr...    67   4e-10
gi|38075238|ref|XP_355362.1| similar to R3H domain (binds single...    67   4e-10
gi|17539080|ref|NP_502508.1| allergen V5/Tpx-1 related family me...    67   5e-10
gi|45361475|ref|NP_989314.1| hypothetical protein MGC76177 [Xeno...    67   5e-10
gi|1336808|gb|AAB36116.1| Sol i 3=antigen [Solenopsis invicta=im...    67   7e-10
gi|14424466|sp|P35778|VA3_SOLIN Venom allergen III precursor (Al...    67   7e-10
gi|50288531|ref|XP_446695.1| unnamed protein product [Candida gl...    67   7e-10
gi|50345391|gb|AAT74668.1| cysteine-rich secreted protein 2 [Mes...    66   9e-10
gi|39579905|emb|CAE56329.1| Hypothetical protein CBG23994 [Caeno...    66   9e-10
gi|39587728|emb|CAE58666.1| Hypothetical protein CBG01835 [Caeno...    66   1e-09
gi|34395115|dbj|BAC84831.1| putative pathogenesis-related protei...    66   1e-09
gi|29840988|gb|AAP06001.1| similar to GenBank Accession Number A...    65   2e-09
gi|25121984|ref|NP_733758.1| acidic epididymal glycoprotein-like...    65   2e-09
gi|17540542|ref|NP_502503.1| allergen V5/Tpx-1 related precursor...    65   2e-09
gi|6753004|ref|NP_033769.1| cysteine-rich secretory protein 3; a...    65   2e-09
gi|50306405|ref|XP_453176.1| unnamed protein product [Kluyveromy...    65   2e-09
gi|50287531|ref|XP_446195.1| unnamed protein product [Candida gl...    64   3e-09
gi|6322864|ref|NP_012938.1| Protein of unknown function, has sim...    64   3e-09
gi|548588|sp|P35792|PR12_HORVU Pathogenesis-related protein PRB1...    64   3e-09
gi|1582766|prf||2119294B YFW12 gene                                    64   3e-09
gi|49069060|ref|XP_398819.1| hypothetical protein UM01204.1 [Ust...    64   3e-09
gi|34395117|dbj|BAC84833.1| putative pathogenesis-related protei...    64   4e-09
gi|13560653|gb|AAK30143.1| pathogenesis-related protein PR-1 pre...    64   4e-09
gi|41055626|ref|NP_956869.1| hypothetical protein MGC65887 [Dani...    64   4e-09
gi|50304613|ref|XP_452262.1| unnamed protein product [Kluyveromy...    64   6e-09
gi|34900744|ref|NP_911718.1| putative type-1 pathogenesis-relate...    64   6e-09
gi|34393704|dbj|BAC83017.1| putative Pathogenesis-related protei...    64   6e-09
gi|3702665|emb|CAA07474.1| pathogenisis-related protein 1.2 [Tri...    64   6e-09
gi|2129798|pir||S65777 pathogenesis-related protein 1a homolog p...    64   6e-09
gi|34900740|ref|NP_911716.1| putative pathogenesis-related prote...    63   7e-09
gi|47497544|dbj|BAD19616.1| putative pathogenesis-related protei...    63   7e-09
gi|50726421|dbj|BAD34031.1| putative pathogenesis related protei...    63   9e-09
gi|1709754|sp|Q08697|PR1A_LYCES Pathogenesis-related protein 1A1...    63   9e-09
gi|17539082|ref|NP_502509.1| allergen V5/Tpx-1 related family me...    63   9e-09
gi|130846|sp|P11670|PRB1_TOBAC Basic form of pathogenesis-relate...    63   9e-09
gi|548589|sp|P35793|PR13_HORVU Pathogenesis-related protein PRB1...    63   9e-09
gi|548592|sp|Q05968|PR1_HORVU Pathogenesis-related protein 1 pre...    63   9e-09
gi|47497545|dbj|BAD19617.1| putative pathogenesis-related protei...    63   9e-09
gi|23630526|gb|AAN37409.1| pathogenesis-related protein 1 [Brass...    63   9e-09
gi|17540530|ref|NP_502497.1| venom allergen-like protein precurs...    62   1e-08
gi|34395102|dbj|BAC84818.1| putative pathogenesis-related protei...    62   1e-08
gi|50745336|ref|XP_426225.1| PREDICTED: similar to ophanin [Gall...    62   1e-08
gi|47605560|sp|Q9XSD3|CRS1_MACMU Cysteine-rich secretory protein...    62   2e-08
gi|112558|pir||B37330 venom allergen III - red imported fire ant...    62   2e-08
gi|282959|pir||S22531 pathogenesis-related protein 1b - common t...    61   3e-08
gi|31322508|gb|AAP22984.1| mannose receptor precursor-like isofo...    61   3e-08
gi|480679|pir||S37166 pathogenesis-related protein 1a - barley >...    61   3e-08
gi|50258547|gb|EAL21234.1| hypothetical protein CNBD2890 [Crypto...    61   3e-08
gi|47497162|dbj|BAD19210.1| putative pathogenesis related protei...    61   4e-08
gi|34865028|ref|XP_345822.1| similar to RIKEN cDNA 4921508O11 [R...    61   4e-08
gi|15235056|ref|NP_195098.1| pathogenesis-related protein, putat...    61   4e-08
gi|41018458|sp|Q7YT83|TX31_CONTE Substrate-specific endoprotease...    61   4e-08
gi|39587738|emb|CAE58676.1| Hypothetical protein CBG01850 [Caeno...    61   4e-08
gi|15225974|ref|NP_179068.1| pathogenesis-related protein 1 (PR-...    61   4e-08
gi|7768107|emb|CAB90614.1| cysteine-rich secretory protein-2 [Bo...    60   5e-08
gi|39582258|emb|CAE64209.1| Hypothetical protein CBG08842 [Caeno...    60   5e-08
gi|3702663|emb|CAA07473.1| pathogenisis-related protein 1.1 [Tri...    60   5e-08
gi|39579904|emb|CAE56328.1| Hypothetical protein CBG23993 [Caeno...    60   6e-08
gi|23268455|gb|AAN11402.1| secreted-protein 1 precursor [Ancylos...    60   6e-08
gi|34395121|dbj|BAC84837.1| putative pathogenesis-related protei...    60   6e-08
gi|39590516|emb|CAE66256.1| Hypothetical protein CBG11500 [Caeno...    60   6e-08
gi|130940|sp|Q00008|PRMS_MAIZE Pathogenesis-related protein PRMS...    60   8e-08
gi|39587736|emb|CAE58674.1| Hypothetical protein CBG01847 [Caeno...    60   8e-08
gi|3719257|gb|AAD13339.1| ancylostoma-secreted protein 1 precurs...    60   8e-08
gi|15239598|ref|NP_197985.1| pathogenesis-related protein, putat...    60   8e-08
gi|14334165|gb|AAK60565.1| pathogenesis-related protein 1 [Triti...    60   8e-08
gi|15235081|ref|NP_195099.1| pathogenesis-related protein, putat...    59   1e-07
gi|2500715|sp|Q40374|PR1_MEDTR Pathogenesis-related protein PR-1...    59   1e-07
gi|19073340|gb|AAL84768.1| pathogenesis-related protein 1-1a [Cu...    59   1e-07
gi|1228950|emb|CAA65420.1| pathogenesis-related protein 1 [Arabi...    59   1e-07
gi|39587727|emb|CAE58665.1| Hypothetical protein CBG01834 [Caeno...    59   1e-07
gi|15225280|ref|NP_179589.1| pathogenesis-related protein 1 (PR-...    59   1e-07
gi|48527854|gb|AAT46023.1| pathogenesis-related protein 1 [Brass...    59   1e-07
gi|5305210|gb|AAD41529.1| acidic epididymal glycoprotein D/E [Ra...    59   2e-07
gi|7442178|pir||S71554 pathogenesis-related protein bpr1-1 precu...    59   2e-07
gi|4324680|gb|AAD16985.1| vespid allergen antigen homolog [Wuche...    59   2e-07
gi|16751565|gb|AAL27696.1| pathogenesis-related protein PR1 [Bra...    58   2e-07
gi|39588596|emb|CAE58120.1| Hypothetical protein CBG01207 [Caeno...    58   2e-07
gi|17221641|dbj|BAB78476.1| PR-1 [Solanum torvum]                      58   2e-07
gi|2796175|gb|AAB97282.1| vespid allergen antigen homolog [Oncho...    58   2e-07
gi|6066750|emb|CAB58263.1| pathogenesis related protein PR-1 [So...    58   2e-07
gi|15625250|gb|AAL01594.1| pathogenesis-related protein 1b precu...    58   2e-07
gi|21726980|emb|CAD38276.1| pathogenesis related protein isoform...    58   2e-07
gi|34395063|dbj|BAC84725.1| putative pathogenesis-related protei...    58   3e-07
gi|1469932|gb|AAB05225.1| pathogenesis-related protein-1               58   3e-07
gi|11277195|pir||JC7330 acidic pathogenesis-related protein 1a p...    58   3e-07
gi|38107344|gb|EAA53530.1| hypothetical protein MG07807.4 [Magna...    58   3e-07
gi|21726982|emb|CAD38277.1| pathogenesis related protein isoform...    58   3e-07
gi|13385730|ref|NP_080499.1| RIKEN cDNA 4921508O11 [Mus musculus...    57   4e-07
gi|17540540|ref|NP_502502.1| SCP-Like extracellular protein (scl...    57   4e-07
gi|3396070|gb|AAD13340.1| ancylostoma secreted protein 1 precurs...    57   4e-07
gi|4884851|gb|AAD31839.1| ancylostoma-secreted protein 1 precurs...    57   4e-07
gi|28201315|dbj|BAC56823.1| putative pathogenesis-related protei...    57   4e-07
gi|17540544|ref|NP_502504.1| allergen V5/Tpx-1 related precursor...    57   5e-07
gi|13625885|gb|AAK35187.1| activation associated secreted protei...    57   5e-07
gi|15235992|ref|NP_194308.1| pathogenesis-related protein, putat...    57   5e-07
gi|40646968|gb|AAQ19681.1| cytoplasmic small heat shock protein ...    57   5e-07
gi|2500713|sp|Q16937|ASP_ANCCA Ancylostoma secreted protein prec...    57   5e-07
gi|7442179|pir||T02054 pathogenesis related protein-1 - maize >g...    57   5e-07
gi|37531954|ref|NP_920279.1| putative type-1 pathogenesis-relate...    57   5e-07
gi|100907|pir||A33155 pathogenesis-related protein 1 - maize >gn...    57   5e-07
gi|17539084|ref|NP_502510.1| allergen V5/Tpx-1 related precursor...    57   7e-07
gi|15225965|ref|NP_179064.1| pathogenesis-related protein, putat...    57   7e-07
gi|15232719|ref|NP_187570.1| pathogenesis-related protein, putat...    57   7e-07
gi|45184646|ref|NP_982364.1| AAL178Wp [Eremothecium gossypii] >g...    57   7e-07
gi|47497163|dbj|BAD19211.1| putative Pathogenesis-related protei...    57   7e-07
gi|34395111|dbj|BAC84827.1| putative pathogenesis-related protei...    57   7e-07
gi|39588585|emb|CAE58108.1| Hypothetical protein CBG01194 [Caeno...    57   7e-07
gi|34914926|ref|NP_918810.1| rice pathogenesis-related protein c...    57   7e-07
gi|39581270|emb|CAE60016.1| Hypothetical protein CBG03518 [Caeno...    56   9e-07
gi|17561866|ref|NP_504056.1| allergen V5/Tpx-1 related family me...    56   9e-07
gi|42557353|dbj|BAD11072.1| pathogenesis-related protein 1 [Caps...    56   9e-07
gi|46436621|gb|EAK95980.1| hypothetical protein CaO19.7218 [Cand...    56   9e-07
gi|34914936|ref|NP_918815.1| putative pathogenesis-related prote...    56   1e-06
gi|32567250|ref|NP_506396.2| allergen V5/Tpx-1 related family me...    56   1e-06
gi|536789|emb|CAA29023.1| PR-1c protein [Nicotiana tabacum]            56   1e-06
gi|25518458|pir||D86143 hypothetical protein F6F3.11 - Arabidops...    56   1e-06
gi|100370|pir||S10205 pathogenesis-related protein 1 - common to...    56   1e-06
gi|19944|emb|CAA30017.1| unnamed protein product [Nicotiana taba...    56   1e-06
gi|130828|sp|P09042|PR1C_TOBAC Pathogenesis-related protein 1C p...    56   1e-06
gi|30911057|gb|AAP41924.1| hypothetical protein [Homo sapiens]         56   1e-06
gi|536788|emb|CAA31010.1| PR1c preprotein [Nicotiana tabacum]          56   1e-06
gi|42561586|ref|NP_171638.2| allergen V5/Tpx-1-related family pr...    56   1e-06
gi|548586|sp|Q04108|PR04_LYCES Pathogenesis-related leaf protein...    56   1e-06
gi|46440579|gb|EAK99883.1| hypothetical protein CaO19.6200 [Cand...    55   2e-06
gi|17540534|ref|NP_502499.1| vap-1 like family member (4N815) [C...    55   2e-06
gi|17569627|ref|NP_509802.1| allergen V5/Tpx-1 related (XL408) [...    55   2e-06
gi|7596932|gb|AAB97283.2| vespid allergen antigen homolog [Brugi...    55   2e-06
gi|21304633|gb|AAM45439.1| pathogenesis-related protein 1 [Oryza...    55   2e-06
gi|688429|dbj|BAA05473.1| tumor-related protein [Nicotiana glauc...    55   2e-06
gi|46440490|gb|EAK99795.1| hypothetical protein CaO19.13580 [Can...    55   2e-06
gi|30144637|gb|AAP14676.1| pathogenesis related-1 [Triticum aest...    55   2e-06
gi|39587737|emb|CAE58675.1| Hypothetical protein CBG01849 [Caeno...    55   2e-06
gi|21751967|dbj|BAC04085.1| unnamed protein product [Homo sapiens]     55   3e-06
gi|39584502|emb|CAE74580.1| Hypothetical protein CBG22345 [Caeno...    55   3e-06
gi|22748923|ref|NP_689649.1| hypothetical protein MGC39497 [Homo...    55   3e-06
gi|17532893|ref|NP_494496.1| vespid allergen antigen homolog lik...    55   3e-06
gi|34395126|dbj|BAC84842.1| PR-1 type pathogenesis-related prote...    55   3e-06
gi|46440493|gb|EAK99798.1| hypothetical protein CaO19.13583 [Can...    55   3e-06
gi|4704758|gb|AAD28256.1| vespid allergen antigen homolog [Wuche...    55   3e-06
gi|48475149|gb|AAT44218.1| unknown protein [Oryza sativa (japoni...    55   3e-06
gi|34395114|dbj|BAC84830.1| putative pathogenesis-related protei...    54   3e-06
gi|9963986|gb|AAG09789.1| repressed by TUP1 protein 4; Rbt4p [Ca...    54   3e-06
gi|31217576|ref|XP_316453.1| ENSANGP00000020404 [Anopheles gambi...    54   4e-06
gi|33413141|emb|CAD60273.1| putative pathogenesis related protei...    54   4e-06
gi|5868902|gb|AAB69625.2| activation-associated secreted protein...    54   4e-06
gi|7513369|pir||JC5309 testis-specific, vespid, and pathogenesis...    54   6e-06
gi|15234704|ref|NP_194761.1| allergen V5/Tpx-1-related family pr...    54   6e-06
gi|45184645|ref|NP_982363.1| AAL179Wp [Eremothecium gossypii] >g...    54   6e-06
gi|18765762|dbj|BAB85217.1| PR-1 like protein [Volvox carteri f....    53   8e-06
gi|13625909|gb|AAK35199.1| activation associated secreted protei...    53   8e-06
gi|130826|sp|P08299|PR1A_TOBAC Pathogenesis-related protein 1A p...    53   8e-06
gi|2624502|pdb|1CFE|  P14a, Nmr, 20 Structures                         53   8e-06
gi|548587|sp|P04284|PR06_LYCES Pathogenesis-related leaf protein...    53   8e-06
gi|579402|emb|CAA31008.1| PR1a preprotein [Nicotiana tabacum]          53   8e-06
gi|3986149|dbj|BAA34937.1| PR-1 like protein [Camellia sinensis]       53   1e-05
gi|15225273|ref|NP_179587.1| pathogenesis-related protein, putat...    53   1e-05
gi|13625879|gb|AAK35184.1| activation associated secreted protei...    53   1e-05
gi|2414525|emb|CAA04881.1| pathogenesis-related protein [Lycoper...    53   1e-05
gi|31075035|gb|AAP41952.1| secreted protein ASP-2 [Necator ameri...    52   1e-05
gi|15230919|ref|NP_188603.1| pathogenesis-related protein, putat...    52   1e-05
gi|218304|dbj|BAA14220.1| PR1a protein precursor [Nicotiana taba...    52   1e-05
gi|15241922|ref|NP_195893.1| allergen V5/Tpx-1-related family pr...    52   1e-05
gi|3608493|gb|AAC35986.1| secreted protein ASP-2 precursor [Ancy...    52   1e-05
gi|548901|sp|P35795|SC14_SCHCO Fruiting body protein SC14 precur...    52   2e-05
gi|47497165|dbj|BAD19213.1| putative Pathogenesis-related protei...    52   2e-05
gi|39584312|emb|CAE65476.1| Hypothetical protein CBG10443 [Caeno...    52   2e-05
gi|15235962|ref|NP_194875.1| pathogenesis-related protein, putat...    52   2e-05
gi|39581263|emb|CAE60009.1| Hypothetical protein CBG03511 [Caeno...    52   2e-05
gi|13625881|gb|AAK35185.1| activation associated secreted protei...    52   2e-05
gi|13625877|gb|AAK35183.1| activation associated secreted protei...    52   2e-05
gi|50549999|ref|XP_502472.1| hypothetical protein [Yarrowia lipo...    52   2e-05
gi|4928711|gb|AAD33696.1| PR1a precursor [Glycine max]                 52   2e-05
gi|34860759|ref|XP_345468.1| similar to dJ881L22.3 (novel protei...    52   2e-05
gi|19948|emb|CAA31009.1| PR1b preprotein [Nicotiana tabacum]           51   3e-05
gi|39587729|emb|CAE58667.1| Hypothetical protein CBG01836 [Caeno...    51   3e-05
gi|130827|sp|P07053|PR1B_TOBAC Pathogenesis-related protein 1B p...    51   3e-05
gi|7442185|pir||T08126 pathogenesis-related protein 1 precursor ...    51   3e-05
gi|39594953|emb|CAE70821.1| Hypothetical protein CBG17592 [Caeno...    51   3e-05
gi|31223763|ref|XP_317349.1| ENSANGP00000010508 [Anopheles gambi...    51   3e-05
gi|728622|emb|CAA29022.1| PR-1b protein [Nicotiana tabacum]            51   3e-05
gi|28201322|dbj|BAC56830.1| putative pathogenesis-related protei...    51   4e-05
gi|28573995|ref|NP_608668.2| CG16995-PA [Drosophila melanogaster...    51   4e-05
gi|31213101|ref|XP_315494.1| ENSANGP00000021178 [Anopheles gambi...    51   4e-05
gi|33440014|gb|AAQ19031.1| Prb1 [Oryza sativa (japonica cultivar...    51   4e-05
gi|15225275|ref|NP_179588.1| allergen V5/Tpx-1-related family pr...    51   4e-05
gi|15235994|ref|NP_194309.1| allergen V5/Tpx-1-related family pr...    50   5e-05
gi|46433051|gb|EAK92507.1| hypothetical protein CaO19.2787 [Cand...    50   5e-05
gi|17558778|ref|NP_504963.1| glioma pathogenesis-related protein...    50   5e-05
gi|7500502|pir||T21763 hypothetical protein F35E12.1 - Caenorhab...    50   5e-05
gi|46433074|gb|EAK92529.1| hypothetical protein CaO19.10303 [Can...    50   5e-05
gi|39587730|emb|CAE58668.1| Hypothetical protein CBG01837 [Caeno...    50   5e-05
gi|8698923|gb|AAF78527.1| pathogenesis-related proteins [Pyrus p...    50   5e-05
gi|31217584|ref|XP_316455.1| ENSANGP00000021046 [Anopheles gambi...    50   6e-05
gi|7442177|pir||T07146 pathogenesis-related protein 1a2 - tomato...    50   6e-05
gi|45199219|ref|NP_986248.1| AFR700Wp [Eremothecium gossypii] >g...    50   6e-05
gi|47205351|emb|CAF91801.1| unnamed protein product [Tetraodon n...    50   8e-05
gi|8698925|gb|AAF78528.1| pathogenesis-related protein [Pyrus py...    50   8e-05
gi|22327916|ref|NP_680450.1| allergen V5/Tpx-1-related family pr...    50   8e-05
gi|50414969|gb|AAH77873.1| Unknown (protein for MGC:80621) [Xeno...    50   8e-05
gi|50345393|gb|AAT74669.1| cysteine-rich secreted protein 3 [Mes...    49   1e-04
gi|50758699|ref|XP_417377.1| PREDICTED: similar to R3H domain (b...    49   1e-04
gi|2500716|sp|Q41359|PR1_SAMNI Pathogenesis-related protein PR-1...    49   1e-04
gi|17566862|ref|NP_507655.1| CocoaCrisp precursor family member ...    49   1e-04
gi|50425691|ref|XP_461442.1| unnamed protein product [Debaryomyc...    49   1e-04
gi|34395120|dbj|BAC84836.1| putative pathogenesis-related protei...    49   1e-04
gi|34395064|dbj|BAC84726.1| putative acidic PR-1 type pathogenes...    49   1e-04
gi|15240015|ref|NP_201460.1| allergen V5/Tpx-1-related family pr...    49   1e-04
gi|21554246|gb|AAM63321.1| sts14 [Arabidopsis thaliana]                49   1e-04
gi|49084626|ref|XP_404495.1| hypothetical protein AN0358.2 [Aspe...    49   1e-04
gi|50550175|ref|XP_502560.1| hypothetical protein [Yarrowia lipo...    49   1e-04
gi|17561870|ref|NP_504055.1| allergen V5/Tpx-1 related family me...    49   1e-04
gi|548902|sp|P35794|SC7_SCHCO Fruiting body protein SC7 precurso...    49   1e-04
gi|18389885|gb|AAL68779.1| antigen 5-related 2 protein [Anophele...    49   2e-04
gi|27372895|gb|AAO06821.1| salivary antigen-5 related protein [A...    49   2e-04
gi|15222865|ref|NP_175428.1| pathogenesis-related protein, putat...    48   2e-04
gi|46111725|ref|XP_382920.1| hypothetical protein FG02744.1 [Gib...    48   2e-04
gi|39588543|emb|CAE58066.1| Hypothetical protein CBG01145 [Caeno...    48   2e-04
gi|50427127|ref|XP_462174.1| unnamed protein product [Debaryomyc...    48   2e-04
gi|15235052|ref|NP_195097.1| pathogenesis-related protein, putat...    48   2e-04
gi|2914024|dbj|BAA24993.1| FSG 120k Cys-rich protein [Hemicentro...    48   3e-04
gi|31205369|ref|XP_311633.1| ENSANGP00000015042 [Anopheles gambi...    48   3e-04
gi|7407641|gb|AAF62171.1| pathogenesis-related protein 1 [Betula...    48   3e-04
gi|17565656|ref|NP_507793.1| testis specific protein like precur...    47   4e-04
gi|46136065|ref|XP_389724.1| hypothetical protein FG09548.1 [Gib...    47   4e-04
gi|47213001|emb|CAF95393.1| unnamed protein product [Tetraodon n...    47   4e-04
gi|49086272|ref|XP_405195.1| hypothetical protein AN1058.2 [Aspe...    47   4e-04
gi|39588579|emb|CAE58102.1| Hypothetical protein CBG01188 [Caeno...    47   4e-04
gi|50425713|ref|XP_461453.1| unnamed protein product [Debaryomyc...    47   4e-04
gi|14326230|gb|AAK60209.1| vap-1 [Heterodera glycines]                 47   4e-04
gi|50411137|ref|XP_457020.1| unnamed protein product [Debaryomyc...    47   4e-04
gi|39588550|emb|CAE58073.1| Hypothetical protein CBG01152 [Caeno...    47   5e-04
gi|31075037|gb|AAP41953.1| secreted protein ASP-2 [Ancylostoma c...    47   7e-04
gi|31205367|ref|XP_311632.1| ENSANGP00000024498 [Anopheles gambi...    46   0.001
gi|46435461|gb|EAK94842.1| hypothetical protein CaO19.2336 [Cand...    46   0.001
gi|38350629|gb|AAR18424.1| putative salivary antigen 5 family pr...    46   0.001
gi|48475147|gb|AAT44216.1| unknown protein [Oryza sativa (japoni...    46   0.001
gi|17542330|ref|NP_502228.1| secreted protein ASP-2 family membe...    46   0.001
gi|21450576|gb|AAM54195.1| Venom allergen-like protein protein 1...    46   0.001
gi|33359651|gb|AAQ17073.1| antigen 5-related salivary protein [A...    46   0.001
gi|17537371|ref|NP_493975.1| allergen V5/Tpx-1 related family me...    46   0.001
gi|11762066|gb|AAG40311.1| activation-associated secreted protei...    46   0.001
gi|39588541|emb|CAE58064.1| Hypothetical protein CBG01143 [Caeno...    45   0.002
gi|31210575|ref|XP_314254.1| ENSANGP00000018746 [Anopheles gambi...    45   0.002
gi|39588582|emb|CAE58105.1| Hypothetical protein CBG01191 [Caeno...    45   0.002
gi|31203615|ref|XP_310756.1| ENSANGP00000021983 [Anopheles gambi...    45   0.002
gi|31203315|ref|XP_310606.1| ENSANGP00000019483 [Anopheles gambi...    45   0.002
gi|38082490|ref|XP_355014.1| similar to acidic epididymal glycop...    45   0.003
gi|30027144|gb|AAP06732.1| ASP-2 protein [Onchocerca volvulus]         45   0.003
gi|31217681|ref|XP_316479.1| ENSANGP00000004285 [Anopheles gambi...    45   0.003
gi|50419877|ref|XP_458471.1| unnamed protein product [Debaryomyc...    45   0.003
gi|31198689|ref|XP_308292.1| ENSANGP00000010752 [Anopheles gambi...    44   0.003
gi|39588597|emb|CAE58121.1| Hypothetical protein CBG01208 [Caeno...    44   0.003
gi|46440581|gb|EAK99885.1| hypothetical protein CaO19.6202 [Cand...    44   0.003
gi|39588588|emb|CAE58111.1| Hypothetical protein CBG01197 [Caeno...    44   0.005
gi|2329928|gb|AAC47714.1| 24 kDa excretory/secretory protein [Ha...    44   0.005
gi|7768109|emb|CAB90615.1| cysteine-rich secretory protein-1 [Bo...    44   0.005
gi|41615448|tpg|DAA03482.1| TPA: HDC00353 [Drosophila melanogaster]    44   0.006
gi|17559376|ref|NP_507429.1| predicted CDS, glioma pathogenesis-...    44   0.006
gi|31217598|ref|XP_316459.1| ENSANGP00000021028 [Anopheles gambi...    44   0.006
gi|34556108|emb|CAA76822.2| putative gVAG protein precursor [Ano...    44   0.006
gi|2245508|gb|AAB62535.1| venom allergen antigen 5-like protein ...    44   0.006
gi|47223529|emb|CAF98016.1| unnamed protein product [Tetraodon n...    44   0.006
gi|18568316|gb|AAL76028.1| putative secreted protein [Aedes aegy...    44   0.006
gi|49075842|ref|XP_401958.1| hypothetical protein UM04343.1 [Ust...    43   0.008
gi|38100752|gb|EAA47842.1| hypothetical protein MG03085.4 [Magna...    43   0.008
gi|4887102|gb|AAD32191.1| antigen 5-related protein [Lutzomyia l...    43   0.008
gi|33945409|emb|CAD44296.1| pr-1-like protein [Physcomitrella pa...    43   0.008
gi|13562128|gb|AAK29126.1| activation-associated secreted protei...    43   0.008
gi|25150837|ref|NP_741951.1| Venom-Allergen-like Protein VAP-1, ...    43   0.008
gi|42733845|gb|AAS38763.1| similar to Dictyostelium discoideum (...    43   0.010
gi|13447461|gb|AAK21961.1| secreted venom allergen-like protein ...    43   0.010
gi|14211968|gb|AAK55116.1| venom allergen-like protein [Heterode...    43   0.010
gi|17564430|ref|NP_507364.1| predicted CDS, glioma pathogenesis-...    43   0.010
gi|4102596|gb|AAD01511.1| secreted protein MSP-1 [Meloidogyne in...    43   0.010
gi|7638032|gb|AAF65314.1| salivary allergen 2 [Ctenocephalides f...    42   0.013
gi|32409985|ref|XP_325473.1| hypothetical protein [Neurospora cr...    42   0.013
gi|47225467|emb|CAG11950.1| unnamed protein product [Tetraodon n...    42   0.013
gi|50803868|ref|XP_428688.1| PREDICTED: similar to hypothetical ...    42   0.013
gi|39587249|emb|CAE57717.1| Hypothetical protein CBG00725 [Caeno...    42   0.013
gi|46227116|gb|EAK88066.1| extracellular protein with signal pep...    42   0.013
gi|39596039|emb|CAE69675.1| Hypothetical protein CBG15925 [Caeno...    42   0.017
gi|2500717|sp|Q41495|ST14_SOLTU STS14 protein precursor >gnl|BL_...    42   0.023
gi|29124853|gb|AAO63576.1| secreted protein 4 precursor [Ancylos...    42   0.023
gi|31210577|ref|XP_314255.1| ENSANGP00000018751 [Anopheles gambi...    42   0.023
gi|31075033|gb|AAP41951.1| secreted protein ASP-2 [Ancylostoma d...    42   0.023
gi|31211113|ref|XP_314523.1| ENSANGP00000016942 [Anopheles gambi...    42   0.023
gi|20129165|ref|NP_608663.1| CG4270-PA [Drosophila melanogaster]...    41   0.030
gi|39579940|emb|CAE74287.1| Hypothetical protein CBG21986 [Caeno...    41   0.030
gi|39581266|emb|CAE60012.1| Hypothetical protein CBG03514 [Caeno...    41   0.030
gi|17538308|ref|NP_499859.1| allergen V5/Tpx-1 related family me...    41   0.030
gi|46114940|ref|XP_383488.1| hypothetical protein FG03312.1 [Gib...    41   0.039
gi|32395295|gb|AAO72734.1| antigen 5 precursor [Stomoxys calcitr...    40   0.050
gi|18568284|gb|AAL76012.1| putative secreted protein [Aedes aegy...    40   0.050
gi|24656989|ref|NP_611582.1| CG17974-PA [Drosophila melanogaster...    40   0.066
gi|17550220|ref|NP_509707.1| allergen V5/Tpx-1 related family me...    40   0.086
gi|2905792|gb|AAC03562.1| putative secretory protein precursor; ...    40   0.086
gi|39588578|emb|CAE58101.1| Hypothetical protein CBG01185 [Caeno...    40   0.086
gi|39588614|emb|CAE58138.1| Hypothetical protein CBG01226 [Caeno...    39   0.11
gi|38344687|emb|CAD40249.2| OSJNBb0096E05.9 [Oryza sativa (japon...    39   0.11
gi|31217593|ref|XP_316457.1| ENSANGP00000025115 [Anopheles gambi...    39   0.11
gi|39581269|emb|CAE60015.1| Hypothetical protein CBG03517 [Caeno...    39   0.15
gi|24656985|ref|NP_611581.1| CG9822-PA [Drosophila melanogaster]...    39   0.15
gi|28573842|ref|NP_725234.2| CG30486-PA [Drosophila melanogaster...    39   0.15
gi|39587558|emb|CAE58496.1| Hypothetical protein CBG01643 [Caeno...    39   0.15
gi|2664196|emb|CAA05868.1| PR-1 protein [Vitis vinifera]               39   0.15
gi|31217579|ref|XP_316454.1| ENSANGP00000020471 [Anopheles gambi...    39   0.19
gi|13562122|gb|AAK29123.1| activation-associated secreted protei...    39   0.19
gi|31205375|ref|XP_311636.1| ENSANGP00000014974 [Anopheles gambi...    39   0.19
gi|13562124|gb|AAK29124.1| activation-associated secreted protei...    38   0.25
gi|46395674|sp|P81993|CRVP_BUNCA Bucarin                               38   0.25
gi|24642010|ref|NP_524689.2| CG9540-PA [Drosophila melanogaster]...    38   0.25
gi|3342152|gb|AAD03844.1| antigen 5-related 2 [Drosophila melano...    38   0.25
gi|20978369|gb|AAM33434.1| pathogenesis-related protein 1 [Malus...    38   0.33
gi|13562126|gb|AAK29125.1| activation-associated secreted protei...    38   0.33
gi|21954552|dbj|BAC06345.1| gamete and mating-type specific prot...    38   0.33
gi|39588544|emb|CAE58067.1| Hypothetical protein CBG01146 [Caeno...    38   0.33
gi|15222863|ref|NP_175427.1| pathogenesis-related protein, putat...    37   0.43
gi|33347401|gb|AAQ15283.1| pathogenesis-related protein 1 [Pyrus...    37   0.43
gi|38344688|emb|CAE02369.2| OSJNBb0096E05.10 [Oryza sativa (japo...    37   0.43
gi|25296205|pir||A96537 hypothetical protein F2J10.7 [imported] ...    37   0.43
gi|20269910|gb|AAM18099.1| pathogenesis-related protein 1 [Pyrus...    37   0.56
gi|17566860|ref|NP_507654.1| CocoaCrisp precursor family member ...    37   0.73
gi|33991824|gb|AAH56553.1| LOC407645 protein [Danio rerio]             37   0.73
gi|32406422|ref|XP_323824.1| hypothetical protein [Neurospora cr...    37   0.73
gi|18568308|gb|AAL76024.1| putative secreted protein [Aedes aegy...    37   0.73
gi|39588594|emb|CAE58117.1| Hypothetical protein CBG01204 [Caeno...    36   0.95
gi|31217588|ref|XP_316456.1| ENSANGP00000025316 [Anopheles gambi...    36   0.95
gi|50252720|dbj|BAD28946.1| transcription factor EIL1-like [Oryz...    36   0.95
gi|28573640|ref|NP_611888.2| CG13569-PA [Drosophila melanogaster...    36   0.95
gi|2497543|sp|Q42954|KPYC_TOBAC Pyruvate kinase, cytosolic isozy...    36   1.2
gi|31979121|gb|AAP68776.1| antigen 5-related 2 salivary protein ...    36   1.2
gi|46229593|gb|EAK90411.1| extracellular protein with a signal p...    36   1.2
gi|12751380|gb|AAK07633.1| vespid allergen antigen-like protein ...    36   1.2
gi|38078337|ref|XP_357369.1| similar to chromosome 9 open readin...    35   1.6
gi|46439136|gb|EAK98457.1| hypothetical protein CaO19.8101 [Cand...    35   1.6
gi|2853293|gb|AAC02268.1| intestinal mucin [Homo sapiens]              35   1.6
gi|46439042|gb|EAK98364.1| hypothetical protein CaO19.470 [Candi...    35   1.6
gi|24216625|ref|NP_714106.1| transmembrane efflux pump protein [...    35   2.1
gi|45658956|ref|YP_003042.1| acriflavin resistance [Leptospira i...    35   2.1
gi|18478862|gb|AAL73347.1| putative esophageal gland cell secret...    35   2.1
gi|29248186|gb|EAA39726.1| GLP_14_5908_12108 [Giardia lamblia AT...    35   2.8
gi|29841084|gb|AAP06097.1| similar to GenBank Accession Number A...    35   2.8
gi|1523780|emb|CAA68959.1| putative transposase [Ascobolus immer...    35   2.8
gi|41406326|ref|NP_959162.1| EmbB [Mycobacterium avium subsp. pa...    35   2.8
gi|50736221|ref|XP_419085.1| PREDICTED: similar to chromosome 9 ...    35   2.8
gi|41147656|ref|XP_168583.4| similar to intestinal membrane muci...    34   3.6
gi|6322611|ref|NP_012685.1| Delayed Anaerobic Gene; Dan4p [Sacch...    34   3.6
gi|34501467|gb|AAK74120.3| mucin 16 [Homo sapiens]                     34   3.6
gi|24419041|gb|AAL65133.2| ovarian cancer related tumor marker C...    34   3.6
gi|49074026|ref|XP_401176.1| hypothetical protein UM03561.1 [Ust...    34   3.6
gi|38100315|gb|EAA47457.1| hypothetical protein MG02700.4 [Magna...    34   3.6
gi|46117448|ref|XP_384742.1| predicted protein [Gibberella zeae ...    34   4.7


>gi|25152554|ref|NP_741138.1| venom allergen 5, LONg body length
           LON-1 (lon-1) [Caenorhabditis elegans]
 gi|21328348|gb|AAM48531.1| Long protein 1, isoform c
           [Caenorhabditis elegans]
          Length = 287

 Score =  502 bits (1293), Expect = e-141
 Identities = 226/236 (95%), Positives = 226/236 (95%)
 Frame = +1

Query: 1   MNYXXXXXXXXXXPISVAYNVPHGFLTGEAVTSHSGPNDLDGELPATDEVKREKRGYFFP 180
           MNY          PISVAYNVPHGFLTGEAVTSHSGPNDLDGELPATDEVKREKRGYFFP
Sbjct: 1   MNYLLTALIALLAPISVAYNVPHGFLTGEAVTSHSGPNDLDGELPATDEVKREKRGYFFP 60

Query: 181 SHFQSDSGLLSRSEHPNEYLKKWITHEHNRYRRMVPASDMNMLYWSDELAASAQRHADTC 360
           SHFQSDSGLLSRSEHPNEYLKKWITHEHNRYRRMVPASDMNMLYWSDELAASAQRHADTC
Sbjct: 61  SHFQSDSGLLSRSEHPNEYLKKWITHEHNRYRRMVPASDMNMLYWSDELAASAQRHADTC 120

Query: 361 DFRHSRGRINVGENIWAAPYSNYSDAISIWFNEVHNPRCGCNHAYKHCCGHYVQVVWAKT 540
           DFRHSRGRINVGENIWAAPYSNYSDAISIWFNEVHNPRCGCNHAYKHCCGHYVQVVWAKT
Sbjct: 121 DFRHSRGRINVGENIWAAPYSNYSDAISIWFNEVHNPRCGCNHAYKHCCGHYVQVVWAKT 180

Query: 541 NLVGCGFSRCRDVQGVWGRGHRNVFVCHYNPQGKCSNCPANAPACYQGLCYMPKNY 708
           NLVGCGFSRCRDVQGVWGRGHRNVFVCHYNPQGKCSNCPANAPACYQGLCYMPKNY
Sbjct: 181 NLVGCGFSRCRDVQGVWGRGHRNVFVCHYNPQGKCSNCPANAPACYQGLCYMPKNY 236




[DB home][top]