Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F53A3_6
(393 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17554780|ref|NP_497481.1| ribosomal Protein, Small subunit (1... 256 7e-68
gi|50755847|ref|XP_425249.1| PREDICTED: similar to Rps15a protei... 231 3e-60
gi|18000277|gb|AAL54900.1| ribosomal protein S15 isoform [Lapemi... 231 3e-60
gi|37779114|gb|AAP20217.1| 40S ribosomal protein S15A [Pagrus ma... 230 4e-60
gi|7340072|gb|AAF61072.1| 40S ribosomal protein S15A [Paralichth... 230 6e-60
gi|14165469|ref|NP_001010.2| ribosomal protein S15a; 40S ribosom... 229 9e-60
gi|17975567|ref|NP_524709.1| CG2033-PD [Drosophila melanogaster]... 229 9e-60
gi|30109302|gb|AAH51205.1| Rps15a protein [Mus musculus] 229 9e-60
gi|12804561|gb|AAH01697.1| Ribosomal protein S15a [Homo sapiens] 228 2e-59
gi|47086525|ref|NP_997927.1| ribosomal protein S15a; wu:fb04b07 ... 228 2e-59
gi|1082767|pir||S52339 ribosomal protein S15a, cytosolic [valida... 228 2e-59
gi|24652557|ref|NP_610616.1| CG12324-PA [Drosophila melanogaster... 227 4e-59
gi|26891588|gb|AAN78366.1| CG12324 protein [Drosophila melanogas... 227 5e-59
gi|26328337|dbj|BAC27909.1| unnamed protein product [Mus musculus] 226 6e-59
gi|22001960|sp|Q90YQ8|RS1A_ICTPU 40S ribosomal protein S15a 224 3e-58
gi|31231736|ref|XP_318584.1| ENSANGP00000021108 [Anopheles gambi... 223 7e-58
gi|15213820|gb|AAK92185.1| ribosomal protein S15A [Spodoptera fr... 223 7e-58
gi|50344492|emb|CAH04332.1| S15Ae ribosomal protein [Biphyllus l... 222 2e-57
gi|38090753|ref|XP_137226.3| similar to Rps15a protein [Mus musc... 221 3e-57
gi|15294043|gb|AAK95198.1| 40S ribosomal protein S15a [Ictalurus... 219 1e-56
gi|20269780|gb|AAM18049.1| ribosomal protein S24 [Marsupenaeus j... 216 6e-56
gi|27362934|gb|AAN86979.1| ribosomal protein S15a [Branchiostoma... 216 8e-56
gi|34854258|ref|XP_345163.1| similar to 40S ribosomal protein S1... 213 7e-55
gi|47551199|ref|NP_999780.1| ribosomal protein S15a; ribosomal p... 212 1e-54
gi|14326103|gb|AAK60141.1| ribosomal protein S22 [Candida albica... 210 6e-54
gi|2119072|pir||JC4713 ribosomal protein S15a.e - sea urchin (Pa... 209 8e-54
gi|45190456|ref|NP_984710.1| AEL151Cp [Eremothecium gossypii] >g... 209 1e-53
gi|34869867|ref|XP_344039.1| similar to 40S ribosomal protein S1... 208 2e-53
gi|50413402|ref|XP_457257.1| unnamed protein product [Debaryomyc... 208 2e-53
gi|1710747|sp|P50891|RS1A_PARLI 40S RIBOSOMAL PROTEIN S15A (S24)... 208 2e-53
gi|50427203|ref|XP_462214.1| unnamed protein product [Debaryomyc... 207 3e-53
gi|6322271|ref|NP_012345.1| Protein component of the small (40S)... 207 5e-53
gi|6323399|ref|NP_013471.1| Protein component of the small (40S)... 206 9e-53
gi|50291985|ref|XP_448425.1| unnamed protein product [Candida gl... 206 1e-52
gi|464711|sp|P33953|RS22_KLUMA 40S RIBOSOMAL PROTEIN S22 (S15A) ... 205 2e-52
gi|49258827|pdb|1S1H|H Chain H, Structure Of The Ribosomal 80s-E... 205 2e-52
gi|46125827|ref|XP_387467.1| RS22_KLUMA 40S RIBOSOMAL PROTEIN S2... 204 2e-52
gi|50549967|ref|XP_502456.1| hypothetical protein [Yarrowia lipo... 204 4e-52
gi|50303843|ref|XP_451868.1| unnamed protein product [Kluyveromy... 204 4e-52
gi|32411611|ref|XP_326286.1| 40S RIBOSOMAL PROTEIN S22 (S15A) (Y... 203 7e-52
gi|38110846|gb|EAA56508.1| hypothetical protein MG06479.4 [Magna... 201 4e-51
gi|34873149|ref|XP_345618.1| similar to 40S ribosomal protein S1... 201 4e-51
gi|50556914|ref|XP_505865.1| hypothetical protein [Yarrowia lipo... 200 5e-51
gi|36142|emb|CAA44568.1| ribosomal protein homologous to yeast S... 199 1e-50
gi|41107480|ref|XP_372778.1| similar to 40S ribosomal protein S1... 198 2e-50
gi|49085918|ref|XP_405044.1| RS22_KLUMA 40S RIBOSOMAL PROTEIN S2... 198 2e-50
gi|28411802|dbj|BAC57277.1| ribosomal protein S15 [Oryza sativa ... 197 4e-50
gi|47848234|dbj|BAD22059.1| putative ribosomal protein S15 [Oryz... 196 7e-50
gi|13539680|gb|AAK29203.1| ribosomal protein S15a [Taenia solium... 196 9e-50
gi|15223001|ref|NP_172256.1| 40S ribosomal protein S15A (RPS15aA... 196 1e-49
gi|49068386|ref|XP_398482.1| hypothetical protein UM00867.1 [Ust... 195 2e-49
gi|133793|sp|Q00332|RS1A_BRANA 40S RIBOSOMAL PROTEIN S15A (PPCB8... 195 2e-49
gi|49036493|sp|Q9AT34|RS1A_DAUCA 40S ribosomal protein S15a >gnl... 195 2e-49
gi|16805252|ref|NP_473280.1| 40S ribosomal protein S15A, putativ... 195 2e-49
gi|34872088|ref|XP_344104.1| similar to 40S ribosomal protein S1... 195 2e-49
gi|23480297|gb|EAA16894.1| ribosomal protein S8 [Plasmodium yoel... 195 2e-49
gi|34870439|ref|XP_221893.2| similar to Rps15a protein [Rattus n... 194 3e-49
gi|5931793|emb|CAB56626.1| ribosomal protein 22 of the small sub... 194 3e-49
gi|6683481|dbj|BAA89231.1| wrp15a [Citrullus lanatus] 194 3e-49
gi|34851495|ref|XP_344732.1| similar to 40S ribosomal protein S1... 194 4e-49
gi|15231316|ref|NP_190190.1| 40S ribosomal protein S15A (RPS15aD... 192 1e-48
gi|2130985|emb|CAA42600.1| r-protein BnS15a [Brassica napus] 192 1e-48
gi|15225502|ref|NP_181491.1| 40S ribosomal protein S15A (RPS15aC... 189 1e-47
gi|19114146|ref|NP_593234.1| 40s ribosomal protein S15A/S22A [Sc... 186 7e-47
gi|28850259|gb|AAO53065.1| similar to Dictyostelium discoideum (... 186 9e-47
gi|46228863|gb|EAK89733.1| 40S ribosomal protein S15A , transcri... 184 5e-46
gi|41146743|ref|XP_373027.1| similar to 40S ribosomal protein S1... 183 6e-46
gi|1173219|sp|P46793|RS1A_DICDI 40S ribosomal protein S15A (S24)... 183 8e-46
gi|50255303|gb|EAL18038.1| hypothetical protein CNBK0590 [Crypto... 183 8e-46
gi|1173217|sp|P46792|RS22_AGABI 40S RIBOSOMAL PROTEIN S22 (S15A)... 181 3e-45
gi|46138025|ref|XP_390703.1| hypothetical protein FG10527.1 [Gib... 179 1e-44
gi|42491231|dbj|BAD10932.1| ribosomal protein S15a [Trichomonas ... 175 2e-43
gi|29245245|gb|EAA36895.1| GLP_541_6521_6913 [Giardia lamblia AT... 169 9e-42
gi|41197098|ref|XP_371814.1| similar to Rps15a protein [Homo sap... 159 2e-38
gi|13812410|ref|NP_113528.1| 40S ribosomal protein S15A [Guillar... 152 2e-36
gi|17482323|ref|XP_064859.1| similar to 40S ribosomal protein S1... 149 1e-35
gi|12733945|emb|CAC28940.1| 40S ribosomal protein S15a [Platicht... 144 5e-34
gi|34865554|ref|XP_236459.2| similar to Rps15a protein [Rattus n... 141 3e-33
gi|50312621|ref|XP_451883.1| unnamed protein product [Kluyveromy... 139 1e-32
gi|15233571|ref|NP_194672.1| 40S ribosomal protein S15A (RPS15aE... 132 2e-30
gi|14520542|ref|NP_126017.1| SSU ribosomal protein S8P [Pyrococc... 131 3e-30
gi|18978181|ref|NP_579538.1| SSU ribosomal protein S8P [Pyrococc... 130 5e-30
gi|14591519|ref|NP_143600.1| 30S ribosomal protein S8 [Pyrococcu... 130 8e-30
gi|15224834|ref|NP_179562.1| 40S ribosomal protein S15A (RPS15aB... 129 1e-29
gi|50251667|dbj|BAD29691.1| putative 40S ribosomal protein S15A ... 127 5e-29
gi|15668647|ref|NP_247446.1| SSU ribosomal protein S8P (rpsH) [M... 127 5e-29
gi|20139903|sp|Q977V0|RS8_METIG 30S ribosomal protein S8P >gnl|B... 127 7e-29
gi|15920627|ref|NP_376296.1| 133aa long hypothetical 30S ribosom... 126 1e-28
gi|15825871|pdb|1I6U|A Chain A, Rna-Protein Interactions: The Cr... 122 1e-27
gi|19173255|ref|NP_597058.1| 40S RIBOSOMAL PROTEIN S15A (S22 in ... 122 2e-27
gi|20094659|ref|NP_614506.1| Ribosomal protein S8 [Methanopyrus ... 121 3e-27
gi|48838698|ref|ZP_00295638.1| COG0096: Ribosomal protein S8 [Me... 121 4e-27
gi|21228241|ref|NP_634163.1| SSU ribosomal protein S8P [Methanos... 120 8e-27
gi|2811038|sp|O05636|RS8_SULAC 30S ribosomal protein S8P >gnl|BL... 119 1e-26
gi|15897609|ref|NP_342214.1| SSU ribosomal protein S8AB (rps8AB)... 119 1e-26
gi|15678049|ref|NP_275163.1| ribosomal protein S15a (E.coli S8) ... 119 1e-26
gi|20139901|sp|Q977U8|RS8_METTL 30S ribosomal protein S8P >gnl|B... 119 1e-26
gi|20089957|ref|NP_616032.1| ribosomal protein S8 [Methanosarcin... 117 4e-26
gi|45358977|ref|NP_988534.1| SSU ribosomal protein S8P [Methanoc... 116 1e-25
gi|48477727|ref|YP_023433.1| small subunit ribosomal protein S8P... 115 2e-25
gi|13541171|ref|NP_110859.1| 30S ribosomal protein S8 [Thermopla... 113 8e-25
gi|20139902|sp|Q977U9|RS8_METVO 30S ribosomal protein S8P >gnl|B... 113 8e-25
gi|134020|sp|P14038|RS8_METVA 30S ribosomal protein S8P >gnl|BL_... 113 1e-24
gi|16082258|ref|NP_394712.1| probable 30S ribosomal protein S8 [... 112 2e-24
gi|18313095|ref|NP_559762.1| ribosomal protein S8 [Pyrobaculum a... 110 6e-24
gi|11499494|ref|NP_070735.1| SSU ribosomal protein S8P (rps8E) [... 110 6e-24
gi|14600655|ref|NP_147172.1| 30S ribosomal protein S8 [Aeropyrum... 110 8e-24
gi|48852511|ref|ZP_00306697.1| COG0096: Ribosomal protein S8 [Fe... 108 3e-23
gi|134016|sp|P12742|RS8_HALMA 30S ribosomal protein S8P (HmaS8) ... 100 7e-21
gi|23822123|sp|Q9HPB9|RS8_HALN1 30S ribosomal protein S8P 99 3e-20
gi|41615066|ref|NP_963564.1| NEQ274 [Nanoarchaeum equitans Kin4-... 92 3e-18
gi|15790647|ref|NP_280471.1| 30S ribosomal protein S8P; Rps8p [H... 79 3e-14
gi|23024314|ref|ZP_00063530.1| COG0096: Ribosomal protein S8 [Le... 61 6e-09
gi|15900160|ref|NP_344764.1| ribosomal protein S8 [Streptococcus... 60 8e-09
gi|22536257|ref|NP_687108.1| ribosomal protein S8 [Streptococcus... 60 1e-08
gi|15829044|ref|NP_326404.1| 30S RIBOSOMAL PROTEIN S8 [Mycoplasm... 60 1e-08
gi|25010147|ref|NP_734542.1| ribosomal protein S8 [Streptococcus... 60 1e-08
gi|42518443|ref|NP_964373.1| 30S ribosomal protein S8 [Lactobaci... 59 2e-08
gi|23003712|ref|ZP_00047364.1| COG0096: Ribosomal protein S8 [La... 59 2e-08
gi|48857566|ref|ZP_00311560.1| COG0096: Ribosomal protein S8 [Cl... 59 3e-08
gi|50590424|ref|ZP_00331807.1| COG0096: Ribosomal protein S8 [St... 57 6e-08
gi|15674301|ref|NP_268474.1| 30S ribosomal protein S8 [Streptoco... 57 6e-08
gi|20808646|ref|NP_623817.1| Ribosomal protein S8 [Thermoanaerob... 57 6e-08
gi|39938700|ref|NP_950466.1| ribosomal protein S8 [Onion yellows... 57 6e-08
gi|2829478|sp|P56209|RS8_BACST 30S ribosomal protein S8 (BS8) 57 1e-07
gi|29374865|ref|NP_814018.1| ribosomal protein S8 [Enterococcus ... 57 1e-07
gi|15674066|ref|NP_268241.1| 30S ribosomal protein S8 [Lactococc... 57 1e-07
gi|16801828|ref|NP_472096.1| ribosomal protein S8 [Listeria inno... 57 1e-07
gi|23097588|ref|NP_691054.1| 30S ribosomal protein S8 [Oceanobac... 56 1e-07
gi|16077198|ref|NP_388011.1| ribosomal protein S8 (BS8) [Bacillu... 56 2e-07
gi|34849406|gb|AAP58905.1| ribosomal protein S8 [Spiroplasma kun... 55 2e-07
gi|1173279|sp|P12879|RS8_BACSU 30S ribosomal protein S8 (BS8) >g... 55 3e-07
gi|28493508|ref|NP_787669.1| 30S ribosomal protein S8 [Tropherym... 55 3e-07
gi|15612711|ref|NP_241014.1| 30S ribosomal protein S8; ribosomal... 55 3e-07
gi|48855307|ref|ZP_00309466.1| COG0096: Ribosomal protein S8 [Cy... 55 4e-07
gi|1942032|pdb|1SEI|A Chain A, Structure Of 30s Ribosomal Protei... 55 4e-07
gi|48824736|ref|ZP_00286075.1| COG0096: Ribosomal protein S8 [En... 55 4e-07
gi|49235639|ref|ZP_00329706.1| COG0096: Ribosomal protein S8 [Mo... 54 5e-07
gi|23124115|ref|ZP_00106126.1| COG0096: Ribosomal protein S8 [No... 54 9e-07
gi|48871242|ref|ZP_00323958.1| COG0096: Ribosomal protein S8 [Pe... 53 1e-06
gi|28377846|ref|NP_784738.1| ribosomal protein S8 [Lactobacillus... 53 2e-06
gi|31544269|ref|NP_852847.1| RpsH [Mycoplasma gallisepticum R] >... 53 2e-06
gi|24380355|ref|NP_722310.1| 30S ribosomal protein S8 [Streptoco... 53 2e-06
gi|15612290|ref|NP_223943.1| putative 30S RIBOSOMAL PROTEIN S8 [... 52 2e-06
gi|13507918|ref|NP_109867.1| ribosomal protein S8 [Mycoplasma pn... 52 2e-06
gi|17231694|ref|NP_488242.1| 30S ribosomal protein S8 [Nostoc sp... 52 2e-06
gi|48864642|ref|ZP_00318528.1| COG0096: Ribosomal protein S8 [Oe... 52 2e-06
gi|13357805|ref|NP_078079.1| ribosomal protein S8 [Ureaplasma pa... 52 2e-06
gi|134021|sp|P04446|RS8_MYCCA 30S ribosomal protein S8 >gnl|BL_O... 52 3e-06
gi|42561256|ref|NP_975707.1| Ribosomal protein S8 [Mycoplasma my... 51 5e-06
gi|50086201|ref|YP_047711.1| 30S ribosomal protein S8 [Acinetoba... 50 8e-06
gi|15644234|ref|NP_229286.1| ribosomal protein S8 [Thermotoga ma... 50 8e-06
gi|33152940|ref|NP_874293.1| 30S ribosomal protein S8 [Haemophil... 50 8e-06
gi|12045018|ref|NP_072828.1| ribosomal protein S8 (rpS8) [Mycopl... 50 8e-06
gi|15639196|ref|NP_218642.1| ribosomal protein S8 (rpsH) [Trepon... 50 8e-06
gi|28212165|ref|NP_783109.1| SSU ribosomal protein S8P [Clostrid... 50 8e-06
gi|48860655|ref|ZP_00314566.1| COG0096: Ribosomal protein S8 [Mi... 50 1e-05
gi|11465767|ref|NP_053911.1| ribosomal protein S8 [Porphyra purp... 50 1e-05
gi|27468727|ref|NP_765364.1| 30S ribosomal protein S8 [Staphyloc... 50 1e-05
gi|29348122|ref|NP_811625.1| 30S ribosomal protein S8 [Bacteroid... 50 1e-05
gi|48765730|ref|ZP_00270280.1| COG0096: Ribosomal protein S8 [Rh... 50 1e-05
gi|45531573|ref|ZP_00182613.1| COG0096: Ribosomal protein S8 [Ex... 50 1e-05
gi|21398082|ref|NP_654067.1| Ribosomal_S8, Ribosomal protein S8 ... 50 1e-05
gi|22711975|ref|NP_683836.1| ribosomal protein S8 [Chaetosphaeri... 50 1e-05
gi|50364952|ref|YP_053377.1| 30S ribosomal protein S8 [Mesoplasm... 49 2e-05
gi|50122937|ref|YP_052104.1| 30S ribosomal subunit protein S8 [E... 49 2e-05
gi|27904928|ref|NP_778054.1| 30S ribosomal protein S8 [Buchnera ... 49 2e-05
gi|33862101|ref|NP_893662.1| 30S ribosomal protein S8 [Prochloro... 49 2e-05
gi|7525068|ref|NP_051093.1| ribosomal protein S8 [Arabidopsis th... 49 3e-05
gi|15617104|ref|NP_240317.1| 30S ribosomal protein S8 [Buchnera ... 49 3e-05
gi|30468195|ref|NP_849082.1| ribosomal protein S8 [Cyanidioschyz... 48 4e-05
gi|23468111|ref|ZP_00123672.1| COG0096: Ribosomal protein S8 [Ha... 48 4e-05
gi|24213453|ref|NP_710934.1| ribosomal protein S8 [Leptospira in... 48 4e-05
gi|32030989|ref|ZP_00133685.1| COG0096: Ribosomal protein S8 [Ha... 48 4e-05
gi|18860347|ref|NP_569664.1| ribosomal protein S8 [Psilotum nudu... 48 4e-05
gi|30248432|ref|NP_840502.1| Ribosomal protein S8 [Nitrosomonas ... 48 5e-05
gi|41723123|ref|ZP_00150066.1| COG0096: Ribosomal protein S8 [De... 48 5e-05
gi|45917158|ref|ZP_00196303.2| COG0096: Ribosomal protein S8 [Me... 48 5e-05
gi|11467334|ref|NP_043191.1| ribosomal protein S8 [Cyanophora pa... 48 5e-05
gi|15925226|ref|NP_372760.1| 30S ribosomal protein S8 [Staphyloc... 48 5e-05
gi|23112492|ref|ZP_00097968.1| COG0096: Ribosomal protein S8 [De... 48 5e-05
gi|46130378|ref|ZP_00165213.2| COG0096: Ribosomal protein S8 [Sy... 47 7e-05
gi|29653604|ref|NP_819296.1| ribosomal protein S8 [Coxiella burn... 47 7e-05
gi|21672756|ref|NP_660823.1| 30S ribosomal protein S8 [Buchnera ... 47 7e-05
gi|13513067|emb|CAC35455.1| unnamed protein product [Cyanophora ... 47 7e-05
gi|34500949|ref|NP_904134.1| ribosomal protein S8 [Amborella tri... 47 7e-05
gi|22956579|ref|ZP_00004334.1| COG0096: Ribosomal protein S8 [Rh... 47 7e-05
gi|15889229|ref|NP_354910.1| AGR_C_3534p [Agrobacterium tumefaci... 47 7e-05
gi|15803833|ref|NP_289867.1| 30S ribosomal subunit protein S8, a... 47 9e-05
gi|11467077|ref|NP_042553.1| ribosomal protein S8 [Acanthamoeba ... 47 9e-05
gi|5163218|gb|AAD40597.1| ribosomal protein S8 [Leptospira inter... 47 9e-05
gi|48835041|ref|ZP_00292043.1| COG0096: Ribosomal protein S8 [Th... 47 9e-05
gi|33357885|pdb|1P6G|H Chain H, Real Space Refined Coordinates O... 47 1e-04
gi|15896369|ref|NP_349718.1| Ribosomal protein S8 [Clostridium a... 47 1e-04
gi|16125511|ref|NP_420075.1| ribosomal protein S8 [Caulobacter c... 47 1e-04
gi|46202024|ref|ZP_00053911.2| COG0096: Ribosomal protein S8 [Ma... 47 1e-04
gi|13518473|ref|NP_084832.1| ribosomal protein S8 [Lotus cornicu... 46 1e-04
gi|34558015|ref|NP_907830.1| 30S RIBOSOMAL PROTEIN S8 [Wolinella... 46 1e-04
gi|13518369|ref|NP_084728.1| ribosomal protein S8 [Oenothera ela... 46 1e-04
gi|42983|emb|CAA25719.1| unnamed protein product [Escherichia coli] 46 1e-04
gi|16120561|ref|NP_403874.1| 30S ribosomal protein S8 [Yersinia ... 46 1e-04
gi|37528529|ref|NP_931874.1| 30S ribosomal protein S14 [Photorha... 46 1e-04
gi|46143639|ref|ZP_00134841.2| COG0096: Ribosomal protein S8 [Ac... 46 1e-04
gi|15604491|ref|NP_221009.1| 30S RIBOSOMAL PROTEIN S8 (rpsH) [Ri... 46 1e-04
gi|50346819|ref|YP_053190.1| ribosomal protein S8 [Nymphaea alba... 46 1e-04
gi|33594495|ref|NP_882139.1| 30S ribosomal protein S8 [Bordetell... 46 2e-04
gi|34581383|ref|ZP_00142863.1| 30S ribosomal protein S8 [Rickett... 46 2e-04
gi|22297638|ref|NP_680885.1| 30S ribosomal protein S8 [Thermosyn... 46 2e-04
gi|13470565|ref|NP_102134.1| 30S ribosomal protein S8 [Mesorhizo... 46 2e-04
gi|42454064|ref|ZP_00153971.1| hypothetical protein Rick094601 [... 46 2e-04
gi|49475780|ref|YP_033821.1| 30S ribosomal protein s8 [Bartonell... 46 2e-04
gi|23502096|ref|NP_698223.1| ribosomal protein S8 [Brucella suis... 46 2e-04
gi|15892915|ref|NP_360629.1| 30S ribosomal protein S8 [Rickettsi... 46 2e-04
gi|17987054|ref|NP_539688.1| SSU ribosomal protein S8P [Brucella... 46 2e-04
gi|49474390|ref|YP_032432.1| 30s ribosomal protein s8 [Bartonell... 46 2e-04
gi|26554451|ref|NP_758385.1| ribosomal protein S8 [Mycoplasma pe... 45 3e-04
gi|9695408|ref|NP_037630.1| ribosomal protein S8 [Phytophthora i... 45 3e-04
gi|28202208|ref|NP_777449.1| ribosomal protein S8 [Anthoceros fo... 45 3e-04
gi|28261752|ref|NP_783266.1| ribosomal protein S8 [Atropa bellad... 45 3e-04
gi|3980236|emb|CAA79791.1| ribosomal protein S8 [Thermotoga mari... 45 3e-04
gi|21241751|ref|NP_641333.1| 30S ribosomal protein S8 [Xanthomon... 45 3e-04
gi|15965123|ref|NP_385476.1| PROBABLE 30S RIBOSOMAL PROTEIN S8 [... 45 3e-04
gi|39997935|ref|NP_953886.1| ribosomal protein S8 [Geobacter sul... 45 3e-04
gi|21230378|ref|NP_636295.1| 30S ribosomal protein S8 [Xanthomon... 45 3e-04
gi|34541527|ref|NP_906006.1| ribosomal protein S8 [Porphyromonas... 45 4e-04
gi|17547724|ref|NP_521126.1| PROBABLE 30S RIBOSOMAL SUBUNIT PROT... 45 4e-04
gi|15676083|ref|NP_273214.1| 30S ribosomal protein S8 [Neisseria... 45 4e-04
gi|11465435|ref|NP_045174.1| ribosomal protein S8 [Cyanidium cal... 45 4e-04
gi|42526293|ref|NP_971391.1| ribosomal protein S8 [Treponema den... 45 4e-04
gi|15792996|ref|NP_282819.1| 30S ribosomal protein S8 [Campyloba... 44 6e-04
gi|34499627|ref|NP_903842.1| 30S ribosomal protein S8 [Chromobac... 44 6e-04
gi|46579728|ref|YP_010536.1| ribosomal protein S8 [Desulfovibrio... 44 6e-04
gi|15603266|ref|NP_246340.1| RpS8 [Pasteurella multocida Pm70] >... 44 6e-04
gi|34876146|ref|XP_220002.2| similar to 60S ribosomal protein L2... 44 6e-04
gi|11466739|ref|NP_039335.1| ribosomal protein S8 [Marchantia po... 44 6e-04
gi|38233133|ref|NP_938900.1| 30S ribosomal protein S8 [Corynebac... 44 6e-04
gi|33866612|ref|NP_898171.1| 30S ribosomal protein S8 [Synechoco... 44 7e-04
gi|28198367|ref|NP_778681.1| 30S ribosomal protein S8 [Xylella f... 44 7e-04
gi|50657684|gb|AAT79669.1| 30S ribosomal protein S8 [Gracilaria ... 44 7e-04
gi|15837768|ref|NP_298456.1| 30S ribosomal protein S8 [Xylella f... 44 7e-04
gi|16272733|ref|NP_438951.1| ribosomal protein S8 [Haemophilus i... 44 0.001
gi|48893980|ref|ZP_00327178.1| COG0096: Ribosomal protein S8 [Tr... 44 0.001
gi|11467730|ref|NP_050782.1| ribosomal protein S8 [Guillardia th... 44 0.001
gi|22995902|ref|ZP_00040190.1| COG0096: Ribosomal protein S8 [Xy... 44 0.001
gi|25027105|ref|NP_737159.1| putative 30S ribosomal protein S8 [... 44 0.001
gi|11465992|ref|NP_054534.1| ribosomal protein S8 [Nicotiana tab... 43 0.001
gi|34864645|ref|XP_236276.2| similar to RIKEN cDNA 1190002L16 [R... 43 0.002
gi|1173278|sp|P46180|RS8_BUCAK 30S ribosomal protein S8 >gnl|BL_... 43 0.002
gi|15606752|ref|NP_214132.1| ribosomal protein S08 [Aquifex aeol... 43 0.002
gi|11467457|ref|NP_043603.1| ribosomal protein S8 [Odontella sin... 43 0.002
gi|33519672|ref|NP_878504.1| 30S ribosomal subunit protein S8 [C... 42 0.002
gi|33864012|ref|NP_895572.1| 30S ribosomal protein S8 [Prochloro... 42 0.002
gi|11466967|ref|NP_054388.1| ribosomal protein S8 [Epifagus virg... 42 0.003
gi|48767834|ref|ZP_00272187.1| COG0096: Ribosomal protein S8 [Ra... 42 0.003
gi|22973831|ref|ZP_00020309.1| hypothetical protein [Chloroflexu... 42 0.003
gi|45525094|ref|ZP_00176342.1| COG0096: Ribosomal protein S8 [Cr... 42 0.003
gi|34501440|ref|NP_904227.1| ribosomal protein S8 [Physcomitrell... 42 0.003
gi|23308795|ref|NP_599776.2| ribosomal protein S8 [Corynebacteri... 42 0.003
gi|22995988|ref|ZP_00040265.1| COG0096: Ribosomal protein S8 [Xy... 42 0.003
gi|24212272|sp|P59033|RR8_PHAAN Chloroplast 30S ribosomal protei... 42 0.004
gi|24371843|ref|NP_715885.1| ribosomal protein S8 [Shewanella on... 42 0.004
gi|23104453|ref|ZP_00090917.1| COG0096: Ribosomal protein S8 [Az... 42 0.004
gi|42524363|ref|NP_969743.1| 30S ribosomal protein S8 [Bdellovib... 42 0.004
gi|39936299|ref|NP_948575.1| 30S ribosomal protein S8 [Rhodopseu... 42 0.004
gi|47574133|ref|ZP_00244169.1| COG0096: Ribosomal protein S8 [Ru... 41 0.005
gi|11497562|ref|NP_054970.1| ribosomal protein S8 [Spinacia oler... 41 0.005
gi|41324763|emb|CAF19245.1| RIBOSOMAL PROTEIN S8 [Corynebacteriu... 41 0.005
gi|32400983|gb|AAP80697.1| ribosome protein S8 [Griffithsia japo... 41 0.006
gi|32423687|gb|AAP81230.1| ribosomal protein S8 [Candidatus Port... 41 0.006
gi|46120556|ref|ZP_00171728.2| COG0096: Ribosomal protein S8 [Me... 41 0.006
gi|27380497|ref|NP_772026.1| 30S ribosomal protein S8 [Bradyrhiz... 41 0.006
gi|49077216|gb|AAT49647.1| PA4249 [synthetic construct] 40 0.008
gi|15599445|ref|NP_252939.1| 30S ribosomal protein S8 [Pseudomon... 40 0.008
gi|46446059|ref|YP_007424.1| probable 30S ribosomal protein S8 [... 40 0.008
gi|18311373|ref|NP_563307.1| 30S ribosomal protein S8 [Clostridi... 40 0.008
gi|32480878|ref|NP_862789.1| ribosomal protein S8 [Calycanthus f... 40 0.008
gi|417724|sp|P33106|RS8_MICLU 30S ribosomal protein S8 >gnl|BL_O... 40 0.011
gi|32475072|ref|NP_868066.1| 30S ribosomal protein S8 [Pirellula... 40 0.011
gi|48831560|ref|ZP_00288620.1| COG0096: Ribosomal protein S8 [Ma... 40 0.014
gi|15835416|ref|NP_297175.1| ribosomal protein S8 [Chlamydia mur... 40 0.014
gi|48781561|ref|ZP_00278152.1| COG0096: Ribosomal protein S8 [Bu... 40 0.014
gi|46319577|ref|ZP_00219980.1| COG0096: Ribosomal protein S8 [Bu... 40 0.014
gi|46308725|ref|ZP_00210917.1| COG0096: Ribosomal protein S8 [Eh... 40 0.014
gi|45507555|ref|ZP_00159898.1| COG0096: Ribosomal protein S8 [An... 39 0.018
gi|7524923|ref|NP_045925.1| ribosomal protein S8 [Chlorella vulg... 39 0.024
gi|23470619|ref|ZP_00125951.1| COG0096: Ribosomal protein S8 [Ps... 39 0.024
gi|15642577|ref|NP_232210.1| ribosomal protein S8 [Vibrio choler... 39 0.024
gi|16329928|ref|NP_440656.1| 30S ribosomal protein S8 [Synechocy... 39 0.024
gi|29565645|ref|NP_817224.1| ribosomal protein S8 [Pinus koraien... 39 0.024
gi|37523482|ref|NP_926859.1| 30S ribosomal protein S8 [Gloeobact... 39 0.031
gi|33241148|ref|NP_876090.1| Ribosomal protein S8 [Prochlorococc... 39 0.031
gi|11465887|ref|NP_066436.1| ribosomal protein S8 [Ochromonas da... 39 0.031
gi|15594837|ref|NP_212626.1| ribosomal protein S8 (rpsH) [Borrel... 39 0.031
gi|21674984|ref|NP_663049.1| ribosomal protein S8 [Chlorobium te... 38 0.040
gi|48849958|ref|ZP_00304201.1| COG0096: Ribosomal protein S8 [No... 38 0.040
gi|26987209|ref|NP_742634.1| ribosomal protein S8 [Pseudomonas p... 38 0.053
gi|27364200|ref|NP_759728.1| Ribosomal protein S8 [Vibrio vulnif... 38 0.053
gi|32491306|ref|NP_871560.1| rpsH [Wigglesworthia glossinidia en... 38 0.053
gi|48866835|ref|ZP_00320539.1| COG0096: Ribosomal protein S8 [Ha... 38 0.053
gi|41690675|ref|ZP_00147207.1| COG0096: Ribosomal protein S8 [Ps... 38 0.053
gi|11466321|ref|NP_051149.1| ribosomal protein S8 [Cafeteria roe... 37 0.069
gi|28897045|ref|NP_796650.1| ribosomal protein S8 [Vibrio paraha... 37 0.069
gi|46911975|emb|CAG18773.1| putative ribosomal protein S8 [Photo... 37 0.069
gi|11467014|ref|NP_041921.1| ribosomal protein S8 [Euglena graci... 37 0.069
gi|7524688|ref|NP_042442.1| ribosomal protein S8 [Pinus thunberg... 37 0.069
gi|46311180|ref|ZP_00211790.1| COG0096: Ribosomal protein S8 [Bu... 37 0.090
gi|14017607|ref|NP_114293.1| ribosomal protein S8 [Triticum aest... 37 0.12
gi|6831643|sp|O98458|RR8_SPIMX Chloroplast 30S ribosomal protein... 37 0.12
gi|21449988|ref|NP_659250.1| ribosomal protein S8 [Laminaria dig... 36 0.15
gi|15807104|ref|NP_295833.1| ribosomal protein S8 [Deinococcus r... 36 0.15
gi|11466517|ref|NP_044766.1| ribosomal protein S8 [Reclinomonas ... 36 0.15
gi|47938276|gb|AAH71775.1| Unknown (protein for MGC:88417) [Homo... 36 0.20
gi|6831674|sp|Q9ZI39|RS8_AQUPY 30S ribosomal protein S8 >gnl|BL_... 36 0.20
gi|11467227|ref|NP_043059.1| ribosomal protein S8 [Zea mays] >gn... 35 0.26
gi|34899176|ref|NP_910934.1| chloroplast 50S ribosomal protein S... 35 0.26
gi|11466825|ref|NP_039421.1| ribosomal protein S8 [Oryza sativa ... 35 0.26
gi|49574617|ref|NP_848095.2| ribosomal protein S8 [Adiantum capi... 35 0.26
gi|15618544|ref|NP_224830.1| S8 Ribosomal Protein [Chlamydophila... 35 0.34
gi|45547038|ref|ZP_00187099.1| COG0096: Ribosomal protein S8 [Ru... 35 0.34
gi|34907700|ref|NP_915197.1| P0035F12.10 [Oryza sativa (japonica... 35 0.45
gi|50725919|dbj|BAD33447.1| putative ribosomal protein S8 [Oryza... 35 0.45
gi|34763541|ref|ZP_00144479.1| SWF/SNF family helicase [Fusobact... 35 0.45
gi|11466361|ref|NP_038364.1| ribosomal protein S8 [Mesostigma vi... 35 0.45
gi|11467770|ref|NP_050821.1| ribosomal protein S8 [Nephroselmis ... 34 0.76
gi|42520516|ref|NP_966431.1| ribosomal protein S8 [Wolbachia end... 33 1.00
gi|15231784|ref|NP_190897.1| cytochrome P450, putative [Arabidop... 33 1.3
gi|229581|prf||763059A protein S8 33 1.3
gi|50730735|ref|XP_417017.1| PREDICTED: similar to RIKEN cDNA 24... 33 1.7
gi|23112249|ref|ZP_00097756.1| COG1373: Predicted ATPase (AAA+ s... 33 1.7
gi|32040694|ref|ZP_00138277.1| COG2804: Type II secretory pathwa... 32 2.2
gi|13774371|gb|AAK38853.1| ribosomal protein S8 [Glycine max] 32 2.2
gi|46323329|ref|ZP_00223694.1| COG1124: ABC-type dipeptide/oligo... 32 2.9
gi|7482952|pir||C69276 coenzyme F420-quinone oxidoreductase (EC ... 32 2.9
gi|11497827|ref|NP_069049.1| conserved hypothetical protein [Arc... 32 2.9
gi|28630433|gb|AAO45628.1| liguleless2-like protein [Zea mays] 32 3.8
gi|41350157|gb|AAS00419.1| ObsA [Saccharopolyspora spinosa] 32 3.8
gi|15150715|ref|NP_150381.1| ribosomal protein S8 [Pylaiella lit... 32 3.8
gi|41350159|gb|AAS00421.1| ObsC [Saccharopolyspora spinosa] 32 3.8
gi|14042110|dbj|BAB55109.1| unnamed protein product [Homo sapiens] 32 3.8
gi|19704721|ref|NP_604283.1| SWF/SNF family helicase [Fusobacter... 32 3.8
gi|30061509|ref|NP_055837.2| PDZ domain containing 3 isoform b; ... 31 4.9
gi|42519942|ref|NP_965857.1| DNA-directed RNA polymerase, beta/b... 31 4.9
gi|12751452|gb|AAK07661.1| PDZ domain-containing protein AIPC [H... 31 4.9
gi|46164746|ref|ZP_00205169.1| COG0096: Ribosomal protein S8 [Ps... 31 4.9
gi|17559290|ref|NP_505273.1| predicted CDS, RNase H integrase-li... 31 4.9
gi|29421166|dbj|BAA20760.2| KIAA0300 [Homo sapiens] 31 4.9
gi|30061507|ref|NP_835260.1| PDZ domain containing 3 isoform a; ... 31 4.9
gi|46227364|gb|EAK88299.1| hypothetical protein, possible transm... 31 6.5
gi|4204972|gb|AAD10862.1| orf J; putative ATP-binding cassette t... 31 6.5
gi|32699630|sp|P59775|RR8_CHLRE Chloroplast 30S ribosomal protei... 31 6.5
gi|38640237|ref|NP_944193.1| hypothetical protein Aeh1p315 [Bact... 31 6.5
gi|40789265|ref|NP_848632.2| beta1,4-N-acetylgalactosaminyltrans... 31 6.5
gi|41179019|ref|NP_958374.1| ribosomal protein S8 [Chlamydomonas... 31 6.5
gi|6005914|ref|NP_009111.1| trehalase (brush-border membrane gly... 30 8.4
gi|50754297|ref|XP_414318.1| PREDICTED: similar to KIAA0763 gene... 30 8.4
gi|34914372|ref|NP_918533.1| B1168H06.5 [Oryza sativa (japonica ... 30 8.4
gi|21224383|ref|NP_630162.1| putative membrane protein [Streptom... 30 8.4
gi|45916529|ref|ZP_00195449.2| COG4977: Transcriptional regulato... 30 8.4
gi|28872460|ref|NP_795079.1| hypothetical protein [Pseudomonas s... 30 8.4
gi|42655727|ref|XP_048104.4| filaggrin [Homo sapiens] 30 8.4
gi|49078668|ref|XP_403064.1| hypothetical protein UM05449.1 [Ust... 30 8.4
gi|20026695|ref|NP_612737.1| UL112 [Chimpanzee cytomegalovirus] ... 30 8.4
gi|37806133|dbj|BAC99582.1| hypothetical protein [Oryza sativa (... 30 8.4
>gi|17554780|ref|NP_497481.1| ribosomal Protein, Small subunit (14.7
kD) (rps-22) [Caenorhabditis elegans]
gi|25294585|pir||H88394 protein F53A3.3 [imported] - Caenorhabditis
elegans
gi|2429452|gb|AAB70989.1| Ribosomal protein, small subunit protein
22 [Caenorhabditis elegans]
gi|39584059|emb|CAE66465.1| Hypothetical protein CBG11742
[Caenorhabditis briggsae]
Length = 130
Score = 256 bits (654), Expect = 7e-68
Identities = 130/130 (100%), Positives = 130/130 (100%)
Frame = +1
Query: 1 MVRMNVLADALNAINNAEKRGKRQVLIRPASKVIVRFLTVMMKHGYIGEFEIVDDHRAGK 180
MVRMNVLADALNAINNAEKRGKRQVLIRPASKVIVRFLTVMMKHGYIGEFEIVDDHRAGK
Sbjct: 1 MVRMNVLADALNAINNAEKRGKRQVLIRPASKVIVRFLTVMMKHGYIGEFEIVDDHRAGK 60
Query: 181 IVVNLTGRLNKASVISPRLNIRLNDLEKYTNTLLPSRQFGYLILTTSAGIMDHEEARRKH 360
IVVNLTGRLNKASVISPRLNIRLNDLEKYTNTLLPSRQFGYLILTTSAGIMDHEEARRKH
Sbjct: 61 IVVNLTGRLNKASVISPRLNIRLNDLEKYTNTLLPSRQFGYLILTTSAGIMDHEEARRKH 120
Query: 361 LGGKILGFFF 390
LGGKILGFFF
Sbjct: 121 LGGKILGFFF 130