Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F49A5_6
(1407 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17561198|ref|NP_507262.1| receptor 1 family member (5R344) [C... 756 0.0
gi|50507778|emb|CAB04419.2| Hypothetical protein F49A5.7 [Caenor... 718 0.0
gi|33300107|emb|CAE17834.1| Hypothetical protein F49A5.9 [Caenor... 321 2e-86
gi|17564684|ref|NP_507234.1| c-type lectin family member (5R217)... 308 2e-82
gi|34556084|emb|CAA19438.2| Hypothetical protein Y102A5B.2 [Caen... 293 5e-78
gi|17566360|ref|NP_507256.1| predicted CDS, c-type lectin family... 288 3e-76
gi|17561188|ref|NP_507258.1| predicted CDS, c-type lectin family... 262 1e-68
gi|34556083|emb|CAA19437.2| Hypothetical protein Y102A5B.3 [Caen... 258 2e-67
gi|17566362|ref|NP_507255.1| c-type lectin family member (5R330)... 236 1e-60
gi|17564688|ref|NP_507233.1| c-type lectin family member (5R214)... 234 5e-60
gi|17566358|ref|NP_507257.1| c-type lectin family member (5R335)... 218 3e-55
gi|32567058|ref|NP_507235.2| c-type lectin family member (41.9 k... 218 3e-55
gi|7508450|pir||T25279 hypothetical protein T25E12.9 - Caenorhab... 218 3e-55
gi|34555879|emb|CAB04422.2| Hypothetical protein Y102A5B.1 [Caen... 218 3e-55
gi|17564682|ref|NP_507236.1| predicted CDS, c-type lectin family... 214 4e-54
gi|34555888|emb|CAB04740.2| Hypothetical protein T20B3.12 [Caeno... 207 6e-52
gi|17564474|ref|NP_507254.1| predicted CDS, c-type lectin family... 207 6e-52
gi|34555878|emb|CAB04417.2| Hypothetical protein F49A5.5 [Caenor... 198 2e-49
gi|17564472|ref|NP_507253.1| predicted CDS, c-type lectin family... 193 7e-48
gi|17561192|ref|NP_507260.1| c-type lectin family member (5R341)... 187 5e-46
gi|17561194|ref|NP_507261.1| c-type lectin family member (5R343)... 175 3e-42
gi|17561190|ref|NP_507259.1| predicted CDS, c-type lectin family... 171 4e-41
gi|39586019|emb|CAE69095.1| Hypothetical protein CBG15117 [Caeno... 167 7e-40
gi|39585607|emb|CAE65367.1| Hypothetical protein CBG10312 [Caeno... 148 4e-34
gi|39585606|emb|CAE65366.1| Hypothetical protein CBG10311 [Caeno... 145 2e-33
gi|34555889|emb|CAB63316.2| Hypothetical protein T20B3.13 [Caeno... 140 7e-32
gi|17564476|ref|NP_507252.1| c-type lectin family member (5R320)... 140 7e-32
gi|17559516|ref|NP_504865.1| c-type lectin and CUB domain contai... 139 1e-31
gi|39583740|emb|CAE63844.1| Hypothetical protein CBG08400 [Caeno... 139 1e-31
gi|17537005|ref|NP_496688.1| predicted CDS, c-type lectin and CU... 139 2e-31
gi|7509603|pir||T26655 hypothetical protein Y38E10A.e - Caenorha... 139 2e-31
gi|17531345|ref|NP_494427.1| predicted CDS, c-type lectin and CU... 138 4e-31
gi|17507729|ref|NP_493109.1| predicted CDS, c-type lectin and CU... 137 8e-31
gi|17506207|ref|NP_493162.1| c-type lectin and CUB domain contai... 135 2e-30
gi|39582412|emb|CAE74796.1| Hypothetical protein CBG22627 [Caeno... 135 3e-30
gi|17552510|ref|NP_498023.1| predicted CDS, c-type lectin and CU... 132 2e-29
gi|17506483|ref|NP_493152.1| c-type lectin and CUB domain contai... 131 3e-29
gi|32565327|ref|NP_494426.2| c-type lectin and CUB domain contai... 131 4e-29
gi|39585605|emb|CAE65365.1| Hypothetical protein CBG10310 [Caeno... 130 6e-29
gi|39587832|emb|CAE67850.1| Hypothetical protein CBG13437 [Caeno... 130 6e-29
gi|17509297|ref|NP_493166.1| predicted CDS, tolloid like family ... 129 2e-28
gi|17552508|ref|NP_498022.1| c-type lectin and CUB domain contai... 129 2e-28
gi|39587833|emb|CAE67851.1| Hypothetical protein CBG13439 [Caeno... 127 6e-28
gi|17507929|ref|NP_493197.1| c-type lectin and CUB domain contai... 127 6e-28
gi|39593191|emb|CAE64660.1| Hypothetical protein CBG09432 [Caeno... 126 1e-27
gi|17557350|ref|NP_506271.1| c-type lectin and CUB domain contai... 123 1e-26
gi|2146870|pir||S72579 hypothetical protein C35D10.1 - Caenorhab... 122 3e-26
gi|17537003|ref|NP_496687.1| CUB Sushi multiple domains 1 family... 121 4e-26
gi|39585604|emb|CAE65364.1| Hypothetical protein CBG10309 [Caeno... 116 1e-24
gi|34555967|emb|CAB16536.2| Hypothetical protein Y70C5C.2 [Caeno... 116 1e-24
gi|32564282|ref|NP_493725.2| c-type lectin and CUB domain contai... 114 6e-24
gi|7495300|pir||T32032 hypothetical protein C03H5.1 - Caenorhabd... 114 6e-24
gi|17507931|ref|NP_493198.1| c-type lectin family member (1N229)... 112 2e-23
gi|17559776|ref|NP_507557.1| c-type lectin and CUB domain contai... 111 5e-23
gi|39587021|emb|CAE62956.1| Hypothetical protein CBG07170 [Caeno... 109 1e-22
gi|17535979|ref|NP_494826.1| phospholipase a2 receptor precursor... 108 3e-22
gi|17535547|ref|NP_493851.1| predicted CDS, receptor for egg jel... 108 4e-22
gi|39583088|emb|CAE60628.1| Hypothetical protein CBG04271 [Caeno... 105 3e-21
gi|39587019|emb|CAE62954.1| Hypothetical protein CBG07168 [Caeno... 100 6e-20
gi|39587020|emb|CAE62955.1| Hypothetical protein CBG07169 [Caeno... 100 1e-19
gi|39587016|emb|CAE62951.1| Hypothetical protein CBG07164 [Caeno... 98 5e-19
gi|17536121|ref|NP_494002.1| predicted CDS, tolloid-like family ... 96 2e-18
gi|39587018|emb|CAE62953.1| Hypothetical protein CBG07167 [Caeno... 96 3e-18
gi|39582434|emb|CAE74818.1| Hypothetical protein CBG22654 [Caeno... 95 4e-18
gi|39587015|emb|CAE62950.1| Hypothetical protein CBG07163 [Caeno... 93 2e-17
gi|17535525|ref|NP_493859.1| c-type lectin and CUB domain contai... 91 7e-17
gi|38176036|gb|AAB66231.2| Hypothetical protein R07C3.1 [Caenorh... 91 7e-17
gi|39587014|emb|CAE62949.1| Hypothetical protein CBG07162 [Caeno... 89 2e-16
gi|39581281|emb|CAE60027.1| Hypothetical protein CBG03533 [Caeno... 88 4e-16
gi|39588702|emb|CAE58226.1| Hypothetical protein CBG01323 [Caeno... 88 4e-16
gi|39583087|emb|CAE60627.1| Hypothetical protein CBG04270 [Caeno... 87 1e-15
gi|7497310|pir||T32326 hypothetical protein C41H7.7 - Caenorhabd... 87 1e-15
gi|39587831|emb|CAE67849.1| Hypothetical protein CBG13436 [Caeno... 84 6e-15
gi|17536123|ref|NP_494003.1| predicted CDS, CUB sushi multiple d... 83 2e-14
gi|17533765|ref|NP_494066.1| c-type lectin family member (2C33) ... 81 7e-14
gi|39585600|emb|CAE65360.1| Hypothetical protein CBG10305 [Caeno... 80 1e-13
gi|17566216|ref|NP_507227.1| c-type lectin and CUB domain contai... 78 4e-13
gi|39587013|emb|CAE62948.1| Hypothetical protein CBG07161 [Caeno... 74 6e-12
gi|39585608|emb|CAE65368.1| Hypothetical protein CBG10313 [Caeno... 72 2e-11
gi|17559330|ref|NP_504977.1| c-type lectin precursor family memb... 70 9e-11
gi|4505245|ref|NP_002429.1| mannose receptor C type 1 precursor;... 65 3e-09
gi|19923389|ref|NP_031392.2| phospholipase A2 receptor 1 [Homo s... 64 9e-09
gi|39592788|emb|CAE62402.1| Hypothetical protein CBG06489 [Caeno... 63 2e-08
gi|17564166|ref|NP_506744.1| low affinity IgE Fc receptor B fami... 62 3e-08
gi|38569737|gb|AAR24388.1| mannose receptor C1 [Sus scrofa] 62 4e-08
gi|1352704|sp|P49259|PA2R_BOVIN 180 kDa secretory phospholipase ... 60 2e-07
gi|39593192|emb|CAE64661.1| Hypothetical protein CBG09433 [Caeno... 59 2e-07
gi|6678932|ref|NP_032651.1| mannose receptor, C type 1 [Mus musc... 57 8e-07
gi|50732399|ref|XP_418617.1| PREDICTED: similar to Macrophage ma... 57 1e-06
gi|39588704|emb|CAE58228.1| Hypothetical protein CBG01325 [Caeno... 57 1e-06
gi|34877265|ref|XP_225585.2| similar to macrophage mannose recep... 57 1e-06
gi|1352705|sp|P49260|PA2R_RABIT 180 kDa secretory phospholipase ... 56 2e-06
gi|477362|pir||A48925 mannose receptor precursor, macrophage - m... 56 2e-06
gi|46195838|ref|NP_996866.1| yolk sac IgY receptor [Gallus gallu... 55 4e-06
gi|50732401|ref|XP_418618.1| PREDICTED: similar to Macrophage ma... 55 5e-06
gi|47219898|emb|CAF97168.1| unnamed protein product [Tetraodon n... 54 9e-06
gi|50760588|ref|XP_418071.1| PREDICTED: similar to mannose recep... 54 1e-05
gi|6679365|ref|NP_032893.1| phospholipase A2, group IB, pancreas... 54 1e-05
gi|26331710|dbj|BAC29585.1| unnamed protein product [Mus musculus] 53 2e-05
gi|5174485|ref|NP_006030.1| mannose receptor, C type 2; endocyti... 52 3e-05
gi|4835878|gb|AAD30280.1| endocytic receptor Endo180 [Homo sapiens] 52 3e-05
gi|40788335|dbj|BAA31684.2| KIAA0709 protein [Homo sapiens] 52 3e-05
gi|3695055|gb|AAC62622.1| gp200-MR6 [Homo sapiens] 52 3e-05
gi|4505053|ref|NP_002340.1| lymphocyte antigen 75 [Homo sapiens]... 52 3e-05
gi|17557348|ref|NP_506270.1| c-type lectin family member (5N612C... 52 4e-05
gi|39583086|emb|CAE60626.1| Hypothetical protein CBG04269 [Caeno... 51 6e-05
gi|47230595|emb|CAF99788.1| unnamed protein product [Tetraodon n... 51 8e-05
gi|6677703|ref|NP_033068.1| regenerating islet-derived 1; rat re... 51 8e-05
gi|50732663|ref|XP_425982.1| PREDICTED: similar to Macrophage ma... 51 8e-05
gi|26344636|dbj|BAC35967.1| unnamed protein product [Mus musculus] 51 8e-05
gi|6678934|ref|NP_032652.1| mannose receptor, C type 2; novel le... 49 2e-04
gi|33332305|gb|AAQ11364.1| crotocetin-1 [Crotalus durissus terri... 49 4e-04
gi|6677705|ref|NP_033069.1| regenerating islet-derived 2; rat re... 48 5e-04
gi|6981470|ref|NP_036773.1| regenerating islet-derived 1; RATLIT... 48 6e-04
gi|47217439|emb|CAG10208.1| unnamed protein product [Tetraodon n... 48 6e-04
gi|39590706|emb|CAE65076.1| Hypothetical protein CBG09931 [Caeno... 48 6e-04
gi|11277028|pir||JC7134 agkisacutacin alpha chain precursor - sh... 47 8e-04
gi|1082777|pir||B56395 secretory phospholipase A2 receptor precu... 47 8e-04
gi|14719570|pdb|1IOD|A Chain A, Crystal Structure Of The Complex... 47 8e-04
gi|20562937|gb|AAM22786.1| ACF 1/2 A-chain [Deinagkistrodon acutus] 47 0.001
gi|8980619|dbj|BAA99281.1| anticoagulant protein A [Deinagkistro... 47 0.001
gi|20273044|gb|AAF26286.2| agkisacutacin A chain [Deinagkistrodo... 46 0.002
gi|17542436|ref|NP_500843.1| core protein (4G419) [Caenorhabditi... 45 0.003
gi|17544700|ref|NP_502450.1| serum lectin like precursor family ... 45 0.003
gi|18875404|ref|NP_573501.1| CD209a antigen [Mus musculus] >gnl|... 45 0.004
gi|16660119|gb|AAL27539.1| DC-SIGN neck-less isoform [Mus musculus] 45 0.004
gi|16923223|gb|AAL29940.1| lectin 1 [Girardia tigrina] 45 0.004
gi|17538258|ref|NP_501369.1| mannose receptor C type family memb... 45 0.004
gi|39588321|emb|CAE72672.1| Hypothetical protein CBG19888 [Caeno... 44 0.009
gi|20562945|gb|AAM22790.1| antithrombin A A-chain [Deinagkistrod... 44 0.009
gi|25090033|sp|O93426|CVXA_CRODU Convulxin alpha precursor (CVX ... 44 0.009
gi|11967285|gb|AAG42040.1| agkicetin alpha subunit precursor [De... 44 0.009
gi|17551160|ref|NP_509202.1| lithostathine like precursor family... 44 0.009
gi|38493075|pdb|1UOS|A Chain A, The Crystal Structure Of The Sna... 44 0.009
gi|20562939|gb|AAM22787.1| C-type lectin [Deinagkistrodon acutus... 44 0.009
gi|17508839|ref|NP_491247.1| mannose receptor C type family memb... 44 0.012
gi|2736145|gb|AAB94071.1| mannan-binding lectin; collectin [Gall... 43 0.021
gi|6980876|pdb|1QDD|A Chain A, Crystal Structure Of Human Lithos... 43 0.021
gi|1709255|sp|P55066|PGCN_MOUSE Neurocan core protein precursor ... 43 0.021
gi|40789268|ref|NP_031815.2| chondroitin sulfate proteoglycan 3 ... 43 0.021
gi|37993393|gb|AAR06852.1| C-type lectin-2 [Bitis gabonica] 43 0.021
gi|26349637|dbj|BAC38458.1| unnamed protein product [Mus musculus] 43 0.021
gi|25245561|gb|AAN72438.1| flavocetin-A alpha chain [Trimeresuru... 43 0.021
gi|18252680|gb|AAL66391.1| antithrombin 1 A chain [Deinagkistrod... 43 0.021
gi|45383456|ref|NP_989680.1| mannose binding lectin, liver (A) [... 43 0.021
gi|1364010|pir||JC4329 coagulation factor IX-binding protein A c... 43 0.021
gi|23321261|gb|AAN23125.1| agglucetin-alpha 2 subunit precursor ... 42 0.027
gi|45382043|ref|NP_990071.1| neurocan core protein precursor [Ga... 42 0.035
gi|1942639|pdb|1LIT| Human Lithostathine 42 0.046
gi|13928904|ref|NP_113841.1| chondroitin sulfate proteoglycan 3 ... 42 0.046
gi|50793953|ref|XP_423644.1| PREDICTED: similar to C-type lectin... 42 0.046
gi|34877453|ref|XP_346488.1| hypothetical protein XP_346487 [Rat... 42 0.046
gi|3288885|gb|AAC25581.1| PGCN_HUMAN, PARTIAL CDS; 245 KD EARLY ... 42 0.046
gi|321190|pir||A45751 pancreatic stone protein precursor - human... 42 0.046
gi|29725633|ref|NP_002900.2| regenerating islet-derived 1 alpha ... 42 0.046
gi|27530675|dbj|BAC54021.1| C-type lectin 2 [Anguilla japonica] 42 0.046
gi|4758084|ref|NP_004377.1| chondroitin sulfate proteoglycan 3 (... 42 0.046
gi|11066256|gb|AAG28522.1| halyxin B-chain precursor [Gloydius h... 41 0.060
gi|34851945|ref|XP_344774.1| similar to C-type lectin superfamil... 41 0.060
gi|47203231|emb|CAF92548.1| unnamed protein product [Tetraodon n... 41 0.060
gi|37183194|gb|AAQ89397.1| COLEC10 [Homo sapiens] 41 0.060
gi|34870126|ref|XP_221778.2| similar to DC-SIGN [Rattus norvegicus] 41 0.060
gi|3287904|sp|P81398|RHCB_AGKRH Rhodocetin beta subunit 41 0.060
gi|39587489|emb|CAE58427.1| Hypothetical protein CBG01558 [Caeno... 41 0.079
gi|28488673|ref|XP_286121.1| similar to C-type lectin superfamil... 41 0.079
gi|7245412|pdb|1C3A|A Chain A, Crystal Structure Of Flavocetin-A... 41 0.079
gi|4337052|gb|AAD18056.1| fibrinogen clotting inhibitor B chain ... 40 0.10
gi|37181877|gb|AAQ88742.1| CLECSF1 [Homo sapiens] 40 0.10
gi|3023233|sp|P81115|ABBA_TRIAB Alboaggregin B alpha subunit 40 0.10
gi|5031637|ref|NP_005743.1| C-type lectin, superfamily member 1 ... 40 0.10
gi|17538262|ref|NP_501371.1| mannose receptor C type precursor f... 40 0.10
gi|18307446|emb|CAA91440.2| C-type lectin-like protein [Girardia... 40 0.13
gi|16923234|gb|AAL29933.1| scarf2 [Girardia tigrina] 40 0.13
gi|5453619|ref|NP_006429.1| collectin sub-family member 10; coll... 40 0.13
gi|16923238|gb|AAL29935.1| scarf3b [Girardia tigrina] 40 0.13
gi|13810902|gb|AAK40085.1| brevican soluble core protein precurs... 40 0.13
gi|17552078|ref|NP_499148.1| predicted CDS, lectin 2b like famil... 40 0.13
gi|190981|gb|AAA36559.1| regenerating protein (reg) 40 0.13
gi|7949133|ref|NP_037010.1| surfactant associated protein D; Pul... 40 0.13
gi|130307|sp|P21755|PLIA_TRIFL Phospholipase A2 inhibitor subuni... 40 0.13
gi|17566234|ref|NP_503855.1| c-type lectin family member (5D599)... 40 0.13
gi|33341202|gb|AAQ15162.1| stejaggregin-B alpha chain-3 [Trimere... 40 0.18
gi|399125|sp|P22029|BOTA_BOTJA Botrocetin, alpha chain (Platelet... 40 0.18
gi|27718901|ref|XP_235330.1| similar to collectin liver 1; colle... 40 0.18
gi|547847|sp|Q02988|LECA_PLEWA Lectin precursor >gnl|BL_ORD_ID|8... 40 0.18
gi|50744990|ref|XP_426207.1| PREDICTED: similar to collectin sub... 40 0.18
gi|37575443|gb|AAQ93686.1| mucrocetin alpha chain [Protobothrops... 40 0.18
gi|34013702|gb|AAQ56014.1| lectin protein type III [Hippocampus ... 40 0.18
gi|21260582|gb|AAM43808.1| C-type lectin-like protein TMVA A cha... 40 0.18
gi|6467181|dbj|BAA86972.1| phospholipase A2 inhibitor alfa [Agki... 40 0.18
gi|130308|sp|P21756|PLIB_TRIFL Phospholipase A2 inhibitor subuni... 40 0.18
gi|39655009|pdb|1V4L|A Chain A, Crystal Structure Of A Platelet ... 40 0.18
gi|33638231|gb|AAQ24216.1| coagulation factor IX-binding protein... 40 0.18
gi|3023230|sp|P81112|ABA2_TRIAB Alboaggregin A subunit 2 40 0.18
gi|2851436|sp|P23807|IXB_TRIFL Coagulation factor IX/factor X-bi... 39 0.23
gi|26326981|dbj|BAC27234.1| unnamed protein product [Mus musculus] 39 0.23
gi|38049424|ref|XP_283054.2| collectin sub-family member 11 [Mus... 39 0.23
gi|16923229|gb|AAL29936.1| lectin 2c [Girardia tigrina] 39 0.23
gi|34853015|ref|XP_215451.2| similar to Versican core protein pr... 39 0.23
gi|27670608|ref|XP_221686.1| similar to c-type lectin protein MT... 39 0.23
gi|12851982|dbj|BAB29226.1| unnamed protein product [Mus musculus] 39 0.23
gi|3309591|gb|AAC26116.1| versican V3 isoform precursor [Rattus ... 39 0.23
gi|1008921|dbj|BAA06802.1| proteoglycan PG-M(V3) [Mus musculus] 39 0.23
gi|47226732|emb|CAG07891.1| unnamed protein product [Tetraodon n... 39 0.23
gi|2137709|pir||A55535 versican precursor - mouse >gnl|BL_ORD_ID... 39 0.23
gi|2497660|sp|Q62059|PGCV_MOUSE Versican core protein precursor ... 39 0.23
gi|27807147|ref|NP_777058.1| domain) lectin, superfamily member ... 39 0.23
gi|23477368|gb|AAN34657.1| phospholipase A2 myotoxin inhibitor p... 39 0.23
gi|10835248|ref|NP_006498.1| regenerating islet-derived 1 beta p... 39 0.23
gi|27530677|dbj|BAC54022.1| C-type lectin 1 [Anguilla japonica] 39 0.23
gi|21431626|sp||Q9ERB4_2 [Segment 2 of 2] Versican core protein ... 39 0.23
gi|26345454|dbj|BAC36378.1| unnamed protein product [Mus musculus] 39 0.23
gi|3212544|pdb|1IXX|B Chain B, Crystal Structure Of Coagulation ... 39 0.23
gi|33416211|gb|AAQ18640.1| factor IX binding protein A chain [Gl... 39 0.23
gi|13928848|ref|NP_113807.1| proteoglycan 2, bone marrow [Rattus... 39 0.30
gi|27691552|ref|XP_221781.1| similar to SIGNR2 [Rattus norvegicus] 39 0.30
gi|47551233|ref|NP_999801.1| receptor for egg jelly 3 [Strongylo... 39 0.30
gi|17543574|ref|NP_500262.1| c-type lectin precursor family memb... 39 0.30
gi|34863397|ref|XP_345653.1| similar to hypothetical protein MGC... 39 0.30
gi|6467183|dbj|BAA86973.1| phospholipase A2 inhibitor alpha isof... 39 0.30
gi|7994666|sp|P82142|PLIA_AGKBL Phospholipase A2 inhibitor subun... 39 0.30
gi|45382787|ref|NP_989997.1| tetranectin [Gallus gallus] >gnl|BL... 39 0.30
gi|1083928|pir||JP0075 lectin CEL-IV, C-type - Cucumaria echinat... 39 0.39
gi|33341190|gb|AAQ15156.1| factor IX/X binding protein beta chai... 39 0.39
gi|12583677|dbj|BAB21452.1| factor XI/factor X binding protein A... 39 0.39
gi|2851435|sp|P23806|IXA_TRIFL Coagulation factor IX/factor X-bi... 39 0.39
gi|33243094|gb|AAQ01217.1| C-type lectin CTL-9 [Echis carinatus ... 39 0.39
gi|47228554|emb|CAG05374.1| unnamed protein product [Tetraodon n... 39 0.39
gi|27721871|ref|XP_236746.1| similar to tetranectin [Rattus norv... 39 0.39
gi|4507557|ref|NP_003269.1| tetranectin (plasminogen binding pro... 39 0.39
gi|5174531|ref|NP_006084.1| proteoglycan 3; prepro-major basic p... 39 0.39
gi|665485|gb|AAA96811.1| tetranectin 39 0.39
gi|16923225|gb|AAL29932.1| lectin 2a [Girardia tigrina] 39 0.39
gi|20977545|ref|NP_624360.1| chondrolectin [Mus musculus] >gnl|B... 39 0.39
gi|39587916|emb|CAE67935.1| Hypothetical protein CBG13535 [Caeno... 39 0.39
gi|3212622|pdb|1TN3| The C-Type Lectin Carbohydrate Recognition... 39 0.39
gi|10120636|pdb|1EGG|A Chain A, Structure Of A C-Type Carbohydra... 39 0.39
gi|47682816|gb|AAH70507.1| Surfactant associated protein D [Ratt... 39 0.39
gi|39580712|emb|CAE64098.1| Hypothetical protein CBG08706 [Caeno... 39 0.39
gi|2781225|pdb|1HTN| Human Tetranectin, A Trimeric Plasminogen ... 39 0.39
gi|3212543|pdb|1IXX|A Chain A, Crystal Structure Of Coagulation ... 39 0.39
gi|3253302|gb|AAC24359.1| versican V1 splice-variant precursor [... 38 0.51
gi|6755821|ref|NP_035736.1| tetranectin (plasminogen binding pro... 38 0.51
gi|23272041|gb|AAH35043.1| Tetranectin (plasminogen binding prot... 38 0.51
gi|7513547|pir||T14274 versican precursor, splice form V2 - bovi... 38 0.51
gi|3253306|gb|AAC24361.1| versican V3 splice-variant precursor [... 38 0.51
gi|13128972|ref|NP_076932.1| collectin sub-family member 11 isof... 38 0.51
gi|30794358|ref|NP_851378.1| versican; chondroitin sulfate prote... 38 0.51
gi|47216660|emb|CAG04858.1| unnamed protein product [Tetraodon n... 38 0.51
gi|40548420|ref|NP_954705.1| collectin sub-family member 11 isof... 38 0.51
gi|17559336|ref|NP_504976.1| predicted CDS, tetranectin like pre... 38 0.67
gi|10441756|gb|AAG17178.1| halyxin A-chain precursor [Gloydius h... 38 0.67
gi|833853|gb|AAA67565.1| versican V2 core protein precursor 38 0.67
gi|8394042|ref|NP_058610.1| proteoglycan 3; major basic protein ... 38 0.67
gi|21361116|ref|NP_004376.2| chondroitin sulfate proteoglycan 2 ... 38 0.67
gi|46048882|ref|NP_990118.1| proteoglycan [Gallus gallus] >gnl|B... 38 0.67
gi|18777733|ref|NP_570973.1| CD209c antigen [Mus musculus] >gnl|... 38 0.67
gi|1008913|dbj|BAA06801.1| proteoglycan PG-M(V3) [Homo sapiens] 38 0.67
gi|482656|pir||A60979 versican precursor - human >gnl|BL_ORD_ID|... 38 0.67
gi|17553354|ref|NP_497168.1| predicted CDS, C type lectin (3A790... 38 0.67
gi|39579883|emb|CAE56619.1| Hypothetical protein CBG24375 [Caeno... 38 0.67
gi|7804476|dbj|BAA95671.1| C-type lectin [Cyprinus carpio] 38 0.67
gi|34364950|emb|CAE46022.1| hypothetical protein [Homo sapiens] 38 0.67
gi|19921688|ref|NP_610207.1| CG8343-PA [Drosophila melanogaster]... 38 0.67
gi|505285|emb|CAA42787.1| proteoglycan [Gallus gallus] 38 0.67
gi|48476214|gb|AAT44382.1| REJ3CRD [Allocentrotus fragilis] 38 0.67
gi|387017|gb|AAA36437.1| chondroitin sulfate proteoglycan core p... 38 0.67
gi|34810678|pdb|1PW9|A Chain A, High Resolution Crystal Structur... 37 0.87
gi|16923236|gb|AAL29939.1| scarf3a [Girardia tigrina] 37 0.87
gi|33341200|gb|AAQ15161.1| stejaggregin-B alpha chain-2 [Trimere... 37 0.87
gi|33341208|gb|AAQ15165.1| stejaggregin-B alpha chain-4 [Trimere... 37 0.87
gi|33341198|gb|AAQ15160.1| stejaggregin-B alpha chain-1 [Trimere... 37 0.87
gi|1839441|gb|AAB47092.1| platelet glycoprotein Ib-binding prote... 37 0.87
gi|32564770|ref|NP_872000.1| BTB/POZ domain containing protein f... 37 0.87
gi|4321120|gb|AAA29218.2| tyrosine kinase receptor [Hydra vulgaris] 37 0.87
gi|17565466|ref|NP_507951.1| lithostathine like family member (5... 37 0.87
gi|6573319|pdb|1B08|A Chain A, Lung Surfactant Protein D (Sp-D) ... 37 0.87
gi|25395460|pir||H88094 protein F39E9.2 [imported] - Caenorhabdi... 37 0.87
gi|39588559|emb|CAE58082.1| Hypothetical protein CBG01163 [Caeno... 37 0.87
gi|38176075|gb|AAC69343.2| Hypothetical protein Y73C8C.2 [Caenor... 37 0.87
gi|42476330|ref|NP_003010.3| surfactant, pulmonary-associated pr... 37 0.87
gi|49456851|emb|CAG46746.1| SFTPD [Homo sapiens] 37 0.87
gi|464486|sp|P35247|PSPD_HUMAN Pulmonary surfactant-associated p... 37 0.87
gi|18490171|gb|AAH22318.1| Surfactant, pulmonary-associated prot... 37 0.87
gi|27805091|gb|AAO22991.1| surfactant, pulmonary-associated prot... 37 0.87
gi|48476216|gb|AAT44383.1| REJ3CRD [Hemicentrotus pulcherrimus] 37 0.87
gi|48476198|gb|AAT44374.1| REJ1CRD2 [Strongylocentrotus francisc... 37 0.87
gi|1478015|gb|AAB36402.1| ECLV IX/X-bp beta subunit=Ca(2+)-depen... 37 0.87
gi|48476190|gb|AAT44370.1| REJ1CRD2 [Hemicentrotus pulcherrimus] 37 0.87
gi|47550825|ref|NP_999853.1| dermacan [Danio rerio] >gnl|BL_ORD_... 37 1.1
gi|33243072|gb|AAQ01206.1| C-type lectin CTL-1 [Bitis arietans] 37 1.1
gi|31075310|gb|AAP43904.1| chondrolectin variant CHODLFdeltaE [H... 37 1.1
gi|33243082|gb|AAQ01211.1| C-type lectin CTL-1 [Echis ocellatus] 37 1.1
gi|50730821|ref|XP_417032.1| PREDICTED: similar to antithrombin ... 37 1.1
gi|20127636|ref|NP_079220.2| chondrolectin precursor; transmembr... 37 1.1
gi|225342|prf||1301209A lectin 37 1.1
gi|625318|pir||LNRC1 lectin BRA3-1 precursor - barnacle (Megabal... 37 1.1
gi|625317|pir||LNRC3 lectin BRA3-2 precursor - barnacle (Megabal... 37 1.1
gi|1730116|sp|P07439|LEC3_MEGRO Lectin BRA-3 precursor >gnl|BL_O... 37 1.1
gi|10434231|dbj|BAB14181.1| unnamed protein product [Homo sapien... 37 1.1
gi|50749166|ref|XP_421514.1| PREDICTED: similar to surfactant pr... 37 1.1
gi|10445213|gb|AAG16631.1| proteoglycan PG-M V3 isoform [Rattus ... 37 1.1
gi|39588558|emb|CAE58081.1| Hypothetical protein CBG01162 [Caeno... 37 1.1
gi|29742606|ref|XP_290866.1| similar to 4930572L20Rik protein [H... 37 1.1
gi|47227540|emb|CAG04688.1| unnamed protein product [Tetraodon n... 37 1.5
gi|33341186|gb|AAQ15154.1| factor IX/X binding protein beta chai... 37 1.5
gi|11276914|pir||T46256 brevican - human (fragment) >gnl|BL_ORD_... 37 1.5
gi|16923227|gb|AAL29934.1| lectin 2b [Girardia tigrina] 37 1.5
gi|14318638|gb|AAH09117.1| Brevican, isoform 1 [Homo sapiens] >g... 37 1.5
gi|18605564|gb|AAH22938.1| Brevican, isoform 1 [Homo sapiens] 37 1.5
gi|38372935|ref|NP_068767.3| brevican isoform 1; chondroitin sul... 37 1.5
gi|189601|gb|AAA36415.1| pancreatitis associated protein 37 1.5
gi|39590774|emb|CAE65147.1| Hypothetical protein CBG10013 [Caeno... 37 1.5
gi|17385630|dbj|BAB78598.1| GalNAc-specific lectin [Asterina pec... 37 1.5
gi|13445904|gb|AAK26430.1| agkisasin-b [Deinagkistrodon acutus] 37 1.5
gi|31559055|gb|AAP50528.1| agkisasin-b [Deinagkistrodon acutus] 37 1.5
gi|31075306|gb|AAP43902.1| chondrolectin variant CHODLdeltaE [Ho... 36 1.9
gi|27803388|gb|AAO19649.1| CD94-1/NKR-P1-related receptor [Botry... 36 1.9
gi|42543880|pdb|1UV0|A Chain A, Pancreatitis-Associated Protein ... 36 1.9
gi|4505605|ref|NP_002571.1| pancreatitis-associated protein prec... 36 1.9
gi|27530341|dbj|BAC53954.1| collectin-L1 [Mus musculus] 36 1.9
gi|27734138|ref|NP_775598.1| collectin liver 1; collectin-L1 [Mu... 36 1.9
gi|47225069|emb|CAF97484.1| unnamed protein product [Tetraodon n... 36 1.9
gi|135619|sp|P26258|TETN_CARSP Tetranectin-like protein >gnl|BL_... 36 1.9
gi|32330807|gb|AAP79899.1| DEC-205/DCL-1 fusion protein variant ... 36 2.5
gi|33243078|gb|AAQ01209.1| C-type lectin CTL-6 [Bitis arietans] 36 2.5
gi|27806731|ref|NP_776421.1| chondroitin sulfate proteoglycan BE... 36 2.5
gi|47523028|ref|NP_999275.1| lung surfactant protein D [Sus scro... 36 2.5
gi|32307817|gb|AAN85434.1| DEC-205/DCL-1 fusion protein variant ... 36 2.5
gi|6755310|ref|NP_035390.1| regenerating islet-derived 3 gamma; ... 36 2.5
gi|6677921|ref|NP_033186.1| surfactant associated protein D [Mus... 36 2.5
gi|7416081|dbj|BAA93690.1| haustellum specific protein A [Sarcop... 36 2.5
gi|31198957|ref|XP_308426.1| ENSANGP00000018331 [Anopheles gambi... 36 2.5
gi|7512195|pir||PC7027 aggretin alpha chain - Malayan pit viper ... 35 3.3
gi|6174903|sp|P13608|PGCA_BOVIN Aggrecan core protein precursor ... 35 3.3
gi|21260584|gb|AAM43809.1| C-type lectin-like protein TMVA B cha... 35 3.3
gi|33332301|gb|AAQ11362.1| convulxin subunit b [Crotalus durissu... 35 3.3
gi|1083074|pir||A39808 proteoglycan core protein, cartilage - bo... 35 3.3
gi|34013700|gb|AAQ56013.1| lectin protein type II [Hippocampus c... 35 3.3
gi|27806761|ref|NP_776406.1| aggrecan 1 (chondroitin sulfate pro... 35 3.3
gi|30354370|gb|AAH52032.1| Brevican [Mus musculus] 35 3.3
gi|1143285|gb|AAA87847.1| brevican core protein 35 3.3
gi|6671618|ref|NP_031555.1| brevican [Mus musculus] >gnl|BL_ORD_... 35 3.3
gi|37953324|gb|AAP44494.1| aggrecan [Bos taurus] 35 3.3
gi|8809812|gb|AAF79952.1| aggretin alpha chain [Calloselasma rho... 35 3.3
gi|34098771|sp|Q9YI92|MMHB_AGKHA Mamushigin beta chain precursor... 35 4.3
gi|6715115|gb|AAF26287.1| agkisacutacin B chain [Deinagkistrodon... 35 4.3
gi|11277029|pir||JC7135 agkisacutacin beta chain precursor - sha... 35 4.3
gi|6680734|ref|NP_031519.1| asialoglycoprotein receptor 2 [Mus m... 35 4.3
gi|20562943|gb|AAM22789.1| ACF 1/2 B-chain [Deinagkistrodon acutus] 35 4.3
gi|6679457|ref|NP_032946.1| proteoglycan 2, bone marrow [Mus mus... 35 4.3
gi|39584564|emb|CAE74642.1| Hypothetical protein CBG22438 [Caeno... 35 4.3
gi|34856500|ref|XP_230054.2| similar to eosinophil major basic p... 35 4.3
gi|34013698|gb|AAQ56012.1| lectin protein type I [Hippocampus co... 35 4.3
gi|2134245|pir||JC5059 bitiscetin beta chain - puff adder >gnl|B... 35 4.3
gi|48476186|gb|AAT44368.1| REJ1CRD2 [Allocentrotus fragilis] 35 4.3
gi|1514645|emb|CAA42701.1| cartilage aggregating proteoglycan [S... 35 5.6
gi|33341184|gb|AAQ15153.1| factor IX/X binding protein alpha cha... 35 5.6
gi|33243086|gb|AAQ01213.1| C-type lectin CTL-3 [Echis carinatus ... 35 5.6
gi|33243080|gb|AAQ01210.1| C-type lectin CTL-8 [Bitis arietans] ... 35 5.6
gi|25090034|sp|O93427|CVXB_CRODU Convulxin beta precursor (CVX b... 35 5.6
gi|4501991|ref|NP_001126.1| aggrecan 1 isoform 1 precursor; Aggr... 35 5.6
gi|47208881|emb|CAF98183.1| unnamed protein product [Tetraodon n... 35 5.6
gi|18252678|gb|AAL66390.1| antithrombin 1 B chain [Deinagkistrod... 35 5.6
gi|47222448|emb|CAG12968.1| unnamed protein product [Tetraodon n... 35 5.6
gi|30249|emb|CAA35463.1| cartilage specific proteoglycan (600 AA... 35 5.6
gi|181168|gb|AAA35726.1| proteoglycan core protein 35 5.6
gi|2506815|sp|P55068|PGCB_RAT Brevican core protein precursor (B... 35 5.6
gi|28981404|gb|AAH48780.1| Similar to phospholipase A2, group IB... 35 5.6
gi|47551243|ref|NP_999802.1| receptor for egg jelly 2 protein [S... 35 5.6
gi|25756916|pir||A39086 aggrecan precursor, cartilage long splic... 35 5.6
gi|129886|sp|P16112|PGCA_HUMAN Aggrecan core protein precursor (... 35 5.6
gi|6995994|ref|NP_037359.1| aggrecan 1 isoform 2 precursor; Aggr... 35 5.6
gi|47195820|emb|CAF88787.1| unnamed protein product [Tetraodon n... 35 5.6
gi|2134244|pir||JC5058 bitiscetin alpha chain - puff adder >gnl|... 35 5.6
gi|38493076|pdb|1UOS|B Chain B, The Crystal Structure Of The Sna... 35 5.6
gi|39654959|pdb|1UMR|C Chain C, Crystal Structure Of The Platele... 35 5.6
gi|12060181|dbj|BAB20441.1| anticoagulant protein-B [Deinagkistr... 34 7.4
gi|23321263|gb|AAN23126.1| agglucetin-beta 1 subunit precursor [... 34 7.4
gi|11967287|gb|AAG42041.1| agkicetin beta subunit precursor [Dei... 34 7.4
gi|25245527|gb|AAN72437.1| flavocetin-A beta chain [Trimeresurus... 34 7.4
gi|33341210|gb|AAQ15166.1| stejaggregin-A alpha chain [Trimeresu... 34 7.4
gi|33667103|ref|NP_878910.1| C-type lectin, superfamily member 1... 34 7.4
gi|5453684|ref|NP_006335.1| C-type (calcium dependent, carbohydr... 34 7.4
gi|33341192|gb|AAQ15157.1| factor IX/X binding protein beta chai... 34 7.4
gi|48476218|gb|AAT44384.1| REJ3CRD [Strongylocentrotus droebachi... 34 7.4
gi|48476222|gb|AAT44386.1| REJ3CRD [Strongylocentrotus pallidus] 34 7.4
gi|14579651|gb|AAK69351.1| akitonin precursor [Deinagkistrodon a... 34 7.4
gi|48476206|gb|AAT44378.1| REJ2CRD [Hemicentrotus pulcherrimus] 34 7.4
gi|14719571|pdb|1IOD|B Chain B, Crystal Structure Of The Complex... 34 7.4
gi|34922594|sp|Q920P9|LY75_MESAU Lymphocyte antigen 75 precursor... 34 9.6
gi|46276889|ref|NP_002719.3| proteoglycan 2 preproprotein; eosin... 34 9.6
gi|3287903|sp|P81397|RHCA_AGKRH Rhodocetin alpha subunit 34 9.6
gi|6754654|ref|NP_034905.1| mannose binding lectin, liver (A) [M... 34 9.6
gi|46441896|gb|EAL01190.1| hypothetical protein CaO19.351 [Candi... 34 9.6
gi|444786|prf||1908220B pancreatitis-associated protein 34 9.6
gi|20129719|ref|NP_610208.1| CG11211-PA [Drosophila melanogaster... 34 9.6
gi|7507866|pir||T32254 hypothetical protein T15B7.9 - Caenorhabd... 34 9.6
gi|28628336|gb|AAO43605.1| serum lectin isoform 1 precursor [Sal... 34 9.6
gi|28628338|gb|AAO43606.1| serum lectin isoform 2 precursor [Sal... 34 9.6
gi|28628334|gb|AAO43604.1| serum lectin isoform 5 precursor [Sal... 34 9.6
gi|28628342|gb|AAO43608.1| serum lectin isoform 4 precursor [Sal... 34 9.6
gi|46130915|ref|ZP_00202405.1| COG0223: Methionyl-tRNA formyltra... 34 9.6
gi|42561183|ref|NP_975634.1| hypothetical transmembrane protein ... 34 9.6
gi|7245413|pdb|1C3A|B Chain B, Crystal Structure Of Flavocetin-A... 34 9.6
gi|48476212|gb|AAT44381.1| REJ2CRD [Strongylocentrotus pallidus] 34 9.6
>gi|17561198|ref|NP_507262.1| receptor 1 family member (5R344)
[Caenorhabditis elegans]
gi|7503790|pir||T22397 hypothetical protein F49A5.7 - Caenorhabditis
elegans
Length = 468
Score = 756 bits (1952), Expect = 0.0
Identities = 374/468 (79%), Positives = 374/468 (79%)
Frame = -1
Query: 1407 MLFVQPMNFVYELPVTLQRKSCYLRFDLNLTVPQAQNFCLEKCANLVSIHSANEVRFIMT 1228
MLFVQPMNFVYELPVTLQRKSCYLRFDLNLTVPQAQNFCLEKCANLVSIHSANEVRFIMT
Sbjct: 1 MLFVQPMNFVYELPVTLQRKSCYLRFDLNLTVPQAQNFCLEKCANLVSIHSANEVRFIMT 60
Query: 1227 IYDFIEKVIINTHWXXXXXXXXXXXXXXXXXXXSKTFRSMSASHLVPEKWIQFLRLHWXX 1048
IYDFIEKVIINTHW SKTFRSMSASHLVPEKWIQFLRLHW
Sbjct: 61 IYDFIEKVIINTHWIIVLSELISLSIVPIVSVSSKTFRSMSASHLVPEKWIQFLRLHWLI 120
Query: 1047 XXXXXXXXXXXXXXXXXXTYFTTHHAACAADKITSSDFQRSNVFSLTSDSTNXXXXXXXX 868
TYFTTHHAACAADKITSSDFQRSNVFSLTSDSTN
Sbjct: 121 ILIGVITEIVIITGVVLLTYFTTHHAACAADKITSSDFQRSNVFSLTSDSTNSEISSTTR 180
Query: 867 XXXXXIKPATEHSFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTRDNADFDCMREGGST 688
IKPATEHSF TRDNADFDCMREGGST
Sbjct: 181 TVSRSIKPATEHSFTCIIIEYSISETSTASTTIRPLTTTTTPGKTRDNADFDCMREGGST 240
Query: 687 LFSIRNEQENNATLDFVSNSGVAYIWTGLICNANTSSSCTWDLKSGSAANYDNFAKGFPN 508
LFSIRNEQENNATLDFVSNSGVAYIWTGLICNANTSSSCTWDLKSGSAANYDNFAKGFPN
Sbjct: 241 LFSIRNEQENNATLDFVSNSGVAYIWTGLICNANTSSSCTWDLKSGSAANYDNFAKGFPN 300
Query: 507 KTIGDCVYFIANGTEAGHWKSSACNQTMSYVCELPPTIHXXXXXXXXXXXXYVRYDKSST 328
KTIGDCVYFIANGTEAGHWKSSACNQTMSYVCELPPTIH YVRYDKSST
Sbjct: 301 KTIGDCVYFIANGTEAGHWKSSACNQTMSYVCELPPTIHDDNCDNNYNNNCYVRYDKSST 360
Query: 327 IADAQEFCKTKHGGNLVSINSANENRYVQTLYYVSGYIPLGAVVPNYNVIYWMDGSPATY 148
IADAQEFCKTKHGGNLVSINSANENRYVQTLYYVSGYIPLGAVVPNYNVIYWMDGSPATY
Sbjct: 361 IADAQEFCKTKHGGNLVSINSANENRYVQTLYYVSGYIPLGAVVPNYNVIYWMDGSPATY 420
Query: 147 NNILYYTNGTCLFLNFSWGGSGDFWETVECTDKSWFLCKWPIGIDYAQ 4
NNILYYTNGTCLFLNFSWGGSGDFWETVECTDKSWFLCKWPIGIDYAQ
Sbjct: 421 NNILYYTNGTCLFLNFSWGGSGDFWETVECTDKSWFLCKWPIGIDYAQ 468
>gi|50507778|emb|CAB04419.2| Hypothetical protein F49A5.7
[Caenorhabditis elegans]
Length = 452
Score = 718 bits (1854), Expect = 0.0
Identities = 355/449 (79%), Positives = 355/449 (79%)
Frame = -1
Query: 1350 KSCYLRFDLNLTVPQAQNFCLEKCANLVSIHSANEVRFIMTIYDFIEKVIINTHWXXXXX 1171
KSCYLRFDLNLTVPQAQNFCLEKCANLVSIHSANEVRFIMTIYDFIEKVIINTHW
Sbjct: 4 KSCYLRFDLNLTVPQAQNFCLEKCANLVSIHSANEVRFIMTIYDFIEKVIINTHWIIVLS 63
Query: 1170 XXXXXXXXXXXXXXSKTFRSMSASHLVPEKWIQFLRLHWXXXXXXXXXXXXXXXXXXXXT 991
SKTFRSMSASHLVPEKWIQFLRLHW T
Sbjct: 64 ELISLSIVPIVSVSSKTFRSMSASHLVPEKWIQFLRLHWLIILIGVITEIVIITGVVLLT 123
Query: 990 YFTTHHAACAADKITSSDFQRSNVFSLTSDSTNXXXXXXXXXXXXXIKPATEHSFXXXXX 811
YFTTHHAACAADKITSSDFQRSNVFSLTSDSTN IKPATEHSF
Sbjct: 124 YFTTHHAACAADKITSSDFQRSNVFSLTSDSTNSEISSTTRTVSRSIKPATEHSFTCIII 183
Query: 810 XXXXXXXXXXXXXXXXXXXXXXXXXTRDNADFDCMREGGSTLFSIRNEQENNATLDFVSN 631
TRDNADFDCMREGGSTLFSIRNEQENNATLDFVSN
Sbjct: 184 EYSISETSTASTTIRPLTTTTTPGKTRDNADFDCMREGGSTLFSIRNEQENNATLDFVSN 243
Query: 630 SGVAYIWTGLICNANTSSSCTWDLKSGSAANYDNFAKGFPNKTIGDCVYFIANGTEAGHW 451
SGVAYIWTGLICNANTSSSCTWDLKSGSAANYDNFAKGFPNKTIGDCVYFIANGTEAGHW
Sbjct: 244 SGVAYIWTGLICNANTSSSCTWDLKSGSAANYDNFAKGFPNKTIGDCVYFIANGTEAGHW 303
Query: 450 KSSACNQTMSYVCELPPTIHXXXXXXXXXXXXYVRYDKSSTIADAQEFCKTKHGGNLVSI 271
KSSACNQTMSYVCELPPTIH YVRYDKSSTIADAQEFCKTKHGGNLVSI
Sbjct: 304 KSSACNQTMSYVCELPPTIHDDNCDNNYNNNCYVRYDKSSTIADAQEFCKTKHGGNLVSI 363
Query: 270 NSANENRYVQTLYYVSGYIPLGAVVPNYNVIYWMDGSPATYNNILYYTNGTCLFLNFSWG 91
NSANENRYVQTLYYVSGYIPLGAVVPNYNVIYWMDGSPATYNNILYYTNGTCLFLNFSWG
Sbjct: 364 NSANENRYVQTLYYVSGYIPLGAVVPNYNVIYWMDGSPATYNNILYYTNGTCLFLNFSWG 423
Query: 90 GSGDFWETVECTDKSWFLCKWPIGIDYAQ 4
GSGDFWETVECTDKSWFLCKWPIGIDYAQ
Sbjct: 424 GSGDFWETVECTDKSWFLCKWPIGIDYAQ 452