Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F53C11_8
(1167 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17561280|ref|NP_506418.1| WD-repeat protein (42.9 kD) (5O286)... 761 0.0
gi|39590495|emb|CAE66235.1| Hypothetical protein CBG11479 [Caeno... 608 e-173
gi|48102495|ref|XP_395370.1| similar to ENSANGP00000019078 [Apis... 374 e-102
gi|41056057|ref|NP_956363.1| Unknown (protein for MGC:63940); wu... 372 e-102
gi|27882202|gb|AAH44040.1| Cg14614-prov protein [Xenopus laevis]... 369 e-100
gi|45360843|ref|NP_989097.1| hypothetical protein MGC75622 [Xeno... 368 e-100
gi|5031729|ref|NP_005819.1| WD-repeat protein [Homo sapiens] >gn... 367 e-100
gi|20129115|ref|NP_608461.1| CG14614-PA [Drosophila melanogaster... 367 e-100
gi|31204515|ref|XP_311206.1| ENSANGP00000019078 [Anopheles gambi... 367 e-100
gi|34873940|ref|XP_221032.2| similar to WD-repeat protein An11 h... 362 7e-99
gi|28879003|gb|AAH48165.1| 1700012F10Rik protein [Mus musculus] 361 2e-98
gi|39590496|emb|CAE66236.1| Hypothetical protein CBG11480 [Caeno... 360 3e-98
gi|17561278|ref|NP_506417.1| WD-repeat protein (5O282) [Caenorha... 357 2e-97
gi|50760596|ref|XP_418075.1| PREDICTED: potassium voltage-gated ... 350 3e-95
gi|7504039|pir||T22554 hypothetical protein F53C11.7 - Caenorhab... 335 9e-91
gi|22324809|gb|AAM95646.1| WD-repeat protein GhTTG4 [Gossypium h... 302 9e-81
gi|22324803|gb|AAM95643.1| WD-repeat protein GhTTG2 [Gossypium h... 298 2e-79
gi|15222113|ref|NP_172751.1| flower pigmentation protein (AN11) ... 292 1e-77
gi|15231593|ref|NP_189298.1| transducin family protein / WD-40 r... 291 2e-77
gi|28393624|gb|AAO42231.1| putative transcriptional regulator pr... 291 2e-77
gi|2290528|gb|AAC18912.1| ATAN11 [Arabidopsis thaliana] 290 4e-77
gi|21593264|gb|AAM65213.1| flower pigmentation protein ATAN11 [A... 287 4e-76
gi|13346196|gb|AAK19620.1| WD1521 [Gossypium hirsutum] 286 5e-76
gi|49388269|dbj|BAD25387.1| putative WD40 repeat protein [Oryza ... 279 8e-74
gi|37719680|gb|AAR01949.1| WD40 repeat protein [Zea mays] 273 6e-72
gi|2290532|gb|AAC18914.1| AN11 [Petunia x hybrida] 262 1e-68
gi|6752886|gb|AAF27919.1| Ttg1-like protein [Malus x domestica] 257 4e-67
gi|14270085|dbj|BAB58883.1| putative regulatory protein in antho... 247 4e-64
gi|28829693|gb|AAO52209.1| similar to Mus musculus (Mouse). 10 d... 246 6e-64
gi|22324807|gb|AAM95645.1| WD-repeat protein GhTTG3 [Gossypium h... 243 8e-63
gi|13346184|gb|AAK19614.1| GHTTG1 [Gossypium hirsutum] 242 1e-62
gi|22324799|gb|AAM95641.1| WD-repeat protein GhTTG1 [Gossypium h... 238 2e-61
gi|15238565|ref|NP_197840.1| transparent testa glabra 1 protein ... 237 4e-61
gi|10636051|emb|CAC10524.1| transparent testa glabra 1 [Arabidop... 236 1e-60
gi|22324801|gb|AAM95642.1| WD-repeat protein GhTTG1 [Gossypium h... 234 2e-60
gi|37544703|gb|AAM76742.1| anthocyanin biosynthetic gene regulat... 225 2e-57
gi|50251896|dbj|BAD27834.1| putative anthocyanin biosynthetic ge... 218 2e-55
gi|16648278|gb|AAL25404.1| LD21275p [Drosophila melanogaster] 215 1e-54
gi|47217814|emb|CAG07228.1| unnamed protein product [Tetraodon n... 186 5e-47
gi|50557412|ref|XP_506114.1| hypothetical protein [Yarrowia lipo... 183 8e-45
gi|46126295|ref|XP_387701.1| hypothetical protein FG07525.1 [Gib... 169 1e-40
gi|19113174|ref|NP_596382.1| WD repeat protein [Schizosaccharomy... 165 2e-39
gi|32410827|ref|XP_325894.1| hypothetical protein [Neurospora cr... 159 2e-37
gi|49087896|ref|XP_405832.1| hypothetical protein AN1695.2 [Aspe... 157 4e-37
gi|38111527|gb|EAA57096.1| hypothetical protein MG08065.4 [Magna... 157 4e-37
gi|27764295|emb|CAD60575.1| unnamed protein product [Podospora a... 153 8e-36
gi|50423893|ref|XP_460531.1| unnamed protein product [Debaryomyc... 148 3e-34
gi|38091881|ref|XP_181295.2| RIKEN cDNA 1700012F10 [Mus musculus] 144 5e-33
gi|49077600|ref|XP_402640.1| hypothetical protein UM05025.1 [Ust... 140 4e-32
gi|6325009|ref|NP_015077.1| Hypothetical ORF; Ypl247cp [Saccharo... 137 4e-31
gi|29246903|gb|EAA38483.1| GLP_76_38824_37691 [Giardia lamblia A... 137 4e-31
gi|46433216|gb|EAK92664.1| hypothetical protein CaO19.384 [Candi... 137 5e-31
gi|45198364|ref|NP_985393.1| AFL157Cp [Eremothecium gossypii] >g... 137 6e-31
gi|50257279|gb|EAL19988.1| hypothetical protein CNBF3150 [Crypto... 135 1e-30
gi|50288807|ref|XP_446833.1| unnamed protein product [Candida gl... 119 1e-25
gi|50307305|ref|XP_453631.1| unnamed protein product [Kluyveromy... 96 1e-18
gi|46124841|ref|XP_386974.1| hypothetical protein FG06798.1 [Gib... 64 7e-09
gi|49076900|ref|XP_402375.1| hypothetical protein UM04760.1 [Ust... 63 2e-08
gi|50258896|gb|EAL21577.1| hypothetical protein CNBC6150 [Crypto... 63 2e-08
gi|50256850|gb|EAL19568.1| hypothetical protein CNBG1970 [Crypto... 63 2e-08
gi|50546765|ref|XP_500852.1| hypothetical protein [Yarrowia lipo... 61 4e-08
gi|19075381|ref|NP_587881.1| beta transducin, putative chromosom... 60 1e-07
gi|45185704|ref|NP_983420.1| ACR017Wp [Eremothecium gossypii] >g... 59 3e-07
gi|49118670|gb|AAH73699.1| Unknown (protein for MGC:83609) [Xeno... 59 3e-07
gi|45361381|ref|NP_989268.1| hypothetical protein MGC76117 [Xeno... 57 8e-07
gi|47228463|emb|CAG05283.1| unnamed protein product [Tetraodon n... 56 2e-06
gi|49074110|ref|XP_401211.1| hypothetical protein UM03596.1 [Ust... 56 2e-06
gi|50417916|gb|AAH78350.1| Unknown (protein for MGC:92443) [Dani... 55 3e-06
gi|28573273|ref|NP_610182.3| CG12792-PA [Drosophila melanogaster... 55 4e-06
gi|39580650|emb|CAE61332.1| Hypothetical protein CBG05170 [Caeno... 55 4e-06
gi|41054764|ref|NP_955824.1| Unknown (protein for MGC:63547) [Da... 55 4e-06
gi|28277328|gb|AAH44118.1| Grwd-pending-prov protein [Xenopus la... 54 5e-06
gi|18029281|gb|AAL56459.1| similar to retinoblastoma binding pro... 54 5e-06
gi|17556212|ref|NP_498091.1| wd repeat protein (50.6 kD) (3G243)... 54 5e-06
gi|31199377|ref|XP_308636.1| ENSANGP00000011206 [Anopheles gambi... 54 7e-06
gi|48838134|ref|ZP_00295082.1| COG2319: FOG: WD40 repeat [Methan... 54 9e-06
gi|5032027|ref|NP_005601.1| retinoblastoma binding protein 4; MS... 53 1e-05
gi|45382339|ref|NP_990183.1| chromatin assembly factor 1 p48 sub... 53 1e-05
gi|15929379|gb|AAH15123.1| Similar to retinoblastoma-binding pro... 53 1e-05
gi|34871596|ref|XP_232764.2| similar to retinoblastoma-binding p... 53 1e-05
gi|2494893|sp|Q60972|RBB4_MOUSE Chromatin assembly factor 1 subu... 53 1e-05
gi|19115776|ref|NP_594864.1| putative chromatin assembly factor ... 53 1e-05
gi|297906|emb|CAA50685.1| IEF SSP 9306 [Homo sapiens] 53 1e-05
gi|21593624|gb|AAM65591.1| putative WD-40 repeat protein, MSI2 [... 53 2e-05
gi|15227294|ref|NP_179269.1| WD-40 repeat protein (MSI2) [Arabid... 53 2e-05
gi|24021163|gb|AAN40972.1| WD40 [Tortula ruralis] 53 2e-05
gi|17555622|ref|NP_498151.1| g-protein beta WD-40 repeat (3G476)... 52 2e-05
gi|47221639|emb|CAF97904.1| unnamed protein product [Tetraodon n... 52 2e-05
gi|50551667|ref|XP_503308.1| hypothetical protein [Yarrowia lipo... 52 2e-05
gi|47717994|gb|AAH71043.1| MGC82326 protein [Xenopus laevis] 52 3e-05
gi|18916728|dbj|BAB85528.1| KIAA1942 protein [Homo sapiens] 52 3e-05
gi|15236251|ref|NP_195231.1| WD-40 repeat protein (MSI3) [Arabid... 52 3e-05
gi|27754479|gb|AAO22687.1| putative WD-40 repeat protein (MSI3) ... 52 3e-05
gi|47937750|gb|AAH72311.1| MGC82618 protein [Xenopus laevis] 52 3e-05
gi|50603606|gb|AAH77257.1| Unknown (protein for MGC:79922) [Xeno... 52 3e-05
gi|39582664|emb|CAE73768.1| Hypothetical protein CBG21312 [Caeno... 52 3e-05
gi|20091353|ref|NP_617428.1| WD40-repeat containing protein [Met... 52 3e-05
gi|34857068|ref|XP_227252.2| similar to retinoblastoma-binding p... 51 5e-05
gi|20977604|gb|AAM28229.1| nucleosome/chromatin assembly factor ... 51 5e-05
gi|31207939|ref|XP_312936.1| ENSANGP00000014714 [Anopheles gambi... 51 6e-05
gi|48130902|ref|XP_396674.1| similar to ENSANGP00000010673 [Apis... 51 6e-05
gi|50291921|ref|XP_448393.1| unnamed protein product [Candida gl... 51 6e-05
gi|19584465|emb|CAD28519.1| hypothetical protein [Homo sapiens] 51 6e-05
gi|46249661|gb|AAH68955.1| MGC83228 protein [Xenopus laevis] 50 8e-05
gi|50285397|ref|XP_445127.1| unnamed protein product [Candida gl... 50 8e-05
gi|18202731|sp|Q9BQ67|GRWD_HUMAN Glutamate-rich WD-repeat protei... 50 8e-05
gi|31542862|ref|NP_113673.2| glutamate-rich WD repeat containing... 50 8e-05
gi|29420420|dbj|BAC66461.1| A301 protein [Mus musculus] 50 8e-05
gi|17933648|ref|NP_524354.1| CG4236-PA [Drosophila melanogaster]... 50 1e-04
gi|2394233|gb|AAB70244.1| WD-40 repeat protein [Arabidopsis thal... 50 1e-04
gi|47213925|emb|CAF90748.1| unnamed protein product [Tetraodon n... 50 1e-04
gi|38047953|gb|AAR09879.1| similar to Drosophila melanogaster CG... 50 1e-04
gi|3309245|gb|AAC26046.1| retinoblastoma A associated protein; R... 50 1e-04
gi|50511187|dbj|BAD32579.1| mKIAA1923 protein [Mus musculus] 50 1e-04
gi|39645450|gb|AAH63984.1| Retinoblastoma binding protein 4 [Dan... 50 1e-04
gi|47217677|emb|CAG13308.1| unnamed protein product [Tetraodon n... 50 1e-04
gi|50260480|gb|EAL23135.1| hypothetical protein CNBA4800 [Crypto... 50 1e-04
gi|41946841|gb|AAH66082.1| 5430401O09Rik protein [Mus musculus] 50 1e-04
gi|50426037|ref|XP_461615.1| unnamed protein product [Debaryomyc... 50 1e-04
gi|47086841|ref|NP_997760.1| retinoblastoma binding protein 4 [D... 49 2e-04
gi|46227666|gb|EAK88601.1| WD40 repeat protein, predicted histon... 49 2e-04
gi|39595121|emb|CAE60158.1| Hypothetical protein CBG03710 [Caeno... 49 2e-04
gi|13928450|dbj|BAB47154.1| Sec31p [Oryza sativa] >gnl|BL_ORD_ID... 49 2e-04
gi|47217506|emb|CAG10886.1| unnamed protein product [Tetraodon n... 49 2e-04
gi|45709030|gb|AAH67546.1| Rbb4l protein [Danio rerio] 49 2e-04
gi|47086813|ref|NP_997775.1| Unknown (protein for MGC:85617) [Da... 49 2e-04
gi|28892721|ref|NP_795897.1| RIKEN cDNA 5430401O09 gene [Mus mus... 49 2e-04
gi|17508127|ref|NP_492552.1| RetinoBlastoma Associated protein p... 49 3e-04
gi|27503223|gb|AAH42283.1| Rbbp7-prov protein [Xenopus laevis] 49 3e-04
gi|45188115|ref|NP_984338.1| ADR242Cp [Eremothecium gossypii] >g... 49 3e-04
gi|3123169|sp|P90916|RBA2_CAEEL Trp-Asp repeats containing prote... 49 3e-04
gi|13325442|gb|AAH04519.1| FLJ12270 protein [Homo sapiens] 49 3e-04
gi|29747347|ref|XP_290704.1| hypothetical protein FLJ12270 [Homo... 49 3e-04
gi|31982059|ref|NP_033057.2| retinoblastoma binding protein 7; G... 48 4e-04
gi|23956278|ref|NP_700468.1| glutamate-rich WD repeat containing... 48 4e-04
gi|34856095|ref|XP_218563.2| similar to A301 protein [Rattus nor... 48 4e-04
gi|38111378|gb|EAA56968.1| hypothetical protein MG07323.4 [Magna... 48 4e-04
gi|14198122|gb|AAH08121.1| Grwd1 protein [Mus musculus] 48 4e-04
gi|49068256|ref|XP_398417.1| hypothetical protein UM00802.1 [Ust... 48 5e-04
gi|2494892|sp|Q60973|RBB7_MOUSE Histone acetyltransferase type B... 48 5e-04
gi|4506439|ref|NP_002884.1| retinoblastoma binding protein 7; re... 48 5e-04
gi|6323779|ref|NP_013850.1| RiboSome Assembly 2; Rrb1p [Saccharo... 48 5e-04
gi|7494450|pir||B71610 WD40 WEB-1 homolog PFB0640c - malaria par... 48 5e-04
gi|28277505|gb|AAH45315.1| Unknown (protein for MGC:55349) [Dani... 48 5e-04
gi|23593308|ref|NP_473056.2| hypothetical protein, conserved [Pl... 48 5e-04
gi|23612855|ref|NP_704394.1| hypothetical protein, conserved [Pl... 48 5e-04
gi|47221825|emb|CAG08879.1| unnamed protein product [Tetraodon n... 48 5e-04
gi|45361415|ref|NP_989285.1| hypothetical protein MGC76124 [Xeno... 47 7e-04
gi|50556344|ref|XP_505580.1| YlPEX7 [Yarrowia lipolytica] >gnl|B... 47 7e-04
gi|17508661|ref|NP_492551.1| RetinoBlastoma Associated protein p... 47 7e-04
gi|49067234|ref|XP_397907.1| hypothetical protein UM00292.1 [Ust... 47 7e-04
gi|49094388|ref|XP_408655.1| hypothetical protein AN4518.2 [Aspe... 47 7e-04
gi|50749440|ref|XP_421637.1| PREDICTED: similar to S. cerevisiae... 47 7e-04
gi|34899040|ref|NP_910866.1| putative Sec31p [Oryza sativa (japo... 47 7e-04
gi|50420307|ref|XP_458687.1| unnamed protein product [Debaryomyc... 47 9e-04
gi|50725282|dbj|BAD34284.1| putative WD-40 repeat protein [Oryza... 47 9e-04
gi|41055325|ref|NP_956690.1| hypothetical protein MGC63634 [Dani... 47 0.001
gi|24308452|ref|NP_620133.1| chromosome 9 open reading frame 112... 47 0.001
gi|39595122|emb|CAE60159.1| Hypothetical protein CBG03711 [Caeno... 47 0.001
gi|47225002|emb|CAF97417.1| unnamed protein product [Tetraodon n... 47 0.001
gi|38086813|ref|XP_136080.2| similar to retinoblastoma-binding p... 46 0.001
gi|50311657|ref|XP_455855.1| unnamed protein product [Kluyveromy... 46 0.001
gi|11357943|pir||T49187 hypothetical protein MAA21.90 - Arabidop... 46 0.002
gi|50310001|ref|XP_455014.1| unnamed protein product [Kluyveromy... 46 0.002
gi|34852639|ref|XP_218778.2| similar to peroxisomal PTS2 recepto... 46 0.002
gi|18447428|gb|AAL68278.1| RE21021p [Drosophila melanogaster] 46 0.002
gi|30695804|ref|NP_851024.1| WD-40 repeat family protein [Arabid... 46 0.002
gi|20129863|ref|NP_610623.1| CG6751-PA [Drosophila melanogaster]... 46 0.002
gi|26346496|dbj|BAC36899.1| unnamed protein product [Mus musculus] 46 0.002
gi|30695806|ref|NP_191905.3| WD-40 repeat family protein [Arabid... 46 0.002
gi|50251804|dbj|BAD27735.1| putative peroxisomal targeting signa... 46 0.002
gi|47085783|ref|NP_998228.1| zgc:55946 [Danio rerio] >gnl|BL_ORD... 45 0.002
gi|6679283|ref|NP_032848.1| peroxisome biogenesis factor 7 [Mus ... 45 0.002
gi|25090901|sp|Q8R537|PEX7_CRIGR Peroxisomal targeting signal 2 ... 45 0.002
gi|50425681|ref|XP_461437.1| unnamed protein product [Debaryomyc... 45 0.002
gi|49120003|ref|XP_412324.1| hypothetical protein AN8187.2 [Aspe... 45 0.002
gi|19112672|ref|NP_595880.1| WD repeat protein; possible nuclear... 45 0.002
gi|15224798|ref|NP_179544.1| transducin family protein / WD-40 r... 45 0.002
gi|50753589|ref|XP_414054.1| PREDICTED: similar to 5430401O09Rik... 45 0.003
gi|6320779|ref|NP_010858.1| Subunit of the Hat1p-Hat2p histone a... 45 0.003
gi|50427295|ref|XP_462260.1| unnamed protein product [Debaryomyc... 45 0.004
gi|28829827|gb|AAO52329.1| similar to Expressed protein; protein... 45 0.004
gi|47225992|emb|CAG04366.1| unnamed protein product [Tetraodon n... 45 0.004
gi|49095822|ref|XP_409372.1| hypothetical protein AN5235.2 [Aspe... 45 0.004
gi|50755377|ref|XP_414721.1| PREDICTED: similar to Mgc47001-prov... 45 0.004
gi|46441950|gb|EAL01243.1| hypothetical protein CaO19.7900 [Cand... 44 0.006
gi|50309771|ref|XP_454898.1| unnamed protein product [Kluyveromy... 44 0.006
gi|23480360|gb|EAA16941.1| putative WD-40 repeat protein [Plasmo... 44 0.006
gi|29245960|gb|EAA37575.1| GLP_503_9498_8173 [Giardia lamblia AT... 44 0.006
gi|47606182|sp|Q8IZU2|WD17_HUMAN WD-repeat protein 17 >gnl|BL_OR... 44 0.006
gi|31317311|ref|NP_733828.2| WD repeat domain 17 isoform 1 [Homo... 44 0.006
gi|19112374|ref|NP_595582.1| putative COPII coat component; WD r... 44 0.006
gi|49105493|ref|XP_411342.1| hypothetical protein AN7205.2 [Aspe... 44 0.006
gi|46432886|gb|EAK92349.1| hypothetical protein CaO19.6355 [Cand... 44 0.007
gi|47230304|emb|CAG10718.1| unnamed protein product [Tetraodon n... 44 0.007
gi|6009490|dbj|BAA84923.1| ABP125 [Homo sapiens] 44 0.007
gi|34851768|ref|XP_226477.2| similar to RIKEN cDNA 5430401O09 ge... 44 0.007
gi|39587702|emb|CAE58640.1| Hypothetical protein CBG01808 [Caeno... 44 0.007
gi|41281697|ref|NP_624354.1| coronin, actin binding protein 6 is... 44 0.009
gi|41281703|ref|NP_624356.1| coronin, actin binding protein 6 is... 44 0.009
gi|40788981|dbj|BAA74928.2| KIAA0905 protein [Homo sapiens] 44 0.009
gi|42733986|gb|AAS38881.1| similar to Dictyostelium discoideum (... 44 0.009
gi|47221369|emb|CAF97287.1| unnamed protein product [Tetraodon n... 44 0.009
gi|6009492|dbj|BAA84924.1| ABP130 [Homo sapiens] 44 0.009
gi|28839044|gb|AAH47883.1| SEC31L1 protein [Homo sapiens] 44 0.009
gi|41349439|ref|NP_055748.2| SEC31-like 1 isoform 1; yeast Sec31... 44 0.009
gi|15237140|ref|NP_200631.1| WD-40 repeat protein (MSI1) [Arabid... 44 0.009
gi|41281700|ref|NP_624355.1| coronin, actin binding protein 6 is... 44 0.009
gi|48891324|ref|ZP_00324864.1| COG2319: FOG: WD40 repeat [Tricho... 44 0.009
gi|46226954|gb|EAK87920.1| WD repeat protein [Cryptosporidium pa... 44 0.009
gi|41349441|ref|NP_057295.2| SEC31-like 1 isoform 2; yeast Sec31... 44 0.009
gi|32418556|ref|XP_329756.1| hypothetical protein [Neurospora cr... 44 0.009
gi|19743678|gb|AAL92489.1| SlX1-like protein [Silene conica] 44 0.009
gi|50746511|ref|XP_420529.1| PREDICTED: similar to WD repeat dom... 43 0.012
gi|46433652|gb|EAK93085.1| hypothetical protein CaO19.9693 [Cand... 43 0.012
gi|38080334|ref|XP_132230.3| RIKEN cDNA 1810024J13 [Mus musculus] 43 0.012
gi|23478705|gb|EAA15718.1| hypothetical protein [Plasmodium yoel... 43 0.012
gi|34853114|ref|XP_215991.2| similar to RIKEN cDNA 2810443J12 [R... 43 0.012
gi|49128229|ref|XP_412838.1| hypothetical protein AN8701.2 [Aspe... 43 0.016
gi|21386786|gb|AAM23300.1| XY1 protein [Silene vulgaris] 43 0.016
gi|49097674|ref|XP_410297.1| hypothetical protein AN6160.2 [Aspe... 43 0.016
gi|30851621|gb|AAH52530.1| 2610529I12Rik protein [Mus musculus] 43 0.016
gi|46410024|gb|AAS93869.1| G-protein beta subunit [Paramecium te... 42 0.021
gi|50258421|gb|EAL21110.1| hypothetical protein CNBD4860 [Crypto... 42 0.021
gi|46441813|gb|EAL01107.1| hypothetical protein CaO19.268 [Candi... 42 0.021
gi|32418804|ref|XP_329880.1| hypothetical protein [Neurospora cr... 42 0.021
gi|6320333|ref|NP_010413.1| Hypothetical ORF; Ydr128wp [Saccharo... 42 0.021
gi|29841245|gb|AAP06277.1| similar to NM_079059 GTP-binding-prot... 42 0.021
gi|5821391|dbj|BAA83801.1| coronin homolog [Xenopus laevis] >gnl... 42 0.021
gi|45361619|ref|NP_989383.1| hypothetical protein MGC76199 [Xeno... 42 0.021
gi|49069946|ref|XP_399262.1| hypothetical protein UM01647.1 [Ust... 42 0.021
gi|45187687|ref|NP_983910.1| ADL186Cp [Eremothecium gossypii] >g... 42 0.021
gi|38103823|gb|EAA50476.1| hypothetical protein MG04235.4 [Magna... 42 0.021
gi|46133991|ref|XP_389311.1| hypothetical protein FG09135.1 [Gib... 42 0.027
gi|21386790|gb|AAM23302.1| XY1 protein [Silene flos-jovis] 42 0.027
gi|28572024|ref|NP_651720.3| CG7609-PB [Drosophila melanogaster]... 42 0.027
gi|3122386|sp|O22466|MSI1_LYCES WD-40 repeat protein MSI1 >gnl|B... 42 0.027
gi|5701953|emb|CAB52261.1| Y1 protein [Silene latifolia] 42 0.027
gi|21313066|ref|NP_080320.1| RIKEN cDNA 2810443J12 [Mus musculus... 42 0.027
gi|32413088|ref|XP_327024.1| hypothetical protein [Neurospora cr... 42 0.027
gi|48140558|ref|XP_393516.1| similar to ENSANGP00000014751 [Apis... 42 0.027
gi|17232326|ref|NP_488874.1| WD-repeat protein [Nostoc sp. PCC 7... 42 0.027
gi|24286043|gb|AAM09808.1| Sec31p [Yarrowia lipolytica] 42 0.027
gi|28279446|gb|AAH46252.1| Mgc47001-prov protein [Xenopus laevis] 42 0.027
gi|38181570|gb|AAH61558.1| Coro1b protein [Rattus norvegicus] 42 0.027
gi|27882028|gb|AAH44569.1| S. cerevisiae SEC31-like 2, isoform b... 42 0.027
gi|20806171|ref|NP_620815.1| coronin relative protein [Rattus no... 42 0.027
gi|17902568|emb|CAC81926.1| putative WD-repeat protein [Silene l... 42 0.027
gi|9506507|ref|NP_062095.1| coronin, actin-binding protein, 1B; ... 42 0.027
gi|50554379|ref|XP_504598.1| YlSEC31 [Yarrowia lipolytica] >gnl|... 42 0.027
gi|6753494|ref|NP_035908.1| coronin, actin binding protein 1B; c... 42 0.027
gi|32412970|ref|XP_326965.1| hypothetical protein [Neurospora cr... 42 0.027
gi|24651122|ref|NP_733303.1| CG7609-PA [Drosophila melanogaster]... 42 0.027
gi|17541132|ref|NP_502541.1| nuclear phosphoprotein S. cerevisia... 42 0.036
gi|34875099|ref|XP_214188.2| similar to ARP2/3 complex 41 kDa su... 42 0.036
gi|15240710|ref|NP_201533.1| WD-40 repeat family protein [Arabid... 42 0.036
gi|47223644|emb|CAF99253.1| unnamed protein product [Tetraodon n... 42 0.036
gi|46229578|gb|EAK90396.1| WD40 domain protein [Cryptosporidium ... 42 0.036
gi|6753492|ref|NP_034028.1| coronin, actin binding protein 1A; c... 42 0.036
gi|31418362|gb|AAH53398.1| Coronin, actin binding protein 1A [Mu... 42 0.036
gi|34863441|ref|XP_342055.1| similar to secretory pathway compon... 42 0.036
gi|50542962|ref|XP_499647.1| hypothetical protein [Yarrowia lipo... 42 0.036
gi|15242311|ref|NP_196473.1| transducin family protein / WD-40 r... 42 0.036
gi|40218073|gb|AAR82959.1| transducin/WD-40 repeat protein [Oryz... 42 0.036
gi|47226489|emb|CAG08505.1| unnamed protein product [Tetraodon n... 42 0.036
gi|50761511|ref|XP_424742.1| PREDICTED: similar to Cockayne synd... 42 0.036
gi|46227206|gb|EAK88156.1| WD repeat protein [Cryptosporidium pa... 41 0.047
gi|21386778|gb|AAM23296.1| X1 protein [Silene latifolia] >gnl|BL... 41 0.047
gi|50311869|ref|XP_455966.1| unnamed protein product [Kluyveromy... 41 0.047
gi|30684620|ref|NP_196888.2| WD-40 repeat family protein [Arabid... 41 0.047
gi|21595088|gb|AAH31606.1| PEX7 protein [Homo sapiens] 41 0.047
gi|4895037|gb|AAD32703.1| coronin-1 [Mus musculus] >gnl|BL_ORD_I... 41 0.047
gi|4505731|ref|NP_000279.1| peroxisomal biogenesis factor 7; per... 41 0.047
gi|18426834|ref|NP_569095.1| coronin, actin binding protein 1A [... 41 0.047
gi|17902570|emb|CAC81927.1| putative WD-repeat protein [Silene l... 41 0.047
gi|14717392|ref|NP_148981.1| vesicle associated protein [Rattus ... 41 0.047
gi|41052668|dbj|BAD07515.1| putative WD-40 repeat protein [Oryza... 41 0.047
gi|5701955|emb|CAB52219.1| X1 protein [Silene latifolia] 41 0.047
gi|10177650|dbj|BAB11112.1| cell cycle switch protein [Arabidops... 41 0.047
gi|5701951|emb|CAB52218.1| Y1 protein [Silene latifolia] 41 0.047
gi|50746567|ref|XP_420556.1| PREDICTED: similar to SEC31-like 1 ... 41 0.047
gi|38149910|ref|NP_937781.1| S. cerevisiae SEC31-like 2 isoform ... 41 0.061
gi|14149696|ref|NP_056305.1| S. cerevisiae SEC31-like 2 isoform ... 41 0.061
gi|14149734|ref|NP_065174.1| coronin, actin binding protein, 1B;... 41 0.061
gi|47211872|emb|CAF89781.1| unnamed protein product [Tetraodon n... 41 0.061
gi|39645246|gb|AAH09761.2| DKFZp434F054 protein [Homo sapiens] 41 0.061
gi|9716495|gb|AAF97517.1| WD-repeat protein RBAP1 [Zea mays] 41 0.061
gi|14550114|gb|AAK67147.1| nucleosome/chromatin assembly factor ... 41 0.061
gi|34870573|ref|XP_340772.1| similar to Hypothetical protein MGC... 41 0.061
gi|14149987|ref|NP_115635.1| hypothetical protein DKFZp434F054 [... 41 0.061
gi|30424575|ref|NP_776102.1| hypothetical protein MGC47001 [Mus ... 41 0.061
gi|18422588|ref|NP_568648.1| transducin family protein / WD-40 r... 40 0.080
gi|41055464|ref|NP_957408.1| coronin, actin binding protein, 1A;... 40 0.080
gi|2599092|gb|AAD03340.1| WD-40 repeat protein MSI4 [Arabidopsis... 40 0.080
gi|20197482|gb|AAD10151.2| putative WD-40 repeat protein, MSI4 [... 40 0.080
gi|12963527|ref|NP_075631.1| actin related protein 2/3 complex, ... 40 0.080
gi|9506405|ref|NP_062162.1| actin related protein 2/3 complex, s... 40 0.080
gi|12832138|dbj|BAB21980.1| unnamed protein product [Mus musculu... 40 0.080
gi|38086318|ref|XP_204410.2| similar to ARP2/3 complex 41 kDa su... 40 0.080
gi|27806251|ref|NP_776946.1| coronin, actin binding protein, 1A ... 40 0.080
gi|23481363|gb|EAA17664.1| Homo sapiens RIKEN cDNA 1600015H11 ge... 40 0.080
gi|34862412|ref|XP_343187.1| similar to periodic tryptophan prot... 40 0.080
gi|27923818|sp|P59235|NU43_MOUSE Nucleoporin Nup43 >gnl|BL_ORD_I... 40 0.080
gi|30680701|ref|NP_565456.2| WD-40 repeat protein (MSI4) [Arabid... 40 0.080
gi|16307455|gb|AAH10275.1| Arpc1b protein [Mus musculus] 40 0.080
gi|21898564|gb|AAM77039.1| nucleosome/chromatin assembly factor ... 40 0.080
gi|15620905|dbj|BAB67816.1| KIAA1923 protein [Homo sapiens] 40 0.10
gi|50742704|ref|XP_419724.1| PREDICTED: similar to peroxisomal P... 40 0.10
gi|11463876|dbj|BAB18589.1| coronin [Hemicentrotus pulcherrimus] 40 0.10
gi|19074497|ref|NP_586003.1| HISTONE ACETYLTRANSFERASE TYPE B SU... 40 0.10
gi|4572293|gb|AAD23736.1| coronin 1B; coronin, actin binding pro... 40 0.10
gi|4689316|gb|AAD27848.1| peroxisomal targeting signal type 2 re... 40 0.14
gi|23485912|gb|EAA20640.1| Coronin [Plasmodium yoelii yoelii] 40 0.14
gi|34809550|gb|AAH14887.2| FLJ12270 protein [Homo sapiens] 40 0.14
gi|34868591|ref|XP_217063.2| similar to RIKEN cDNA D030041N15 [R... 40 0.14
gi|50754993|ref|XP_414574.1| PREDICTED: similar to gemin 5 [Gall... 40 0.14
gi|46111637|ref|XP_382876.1| hypothetical protein FG02700.1 [Gib... 40 0.14
gi|45382771|ref|NP_990001.1| Rbap46 polypeptide [Gallus gallus] ... 40 0.14
gi|25301665|pir||JC7558 chromatin assembly factor-1 p48 subunit ... 40 0.14
gi|50255919|gb|EAL18649.1| hypothetical protein CNBI3490 [Crypto... 40 0.14
gi|19173109|ref|NP_597660.1| similarity to CDC20 (WD-repeat prot... 40 0.14
gi|17538129|ref|NP_496075.1| FiZzy Related (76.4 kD) (fzr-1) [Ca... 40 0.14
gi|49115501|gb|AAH73411.1| Unknown (protein for MGC:80877) [Xeno... 40 0.14
gi|23510311|ref|NP_700465.1| achalasia, adrenocortical insuffici... 40 0.14
gi|20137304|sp|P58742|AAAS_MOUSE Aladin (Adracalin) >gnl|BL_ORD_... 40 0.14
gi|15218882|ref|NP_174220.1| peroxisomal targeting signal type 2... 39 0.18
gi|46123775|ref|XP_386441.1| hypothetical protein FG06265.1 [Gib... 39 0.18
gi|21618224|gb|AAM67274.1| unknown [Arabidopsis thaliana] 39 0.18
gi|45190337|ref|NP_984591.1| AEL269Cp [Eremothecium gossypii] >g... 39 0.18
gi|48142990|ref|XP_397394.1| similar to CG7609-PB [Apis mellifera] 39 0.18
gi|50308255|ref|XP_454128.1| unnamed protein product [Kluyveromy... 39 0.18
gi|28829271|gb|AAO51813.1| similar to Homo sapiens (Human). Tumo... 39 0.18
gi|50306273|ref|XP_453108.1| unnamed protein product [Kluyveromy... 39 0.18
gi|41053569|ref|NP_956586.1| hypothetical protein MGC56486 [Dani... 39 0.18
gi|6319672|ref|NP_009754.1| Subunit of chromatin assembly factor... 39 0.18
gi|48136805|ref|XP_396783.1| similar to Hypothetical protein MGC... 39 0.18
gi|5821393|dbj|BAA83802.1| coronin homolog [Xenopus laevis] >gnl... 39 0.18
gi|32189380|ref|NP_078923.3| nucleoporin 43kDa; nucleoporin Nup4... 39 0.18
gi|38085179|ref|XP_140784.2| similar to secretory pathway compon... 39 0.18
gi|45190357|ref|NP_984611.1| AEL250Cp [Eremothecium gossypii] >g... 39 0.23
gi|34451597|gb|AAQ72359.1| B-type cell cycle switch protein ccs5... 39 0.23
gi|3746658|gb|AAC64041.1| Hira isoform [Drosophila melanogaster] 39 0.23
gi|3645|emb|CAA42058.1| Cdc20 [Saccharomyces cerevisiae] 39 0.23
gi|38173763|gb|AAH60754.1| MGC69077 protein [Xenopus laevis] 39 0.23
gi|38102632|gb|EAA49450.1| hypothetical protein MG01108.4 [Magna... 39 0.23
gi|41152032|ref|NP_958452.1| coronin, actin binding protein, 1C ... 39 0.23
gi|32415780|ref|XP_328368.1| hypothetical protein [Neurospora cr... 39 0.23
gi|10048265|gb|AAG12330.1| heterotrimeric GTP-binding protein su... 39 0.23
gi|6321322|ref|NP_011399.1| Cell-cycle regulated activator of an... 39 0.23
gi|31228399|ref|XP_318047.1| ENSANGP00000010673 [Anopheles gambi... 39 0.23
gi|23336935|gb|AAH37200.1| Cockayne syndrome 1 homolog [Mus musc... 39 0.23
gi|48095740|ref|XP_392352.1| similar to SI:bZ1G18.15 (novel prot... 39 0.23
gi|47085927|ref|NP_998321.1| actin related protein 2/3 complex, ... 39 0.23
gi|47218767|emb|CAG02753.1| unnamed protein product [Tetraodon n... 39 0.23
gi|416288|dbj|BAA03957.1| CDC20 [Saccharomyces cerevisiae] 39 0.23
gi|50289957|ref|XP_447410.1| unnamed protein product [Candida gl... 39 0.23
gi|26336304|dbj|BAC31837.1| unnamed protein product [Mus musculus] 39 0.30
gi|32417648|ref|XP_329302.1| hypothetical protein [Neurospora cr... 39 0.30
gi|12849534|dbj|BAB28381.1| unnamed protein product [Mus musculus] 39 0.30
gi|1628438|emb|CAA64732.1| ORF [Saccharomyces cerevisiae] 39 0.30
gi|10434331|dbj|BAB14222.1| unnamed protein product [Homo sapiens] 39 0.30
gi|13096812|gb|AAH03199.1| Periodic tryptophan protein 1 homolog... 39 0.30
gi|19923062|ref|NP_598754.1| periodic tryptophan protein 1 homol... 39 0.30
gi|3023842|sp|P93563|GBB_SOLTU Guanine nucleotide-binding protei... 39 0.30
gi|18676480|dbj|BAB84892.1| FLJ00137 protein [Homo sapiens] 39 0.30
gi|39579211|emb|CAE56991.1| Hypothetical protein CBG24857 [Caeno... 39 0.30
gi|50881441|gb|AAT85286.1| MSI type nucleosome/chromatin assembl... 39 0.30
gi|1708202|sp|P54198|HIRA_HUMAN HIRA protein (TUP1 like enhancer... 39 0.30
gi|21536485|ref|NP_003316.3| HIR (histone cell cycle regulation ... 39 0.30
gi|31202019|ref|XP_309957.1| ENSANGP00000004412 [Anopheles gambi... 39 0.30
gi|23957688|ref|NP_082496.2| WD repeat domain 17 [Mus musculus] ... 39 0.30
gi|21312586|ref|NP_082318.1| Cockayne syndrome 1 homolog [Mus mu... 39 0.30
gi|22001417|ref|NP_056280.1| gemin 5 [Homo sapiens] >gnl|BL_ORD_... 39 0.30
gi|18077663|emb|CAD20255.1| cockayne syndrome group A [Mus muscu... 39 0.30
gi|631489|pir||S45344 TUP1 like enhancer - human >gnl|BL_ORD_ID|... 39 0.30
gi|6324434|ref|NP_014503.1| Hypothetical ORF; Yol138cp [Saccharo... 39 0.30
gi|50294329|ref|XP_449576.1| unnamed protein product [Candida gl... 39 0.30
gi|50545357|ref|XP_500216.1| hypothetical protein [Yarrowia lipo... 39 0.30
gi|45508168|ref|ZP_00160508.1| COG2319: FOG: WD40 repeat [Anabae... 39 0.30
gi|50553638|ref|XP_504230.1| hypothetical protein [Yarrowia lipo... 39 0.30
gi|840774|emb|CAA54721.1| HIRAHs [Homo sapiens] 39 0.30
gi|42362327|gb|AAS13372.1| WD-repeat cell cycle regulatory prote... 38 0.40
gi|34910754|ref|NP_916724.1| P0042A10.6 [Oryza sativa (japonica ... 38 0.40
gi|7485323|pir||T04774 hypothetical protein F10M10.50 - Arabidop... 38 0.40
gi|37202034|gb|AAQ89632.1| At4g29730 [Arabidopsis thaliana] 38 0.40
gi|17555002|ref|NP_498096.1| nuclear matrix protein SNEV (3G260)... 38 0.40
gi|25446692|gb|AAN74839.1| Putative cell cycle switch protein [O... 38 0.40
gi|38345769|emb|CAE03470.2| OSJNBa0083N12.7 [Oryza sativa (japon... 38 0.40
gi|5031601|ref|NP_005711.1| actin related protein 2/3 complex su... 38 0.40
gi|37606128|emb|CAE50163.1| SI:zC191D15.1 (novel protein similar... 38 0.40
gi|3023832|sp|P93397|GBB1_TOBAC Guanine nucleotide-binding prote... 38 0.40
gi|15778632|gb|AAL07488.1| G protein beta subunit 2 [Solanum tub... 38 0.40
gi|15233674|ref|NP_194702.1| WD-40 repeat family protein [Arabid... 38 0.40
gi|47227972|emb|CAF97601.1| unnamed protein product [Tetraodon n... 38 0.40
gi|30689988|ref|NP_195154.2| transducin family protein / WD-40 r... 38 0.40
gi|38073349|ref|XP_136170.3| similar to zinc finger protein 91 (... 38 0.40
gi|27924440|gb|AAH45043.1| Arx-3and3n122-prov protein [Xenopus l... 38 0.40
gi|34910476|ref|NP_916585.1| putative WD-repeat protein RBAP1 [O... 38 0.40
gi|39592945|emb|CAE62559.1| Hypothetical protein CBG06669 [Caeno... 38 0.40
gi|7512929|pir||T17345 hypothetical protein DKFZp586M1824.1 - hu... 38 0.52
gi|50311095|ref|XP_455571.1| unnamed protein product [Kluyveromy... 38 0.52
gi|50754099|ref|XP_414244.1| PREDICTED: similar to DKFZP434C245 ... 38 0.52
gi|19527358|ref|NP_598890.1| nuclear matrix protein SNEV [Mus mu... 38 0.52
gi|7657381|ref|NP_055317.1| PRP19/PSO4 homolog; nuclear matrix p... 38 0.52
gi|45184667|ref|NP_982385.1| AAL157Cp [Eremothecium gossypii] >g... 38 0.52
gi|46109128|ref|XP_381622.1| hypothetical protein FG01446.1 [Gib... 38 0.52
gi|31202521|ref|XP_310209.1| ENSANGP00000010454 [Anopheles gambi... 38 0.52
gi|26338912|dbj|BAC33127.1| unnamed protein product [Mus musculus] 38 0.52
gi|27503900|gb|AAH42288.1| MGC53536 protein [Xenopus laevis] 38 0.52
gi|2494216|sp|Q16960|DYI3_ANTCR Dynein intermediate chain 3, cil... 38 0.52
gi|17017388|gb|AAL33648.1| MSI type nucleosome/chromatin assembl... 38 0.52
gi|50259595|gb|EAL22268.1| hypothetical protein CNBC4060 [Crypto... 38 0.52
gi|26345812|dbj|BAC36557.1| unnamed protein product [Mus musculus] 38 0.52
gi|50548851|ref|XP_501895.1| hypothetical protein [Yarrowia lipo... 38 0.52
gi|49903464|gb|AAH76887.1| Unknown (protein for MGC:88952) [Xeno... 38 0.52
gi|47229624|emb|CAG06820.1| unnamed protein product [Tetraodon n... 38 0.52
gi|17229616|ref|NP_486164.1| WD-40 repeat protein [Nostoc sp. PC... 38 0.52
gi|49250840|gb|AAH74533.1| Unknown (protein for MGC:69283) [Xeno... 37 0.68
gi|45198505|ref|NP_985534.1| AFL014Cp [Eremothecium gossypii] >g... 37 0.68
gi|28279856|gb|AAH44093.1| Nmp200-prov protein [Xenopus laevis] 37 0.68
gi|31199241|ref|XP_308568.1| ENSANGP00000016070 [Anopheles gambi... 37 0.68
gi|22969840|ref|ZP_00017055.1| hypothetical protein [Chloroflexu... 37 0.68
gi|5902134|ref|NP_009005.1| coronin, actin binding protein, 1A; ... 37 0.68
gi|1002923|gb|AAA77058.1| coronin-like protein 37 0.68
gi|42565893|ref|NP_190907.2| transducin family protein / WD-40 r... 37 0.68
gi|30584071|gb|AAP36284.1| Homo sapiens achalasia, adrenocortica... 37 0.68
gi|42562156|ref|NP_173317.2| transducin family protein / WD-40 r... 37 0.68
gi|47207366|emb|CAG14264.1| unnamed protein product [Tetraodon n... 37 0.68
gi|41152065|ref|NP_958490.1| hypothetical protein MGC55958 [Dani... 37 0.68
gi|50344856|ref|NP_001002100.1| zgc:86896 [Danio rerio] >gnl|BL_... 37 0.68
gi|25518075|pir||B86322 F6A14.8 protein - Arabidopsis thaliana >... 37 0.68
gi|46121461|ref|XP_385285.1| hypothetical protein FG05109.1 [Gib... 37 0.68
gi|12962937|ref|NP_056480.1| achalasia, adrenocortical insuffici... 37 0.68
gi|7021151|dbj|BAA91394.1| unnamed protein product [Homo sapiens] 37 0.68
gi|47086987|ref|NP_998500.1| zgc:63980 [Danio rerio] >gnl|BL_ORD... 37 0.68
gi|46439600|gb|EAK98916.1| hypothetical protein CaO19.10751 [Can... 37 0.88
gi|50550681|ref|XP_502813.1| hypothetical protein [Yarrowia lipo... 37 0.88
gi|45200907|ref|NP_986477.1| AGL190Wp [Eremothecium gossypii] >g... 37 0.88
gi|37778986|gb|AAP20153.1| actin-binding protein [Pagrus major] 37 0.88
gi|7441555|pir||T02059 GTP-binding regulatory protein beta chain... 37 0.88
gi|21326455|ref|NP_647549.1| neuronal differentiation-related ge... 37 0.88
gi|34872826|ref|XP_222275.2| similar to slingshot 1 [Rattus norv... 37 0.88
gi|31542413|ref|NP_035909.2| coronin, actin binding protein 1C; ... 37 0.88
gi|7656991|ref|NP_055140.1| coronin, actin binding protein, 1C; ... 37 0.88
gi|12229770|sp|Q9WUM4|CO1C_MOUSE Coronin 1C (Coronin 3) >gnl|BL_... 37 0.88
gi|17647459|ref|NP_523783.1| CG5519-PA [Drosophila melanogaster]... 37 0.88
gi|31543297|ref|NP_003571.2| neutral sphingomyelinase (N-SMase) ... 37 0.88
gi|38100156|gb|EAA47326.1| hypothetical protein MG02569.4 [Magna... 37 0.88
gi|3023859|sp|Q40507|GBB3_TOBAC Guanine nucleotide-binding prote... 37 0.88
gi|11346452|pir||T47172 hypothetical protein DKFZp762H186.1 - hu... 37 0.88
gi|50742535|ref|XP_419667.1| PREDICTED: similar to Nucleoporin N... 37 0.88
gi|17137608|ref|NP_477395.1| CG7961-PA [Drosophila melanogaster]... 37 0.88
gi|3676167|emb|CAA09492.1| coatomer alpha subunit [Drosophila me... 37 0.88
gi|34932882|ref|XP_344558.1| similar to WD repeat domain 17 [Rat... 37 0.88
gi|42568419|ref|NP_199754.2| transducin family protein / WD-40 r... 37 0.88
gi|46441861|gb|EAL01155.1| hypothetical protein CaO19.316 [Candi... 37 1.2
gi|50421125|ref|XP_459108.1| unnamed protein product [Debaryomyc... 37 1.2
gi|24586098|ref|NP_610242.1| CG9446-PA [Drosophila melanogaster]... 37 1.2
gi|24640390|ref|NP_572401.2| CG12153-PA [Drosophila melanogaster... 37 1.2
gi|11346445|pir||A59246 HIRA protein - fruit fly (Drosophila mel... 37 1.2
gi|31214897|ref|XP_315920.1| ENSANGP00000022450 [Anopheles gambi... 37 1.2
gi|6754202|ref|NP_034565.1| histone cell cycle regulation defect... 37 1.2
gi|22773842|dbj|BAC11842.1| HIRA [Gallus gallus] 37 1.2
gi|17943201|pdb|1K8K|C Chain C, Crystal Structure Of Arp23 COMPLEX 37 1.2
gi|50287713|ref|XP_446286.1| unnamed protein product [Candida gl... 37 1.2
gi|31236603|ref|XP_319442.1| ENSANGP00000002872 [Anopheles gambi... 37 1.2
gi|2137602|pir||S68141 nuclear protein HIRA - mouse >gnl|BL_ORD_... 37 1.2
gi|47229301|emb|CAG04053.1| unnamed protein product [Tetraodon n... 37 1.2
gi|49523001|gb|AAH75371.1| Unknown (protein for MGC:89080) [Xeno... 37 1.2
gi|1771288|emb|CAA68049.1| HIRA [Mus musculus] 37 1.2
gi|3041690|sp|Q61666|HIRA_MOUSE HIRA protein (TUP1 like enhancer... 37 1.2
gi|19114073|ref|NP_593161.1| wd-domain protein; CDC20/p55CDC/Fiz... 37 1.2
gi|38107622|gb|EAA53768.1| hypothetical protein MG09518.4 [Magna... 37 1.2
gi|50419381|ref|XP_458216.1| unnamed protein product [Debaryomyc... 37 1.2
gi|3023946|sp|O42611|HIRA_FUGRU HIRA protein (TUP1 like enhancer... 37 1.2
gi|19922858|ref|NP_611854.1| CG16783-PA [Drosophila melanogaster... 37 1.2
gi|17563660|ref|NP_506685.1| denticleless homolog (82.2 kD) (5P4... 37 1.2
gi|41054303|ref|NP_956049.1| Unknown (protein for MGC:65943); mg... 37 1.2
gi|17862164|gb|AAL39559.1| LD11036p [Drosophila melanogaster] 37 1.2
gi|47207697|emb|CAF89860.1| unnamed protein product [Tetraodon n... 37 1.2
gi|31127112|gb|AAH52856.1| Hira protein [Mus musculus] 37 1.2
gi|19112071|ref|NP_595279.1| putative coatomer alpha subunit [Sc... 37 1.2
gi|50260356|gb|EAL23015.1| hypothetical protein CNBA7820 [Crypto... 37 1.2
gi|34870040|ref|XP_344058.1| similar to HIRA [Rattus norvegicus] 37 1.2
gi|47227669|emb|CAG09666.1| unnamed protein product [Tetraodon n... 37 1.2
gi|31214883|ref|XP_315917.1| ENSANGP00000013592 [Anopheles gambi... 37 1.2
gi|34854967|ref|XP_342643.1| similar to cDNA sequence BC020002 [... 36 1.5
gi|20842228|ref|XP_143950.1| similar to hypothetical protein FLJ... 36 1.5
gi|34911282|ref|NP_916988.1| guanine nucleotide-binding protein ... 36 1.5
gi|50732529|ref|XP_418678.1| PREDICTED: similar to CDNA sequence... 36 1.5
gi|50419399|ref|XP_458225.1| unnamed protein product [Debaryomyc... 36 1.5
gi|14336712|gb|AAK61244.1| similar to FBan0007609 [Homo sapiens] 36 1.5
gi|47218659|emb|CAG04988.1| unnamed protein product [Tetraodon n... 36 1.5
gi|47086251|ref|NP_998057.1| hypothetical protein zgc:77032 [Dan... 36 1.5
gi|19923529|ref|NP_060853.2| WD repeat domain 33 [Homo sapiens] ... 36 1.5
gi|3023841|sp|P93339|GBB_NICPL Guanine nucleotide-binding protei... 36 1.5
gi|47222886|emb|CAF96553.1| unnamed protein product [Tetraodon n... 36 1.5
gi|38090732|ref|XP_137286.2| similar to retinoblastoma-binding p... 36 1.5
gi|3122074|sp|Q92636|FAN_HUMAN Protein FAN (Factor associated wi... 36 1.5
gi|7020344|dbj|BAA91090.1| unnamed protein product [Homo sapiens] 36 1.5
>gi|17561280|ref|NP_506418.1| WD-repeat protein (42.9 kD) (5O286)
[Caenorhabditis elegans]
gi|7504040|pir||T22553 hypothetical protein F53C11.8 - Caenorhabditis
elegans
gi|3877477|emb|CAB02115.1| Hypothetical protein F53C11.8
[Caenorhabditis elegans]
Length = 388
Score = 761 bits (1964), Expect = 0.0
Identities = 370/388 (95%), Positives = 370/388 (95%)
Frame = -1
Query: 1167 MATNGHAVNGEAHVMXXXXXXXXXXXXXXXXXXGRQNEIVIGGRDRRCEIYKFTSDQQLY 988
MATNGHAVNGEAHVM GRQNEIVIGGRDRRCEIYKFTSDQQLY
Sbjct: 1 MATNGHAVNGEAHVMQQVAQQPAPPGPLAPQGIGRQNEIVIGGRDRRCEIYKFTSDQQLY 60
Query: 987 ASAWSNKNDIKFRLAVGTVSDVSVNPCAANKVSIVQLKDETGELVETASFPMEFPANAVG 808
ASAWSNKNDIKFRLAVGTVSDVSVNPCAANKVSIVQLKDETGELVETASFPMEFPANAVG
Sbjct: 61 ASAWSNKNDIKFRLAVGTVSDVSVNPCAANKVSIVQLKDETGELVETASFPMEFPANAVG 120
Query: 807 FIPDPDNVYPDLIATTSDCLRLWRVVDGKVHPDAVMINNTNSQYGSALTSFDWNELEPRY 628
FIPDPDNVYPDLIATTSDCLRLWRVVDGKVHPDAVMINNTNSQYGSALTSFDWNELEPRY
Sbjct: 121 FIPDPDNVYPDLIATTSDCLRLWRVVDGKVHPDAVMINNTNSQYGSALTSFDWNELEPRY 180
Query: 627 IGVSSVDTTCTIYDVEVGCAIGQTKPTAPFTLKTQLIAHDKPVHDIEFAKINGGRDHFAT 448
IGVSSVDTTCTIYDVEVGCAIGQTKPTAPFTLKTQLIAHDKPVHDIEFAKINGGRDHFAT
Sbjct: 181 IGVSSVDTTCTIYDVEVGCAIGQTKPTAPFTLKTQLIAHDKPVHDIEFAKINGGRDHFAT 240
Query: 447 VGADGSARMFDLRHLNHSTIVYEDPNKEKLQRLSWNKQEPYFMALFAENSQEVQILDIRM 268
VGADGSARMFDLRHLNHSTIVYEDPNKEKLQRLSWNKQEPYFMALFAENSQEVQILDIRM
Sbjct: 241 VGADGSARMFDLRHLNHSTIVYEDPNKEKLQRLSWNKQEPYFMALFAENSQEVQILDIRM 300
Query: 267 PCNILCRLRNHTGPVNGIAWAPHSPHHICTAGDDSQALIWDLQQVPRPVDDPILAYSAGG 88
PCNILCRLRNHTGPVNGIAWAPHSPHHICTAGDDSQALIWDLQQVPRPVDDPILAYSAGG
Sbjct: 301 PCNILCRLRNHTGPVNGIAWAPHSPHHICTAGDDSQALIWDLQQVPRPVDDPILAYSAGG 360
Query: 87 EVNQIHWGPVHSNWIAICFNKTLEILRV 4
EVNQIHWGPVHSNWIAICFNKTLEILRV
Sbjct: 361 EVNQIHWGPVHSNWIAICFNKTLEILRV 388