Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F53E4_1
(977 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17561284|ref|NP_506895.1| kelch domain containing 3 (48.2 kD)... 702 0.0
gi|39590039|emb|CAE61037.1| Hypothetical protein CBG04780 [Caeno... 531 e-149
gi|47216693|emb|CAG05190.1| unnamed protein product [Tetraodon n... 280 5e-74
gi|17390341|gb|AAH18154.1| Kelch domain containing 3 [Mus muscul... 276 7e-73
gi|13397913|emb|CAC34582.1| hypothetical protein [Mus musculus] 276 7e-73
gi|17017965|ref|NP_082186.1| kelch domain containing 3; testis i... 276 7e-73
gi|14669812|dbj|BAB62016.1| Peas [Mus musculus] 276 7e-73
gi|14495697|gb|AAH09460.1| KLHDC3 protein [Homo sapiens] 275 1e-72
gi|16945972|ref|NP_476502.1| testis intracellular mediator prote... 275 1e-72
gi|33416798|gb|AAH56132.1| Klhdc3-prov protein [Xenopus laevis] 275 1e-72
gi|31202503|ref|XP_310200.1| ENSANGP00000010968 [Anopheles gambi... 275 1e-72
gi|50738601|ref|XP_419322.1| PREDICTED: similar to testis intrac... 275 1e-72
gi|24640635|ref|NP_572494.1| CG12081-PA [Drosophila melanogaster... 266 5e-70
gi|47086101|ref|NP_998434.1| zgc:85727 [Danio rerio] >gnl|BL_ORD... 204 2e-51
gi|33991339|gb|AAH12987.1| KLHDC3 protein [Homo sapiens] 173 5e-42
gi|34874438|ref|XP_343533.1| similar to kelch domain containing ... 167 4e-40
gi|21757575|dbj|BAC05149.1| unnamed protein product [Homo sapiens] 166 7e-40
gi|27469391|gb|AAH41793.1| KLHDC3 protein [Homo sapiens] >gnl|BL... 122 2e-26
gi|50551299|ref|XP_503123.1| hypothetical protein [Yarrowia lipo... 108 2e-22
gi|19075851|ref|NP_588351.1| cell polarity protein tea1.tip elon... 107 5e-22
gi|32408643|ref|XP_324802.1| hypothetical protein [Neurospora cr... 103 6e-21
gi|15221158|ref|NP_177555.1| kelch repeat-containing protein [Ar... 102 2e-20
gi|24286648|gb|AAN46875.1| nucleotide exchange factor RasGEF F [... 102 2e-20
gi|25518069|pir||G86319 F25I16.5 protein - Arabidopsis thaliana ... 101 2e-20
gi|38100516|gb|EAA47632.1| hypothetical protein MG02875.4 [Magna... 98 2e-19
gi|18146791|dbj|BAB82454.1| D-protein [Hordeum vulgare] 97 4e-19
gi|7489916|pir||S72442 actin-fragmin kinase - slime mold (Physar... 96 9e-19
gi|15221823|ref|NP_173296.1| kelch repeat-containing protein [Ar... 96 2e-18
gi|34905476|ref|NP_914085.1| P0682B08.13 [Oryza sativa (japonica... 94 6e-18
gi|49094480|ref|XP_408701.1| hypothetical protein AN4564.2 [Aspe... 93 1e-17
gi|21950739|gb|AAM78582.1| RanGAP1 interacting protein [Arabidop... 91 3e-17
gi|49073320|ref|XP_400888.1| hypothetical protein UM03273.1 [Ust... 91 3e-17
gi|50728862|ref|XP_416319.1| PREDICTED: similar to host cell fac... 90 9e-17
gi|30686896|ref|NP_197360.2| kelch repeat-containing protein [Ar... 89 1e-16
gi|47226526|emb|CAG08542.1| unnamed protein product [Tetraodon n... 89 1e-16
gi|7019405|ref|NP_037452.1| host cell factor C2; host cell facto... 89 2e-16
gi|50287773|ref|XP_446316.1| unnamed protein product [Candida gl... 89 2e-16
gi|16306876|gb|AAH06558.1| HCFC2 protein [Homo sapiens] 89 2e-16
gi|31209199|ref|XP_313566.1| ENSANGP00000013413 [Anopheles gambi... 89 2e-16
gi|50258620|gb|EAL21307.1| hypothetical protein CNBD3610 [Crypto... 88 3e-16
gi|40714674|gb|AAR88580.1| putative transcription factor [Oryza ... 88 3e-16
gi|47123888|gb|AAH70638.1| MGC81491 protein [Xenopus laevis] 88 3e-16
gi|50289821|ref|XP_447342.1| unnamed protein product [Candida gl... 88 3e-16
gi|46128651|ref|XP_388879.1| hypothetical protein FG08703.1 [Gib... 87 4e-16
gi|40714667|gb|AAR88573.1| putative transcription factor [Oryza ... 87 6e-16
gi|42572263|ref|NP_974227.1| acyl-CoA binding family protein [Ar... 87 6e-16
gi|42563520|ref|NP_187193.3| acyl-CoA binding family protein [Ar... 87 6e-16
gi|47606005|sp|Q7M3S9|RNGB_DICDI Ring finger protein B (Protein ... 87 8e-16
gi|48096631|ref|XP_394735.1| similar to ENSANGP00000013413 [Apis... 84 5e-15
gi|50404934|ref|YP_054026.1| Kelch repeat-containing protein, pu... 84 6e-15
gi|50309287|ref|XP_454650.1| unnamed protein product [Kluyveromy... 84 6e-15
gi|47229997|emb|CAG10411.1| unnamed protein product [Tetraodon n... 82 1e-14
gi|45187724|ref|NP_983947.1| ADL149Wp [Eremothecium gossypii] >g... 82 1e-14
gi|30686755|ref|NP_850263.1| kelch repeat-containing protein [Ar... 82 1e-14
gi|18423130|ref|NP_568723.1| kelch repeat-containing protein [Ar... 81 3e-14
gi|9758913|dbj|BAB09450.1| unnamed protein product [Arabidopsis ... 81 3e-14
gi|6321677|ref|NP_011754.1| Protein that functions in a complex ... 81 3e-14
gi|34865674|ref|XP_234272.2| similar to kelch domain-containing ... 80 5e-14
gi|22832904|gb|AAH34400.1| Leucine-zipper-like transcriptional r... 80 7e-14
gi|47717139|ref|NP_006758.2| leucine-zipper-like transcriptional... 80 7e-14
gi|27229001|ref|NP_080084.2| leucine-zipper-like transcriptional... 80 7e-14
gi|26350531|dbj|BAC38905.1| unnamed protein product [Mus musculus] 80 7e-14
gi|34869814|ref|XP_341018.1| similar to leucine-zipper-like tran... 80 7e-14
gi|7497490|pir||T29816 hypothetical protein C46A5.9 - Caenorhabd... 80 9e-14
gi|6321952|ref|NP_012028.1| Protein required for proper cell fus... 80 9e-14
gi|17539228|ref|NP_501279.1| human HCF1 related (87.4 kD) (hcf-1... 80 9e-14
gi|31559945|ref|NP_663497.2| Rab9 effector p40 [Mus musculus] >g... 79 1e-13
gi|18043893|gb|AAH19800.1| Rab9 effector p40 [Mus musculus] 79 1e-13
gi|30142701|ref|NP_839984.1| kelch domain containing 1 [Mus musc... 79 1e-13
gi|46440743|gb|EAL00046.1| hypothetical protein CaO19.13511 [Can... 79 2e-13
gi|18398038|ref|NP_566316.1| kelch repeat-containing protein [Ar... 79 2e-13
gi|34533828|dbj|BAC86816.1| unnamed protein product [Homo sapiens] 78 3e-13
gi|50405047|ref|YP_054139.1| Kelch-domain protein [Paramecium te... 78 3e-13
gi|17862766|gb|AAL39860.1| LP01394p [Drosophila melanogaster] 77 5e-13
gi|24638987|ref|NP_569869.2| CG3711-PA [Drosophila melanogaster]... 77 5e-13
gi|19262942|emb|CAD24864.1| ND2 protein [Paramecium tetraurelia] 77 5e-13
gi|15724206|gb|AAL06496.1| AT5g04420/T32M21_20 [Arabidopsis thal... 77 8e-13
gi|22327105|ref|NP_198115.2| acyl-CoA binding family protein [Ar... 77 8e-13
gi|34853682|ref|XP_216042.2| similar to RIKEN cDNA 9530020D24 [R... 76 1e-12
gi|1708194|sp|P51611|HFC1_MESAU Host cell factor C1 (HCF) (VP16 ... 75 2e-12
gi|4098678|gb|AAD09225.1| C1 transcription factor [Mus musculus] 75 2e-12
gi|34328130|ref|NP_032250.2| host cell factor C1; VP16-accessory... 75 2e-12
gi|1293686|gb|AAB01163.1| transcription factor C1 (HCF) [Mus mus... 75 2e-12
gi|15292107|gb|AAK93322.1| LD38671p [Drosophila melanogaster] 75 2e-12
gi|40215875|gb|AAR82792.1| LD07466p [Drosophila melanogaster] 75 2e-12
gi|34881756|ref|XP_343844.1| similar to HCF [Rattus norvegicus] 75 2e-12
gi|47211433|emb|CAF93412.1| unnamed protein product [Tetraodon n... 75 2e-12
gi|34862433|ref|XP_235011.2| similar to host cell factor 2 [Ratt... 75 2e-12
gi|39795217|gb|AAH63435.1| Unknown (protein for MGC:70925) [Homo... 75 3e-12
gi|23616996|dbj|BAC20692.1| MET-10+related protein-like [Oryza s... 75 3e-12
gi|28829481|gb|AAL92369.2| similar to Homo sapiens (Human). Test... 75 3e-12
gi|476805|pir||A40718 host cell factor C1 precursor - human >gnl... 75 3e-12
gi|1708193|sp|P51610|HFC1_HUMAN Host cell factor C1 (HCF) (VP16 ... 75 3e-12
gi|38345333|emb|CAE03144.2| OSJNBa0081L15.6 [Oryza sativa (japon... 74 4e-12
gi|50345076|ref|NP_001002209.1| zgc:91813 [Danio rerio] >gnl|BL_... 74 4e-12
gi|50260592|gb|EAL23245.1| hypothetical protein CNBA3610 [Crypto... 74 5e-12
gi|15237715|ref|NP_196062.1| kelch repeat-containing protein [Ar... 74 5e-12
gi|47218255|emb|CAF96292.1| unnamed protein product [Tetraodon n... 74 7e-12
gi|49085698|ref|XP_404950.1| hypothetical protein AN0813.2 [Aspe... 74 7e-12
gi|26341942|dbj|BAC34633.1| unnamed protein product [Mus musculus] 73 9e-12
gi|21312320|ref|NP_081393.1| kelch domain containing 2 [Mus musc... 73 9e-12
gi|26006173|dbj|BAC41429.1| mKIAA0548 protein [Mus musculus] 73 1e-11
gi|25012507|gb|AAN71357.1| RE30283p [Drosophila melanogaster] 73 1e-11
gi|6753146|ref|NP_033860.1| attractin [Mus musculus] >gnl|BL_ORD... 73 1e-11
gi|22328346|ref|NP_567268.2| Met-10+ like family protein / kelch... 73 1e-11
gi|47227326|emb|CAF96875.1| unnamed protein product [Tetraodon n... 73 1e-11
gi|50748920|ref|XP_421458.1| PREDICTED: similar to kelch domain ... 73 1e-11
gi|25407284|pir||H85058 hypothetical protein AT4g04670 [imported... 73 1e-11
gi|34865313|ref|XP_216721.2| similar to RIKEN cDNA 2310022K15 [R... 73 1e-11
gi|24638603|ref|NP_524621.2| CG1710-PA [Drosophila melanogaster]... 73 1e-11
gi|13507075|gb|AAK28427.1| host cell factor HCF [Drosophila mela... 73 1e-11
gi|13431313|sp|Q9WU60|ATRN_MOUSE Attractin precursor (Mahogany p... 73 1e-11
gi|31228364|ref|XP_318042.1| ENSANGP00000003420 [Anopheles gambi... 72 1e-11
gi|12653463|gb|AAH00503.1| Rab9 effector p40 [Homo sapiens] 72 1e-11
gi|48145791|emb|CAG33118.1| RAB9P40 [Homo sapiens] 72 1e-11
gi|47219691|emb|CAG12613.1| unnamed protein product [Tetraodon n... 72 1e-11
gi|2217970|emb|CAB09808.1| p40 [Homo sapiens] 72 2e-11
gi|33695109|ref|NP_005824.2| Rab9 effector p40 [Homo sapiens] >g... 72 2e-11
gi|49456657|emb|CAG46649.1| RAB9P40 [Homo sapiens] 72 2e-11
gi|41351310|gb|AAH65725.1| Rab9 effector p40 [Homo sapiens] 72 2e-11
gi|13542753|gb|AAH05581.1| Kelch domain containing 2 [Mus musculus] 72 2e-11
gi|16930101|dbj|BAB72012.1| attractin [Mesocricetus auratus] 72 2e-11
gi|33468619|emb|CAE30414.1| SI:zK13A21.2 (novel protein similar ... 72 2e-11
gi|28422692|gb|AAH47023.1| RAB9P40 protein [Homo sapiens] 72 2e-11
gi|50409688|ref|XP_456898.1| unnamed protein product [Debaryomyc... 72 2e-11
gi|4585307|gb|AAD25372.1| attractin [Mus musculus] 71 3e-11
gi|19115011|ref|NP_594099.1| coiled-coil protein with low simila... 70 6e-11
gi|48146527|emb|CAG33486.1| KLHDC2 [Homo sapiens] 70 6e-11
gi|7657301|ref|NP_055130.1| kelch domain containing 2; host cell... 70 6e-11
gi|50748922|ref|XP_421459.1| PREDICTED: similar to Kelch domain ... 70 7e-11
gi|26190616|ref|NP_751943.1| kelch domain containing 1 [Homo sap... 70 7e-11
gi|28380069|sp|Q8N7A1|KDC1_HUMAN Kelch domain containing protein... 70 7e-11
gi|41053734|ref|NP_956555.1| hypothetical protein MGC55663 [Dani... 70 9e-11
gi|31873204|emb|CAD97574.1| nd2-like protein [Paramecium tetraur... 69 1e-10
gi|50761262|ref|XP_419246.1| PREDICTED: similar to Leucine-zippe... 69 2e-10
gi|39595010|emb|CAE70878.1| Hypothetical protein CBG17668 [Caeno... 68 3e-10
gi|12275312|dbj|BAB21018.1| attractin [Rattus norvegicus] 68 3e-10
gi|13786196|ref|NP_112641.1| attractin [Rattus norvegicus] >gnl|... 68 3e-10
gi|16118838|gb|AAL14622.1| epithiospecifier [Arabidopsis thalian... 68 3e-10
gi|8118082|gb|AAF72881.1| membrane attractin precursor [Homo sap... 68 4e-10
gi|21450861|ref|NP_647537.1| attractin isoform 1; attractin-2; m... 68 4e-10
gi|13160051|emb|CAC32456.1| dJ741H3.1.1 (attractin (with dipepti... 68 4e-10
gi|1665797|dbj|BAA13395.1| KIAA0265 [Homo sapiens] 68 4e-10
gi|13160052|emb|CAC32457.1| dJ741H3.1.2 (attractin (with dipepti... 68 4e-10
gi|44917619|ref|NP_055812.1| KIAA0265 protein [Homo sapiens] >gn... 68 4e-10
gi|27924400|gb|AAH44884.1| KIAA0265 protein [Homo sapiens] 68 4e-10
gi|21450848|ref|NP_036202.2| attractin isoform 3; attractin-2; m... 68 4e-10
gi|18422882|ref|NP_568692.1| kelch repeat-containing protein [Ar... 68 4e-10
gi|21450863|ref|NP_647538.1| attractin isoform 2; attractin-2; m... 68 4e-10
gi|4093196|gb|AAD03057.1| attractin-2 [Homo sapiens] 68 4e-10
gi|8118083|gb|AAF72882.1| secreted attractin precursor [Homo sap... 68 4e-10
gi|38383171|gb|AAH62489.1| LOC394683 protein [Xenopus tropicalis] 67 5e-10
gi|48716283|dbj|BAD22898.1| acyl-CoA binding protein-like [Oryza... 67 5e-10
gi|50753950|ref|XP_414193.1| PREDICTED: similar to MGC53395 prot... 67 5e-10
gi|26333425|dbj|BAC30430.1| unnamed protein product [Mus musculu... 67 5e-10
gi|50510431|dbj|BAD32201.1| mKIAA0265 protein [Mus musculus] 67 5e-10
gi|15225787|ref|NP_180866.1| jacalin lectin family protein [Arab... 67 6e-10
gi|27806737|ref|NP_776420.1| attractin [Bos taurus] >gnl|BL_ORD_... 67 6e-10
gi|26351471|dbj|BAC39372.1| unnamed protein product [Mus musculus] 67 6e-10
gi|28522837|ref|XP_133019.2| RIKEN cDNA 2410127E18 [Mus musculus... 67 6e-10
gi|30695636|ref|NP_175806.3| kelch repeat-containing protein [Ar... 67 8e-10
gi|3676347|gb|AAC61902.1| Attractin; DPPT-L [Homo sapiens] 67 8e-10
gi|25405686|pir||A96581 hypothetical protein F15I1.12 [imported]... 66 1e-09
gi|19682977|gb|AAL92602.1| hypothetical protein [Dictyostelium d... 66 1e-09
gi|47218699|emb|CAG12423.1| unnamed protein product [Tetraodon n... 66 1e-09
gi|39596600|emb|CAE63219.1| Hypothetical protein CBG07577 [Caeno... 66 1e-09
gi|24650662|ref|NP_651571.2| CG5634-PA [Drosophila melanogaster]... 65 2e-09
gi|28071040|emb|CAD61901.1| unnamed protein product [Homo sapiens] 65 2e-09
gi|46229818|gb|EAK90636.1| kelch repeats protein [Cryptosporidiu... 65 2e-09
gi|31212257|ref|XP_315113.1| ENSANGP00000011459 [Anopheles gambi... 65 2e-09
gi|50756055|ref|XP_425257.1| PREDICTED: similar to KIAA0265 prot... 65 2e-09
gi|12846468|dbj|BAB27179.1| unnamed protein product [Mus musculus] 65 2e-09
gi|46798901|emb|CAG27306.1| kelch repeat containing protein [Ory... 64 4e-09
gi|32422751|ref|XP_331819.1| hypothetical protein [Neurospora cr... 64 4e-09
gi|49257422|gb|AAH73038.1| Unknown (protein for MGC:82652) [Xeno... 64 4e-09
gi|47497805|dbj|BAD19903.1| putative D-protein [Oryza sativa (ja... 64 4e-09
gi|46107556|ref|XP_380837.1| hypothetical protein FG00661.1 [Gib... 64 5e-09
gi|18029285|gb|AAL56463.1| similar to host cell factor [Oikopleu... 64 5e-09
gi|34499885|gb|AAQ73528.1| FKF1 [Mesembryanthemum crystallinum] 64 5e-09
gi|50543628|ref|XP_499980.1| hypothetical protein [Yarrowia lipo... 64 5e-09
gi|23509852|ref|NP_702519.1| protein serine/threonine phosphatas... 64 7e-09
gi|50420305|ref|XP_458686.1| unnamed protein product [Debaryomyc... 64 7e-09
gi|26341012|dbj|BAC34168.1| unnamed protein product [Mus musculus] 64 7e-09
gi|47215723|emb|CAG05734.1| unnamed protein product [Tetraodon n... 63 9e-09
gi|26343781|dbj|BAC35547.1| unnamed protein product [Mus musculus] 63 9e-09
gi|31542073|ref|NP_808439.1| expressed sequence AW545966 [Mus mu... 63 9e-09
gi|33872565|gb|AAH09977.2| KIAA0265 protein [Homo sapiens] 63 9e-09
gi|26353934|dbj|BAC40597.1| unnamed protein product [Mus musculus] 63 1e-08
gi|32422745|ref|XP_331816.1| hypothetical protein [Neurospora cr... 63 1e-08
gi|4885403|ref|NP_005325.1| host cell factor C1 (VP16-accessory ... 63 1e-08
gi|47230190|emb|CAG10604.1| unnamed protein product [Tetraodon n... 62 2e-08
gi|50415229|gb|AAH77434.1| Unknown (protein for MGC:82233) [Xeno... 62 2e-08
gi|50510519|dbj|BAD32245.1| mKIAA0534 protein [Mus musculus] 62 2e-08
gi|34499883|gb|AAQ73527.1| ZEITLUPE [Mesembryanthemum crystallinum] 62 2e-08
gi|21553993|gb|AAM63074.1| contains similarity to jasmonate indu... 62 2e-08
gi|7500382|pir||T21694 hypothetical protein F33C8.1 - Caenorhabd... 62 2e-08
gi|8777408|dbj|BAA96998.1| unnamed protein product [Arabidopsis ... 62 2e-08
gi|25152606|ref|NP_510443.2| attractin family member (140.8 kD) ... 62 2e-08
gi|23487680|gb|EAA21123.1| Drosophila melanogaster LP01394p [Pla... 62 2e-08
gi|25004949|emb|CAD56579.1| Hypothetical protein F33C8.1b [Caeno... 62 2e-08
gi|13173410|gb|AAK14396.1| attractin [Caenorhabditis elegans] 62 2e-08
gi|23483052|gb|EAA18849.1| protein serine/threonine phosphatase ... 62 3e-08
gi|38109767|gb|EAA55586.1| hypothetical protein MG01237.4 [Magna... 62 3e-08
gi|34534123|dbj|BAC86914.1| unnamed protein product [Homo sapiens] 62 3e-08
gi|20521073|dbj|BAA25460.2| KIAA0534 protein [Homo sapiens] 62 3e-08
gi|42659385|ref|XP_049349.11| KIAA0534 protein [Homo sapiens] >g... 62 3e-08
gi|23490528|gb|EAA22283.1| hypothetical protein [Plasmodium yoel... 61 3e-08
gi|50749835|ref|XP_421777.1| PREDICTED: similar to attractin-lik... 61 3e-08
gi|47216228|emb|CAG01262.1| unnamed protein product [Tetraodon n... 61 3e-08
gi|38083389|ref|XP_128971.2| similar to Hypothetical protein KIA... 61 4e-08
gi|50510643|dbj|BAD32307.1| mKIAA0795 protein [Mus musculus] 61 4e-08
gi|6651060|gb|AAF22156.1| host cell factor C1 [Mus musculus] 61 4e-08
gi|47218625|emb|CAG04954.1| unnamed protein product [Tetraodon n... 61 4e-08
gi|50510911|dbj|BAD32441.1| mKIAA1384 protein [Mus musculus] 61 4e-08
gi|47219779|emb|CAG03406.1| unnamed protein product [Tetraodon n... 60 6e-08
gi|31201411|ref|XP_309653.1| ENSANGP00000003873 [Anopheles gambi... 60 6e-08
gi|34855091|ref|XP_231567.2| similar to scruin like at the midli... 60 6e-08
gi|34849711|gb|AAH58359.1| Klhdc4 protein [Mus musculus] 60 6e-08
gi|3811109|gb|AAC69437.1| protein serine/threonine phosphatase a... 60 6e-08
gi|21704210|ref|NP_663580.1| kelch domain containing 4; cDNA seq... 60 8e-08
gi|37537238|gb|AAH23738.2| Kelch domain containing 4 [Mus musculus] 60 8e-08
gi|50732169|ref|XP_418512.1| PREDICTED: similar to hypothetical ... 60 8e-08
gi|23508459|ref|NP_701128.1| hypothetical protein [Plasmodium fa... 60 8e-08
gi|34864835|ref|XP_217657.2| similar to bA338L11.1 (novel CUB do... 60 1e-07
gi|22059219|ref|XP_035405.5| KIAA1384 protein [Homo sapiens] 60 1e-07
gi|34851835|ref|XP_226550.2| similar to cDNA sequence BC012312 [... 60 1e-07
gi|14286070|sp|Q9P2G3|KH14_HUMAN Kelch-like protein 14 >gnl|BL_O... 60 1e-07
gi|50737379|ref|XP_419184.1| PREDICTED: similar to Hypothetical ... 60 1e-07
gi|23612620|ref|NP_704181.1| kelch protein, putative [Plasmodium... 60 1e-07
gi|28631397|gb|AAO49695.1| similar to Arabidopsis thaliana (Mous... 60 1e-07
gi|9366610|emb|CAB95372.1| hypothetical protein [Trypanosoma bru... 59 1e-07
gi|10436213|dbj|BAB14756.1| unnamed protein product [Homo sapiens] 59 1e-07
gi|21314675|ref|NP_060036.2| kelch domain containing 4 [Homo sap... 59 1e-07
gi|12654437|gb|AAH01044.1| KLHDC4 protein [Homo sapiens] 59 1e-07
gi|12698095|dbj|BAB21874.1| hypothetical protein [Macaca fascicu... 59 1e-07
gi|33354238|ref|NP_877583.1| cDNA sequence BC027373 [Mus musculu... 59 2e-07
gi|27694842|gb|AAH43978.1| MGC53395 protein [Xenopus laevis] 59 2e-07
gi|50747464|ref|XP_420884.1| PREDICTED: similar to Attractin pre... 59 2e-07
gi|34857554|ref|XP_218809.2| similar to hypothetical protein FLJ... 59 2e-07
gi|6694745|gb|AAF25385.1| myrosinase-binding protein-like protei... 59 2e-07
gi|21592965|gb|AAM64914.1| putative lectin [Arabidopsis thaliana] 59 2e-07
gi|28829099|gb|AAO51661.1| hypothetical protein [Dictyostelium d... 59 2e-07
gi|39586332|emb|CAE66743.1| Hypothetical protein CBG12093 [Caeno... 59 2e-07
gi|30695633|ref|NP_850963.1| kelch repeat-containing protein [Ar... 58 3e-07
gi|15228197|ref|NP_188262.1| jacalin lectin family protein [Arab... 58 3e-07
gi|18401116|ref|NP_566546.1| jacalin lectin family protein [Arab... 58 3e-07
gi|4742003|gb|AAD28800.1| kelch protein [Takifugu rubripes] 58 3e-07
gi|24657743|ref|NP_611647.1| CG6758-PA [Drosophila melanogaster]... 58 4e-07
gi|49088908|ref|XP_406227.1| hypothetical protein AN2090.2 [Aspe... 58 4e-07
gi|11545731|ref|NP_071324.1| gigaxonin [Homo sapiens] >gnl|BL_OR... 57 5e-07
gi|42733925|gb|AAM43738.3| similar to Dictyostelium discoideum (... 57 5e-07
gi|10434165|dbj|BAB14155.1| unnamed protein product [Homo sapiens] 57 6e-07
gi|24582674|ref|NP_609180.2| CG7466-PA [Drosophila melanogaster]... 57 6e-07
gi|21362105|ref|NP_071925.2| hypothetical protein FLJ12587 [Homo... 57 6e-07
gi|30680514|ref|NP_565444.2| F-box family protein / LOV kelch pr... 57 6e-07
gi|13487070|gb|AAK27434.1| Adagio 2 [Arabidopsis thaliana] >gnl|... 57 6e-07
gi|7485778|pir||T01619 hypothetical protein At2g18910 [imported]... 57 6e-07
gi|37522738|ref|NP_926115.1| unknown protein [Gloeobacter violac... 57 6e-07
gi|30680520|ref|NP_849983.1| F-box family protein / LOV kelch pr... 57 6e-07
gi|12857673|dbj|BAB31073.1| unnamed protein product [Mus musculus] 57 8e-07
gi|46444169|gb|EAL03446.1| hypothetical protein CaO19.5009 [Cand... 56 1e-06
gi|29250379|gb|EAA41874.1| GLP_158_57500_62044 [Giardia lamblia ... 56 1e-06
gi|38197234|gb|AAH16388.1| Unknown (protein for IMAGE:3344095) [... 56 1e-06
gi|3882311|dbj|BAA34515.1| KIAA0795 protein [Homo sapiens] 56 1e-06
gi|31874001|emb|CAD97920.1| hypothetical protein [Homo sapiens] 56 1e-06
gi|30179881|sp|O94889|Y795_HUMAN Hypothetical protein KIAA0795 >... 56 1e-06
gi|38086533|ref|XP_194337.2| similar to EGF domain-containing pr... 56 1e-06
gi|48102809|ref|XP_395435.1| similar to kelch-like 10 [Apis mell... 55 2e-06
gi|47218517|emb|CAF98049.1| unnamed protein product [Tetraodon n... 55 2e-06
gi|34855354|ref|XP_341804.1| EGF-like-domain, multiple 4 [Rattus... 55 2e-06
gi|50306275|ref|XP_453109.1| unnamed protein product [Kluyveromy... 55 2e-06
gi|2497944|sp|Q25390|SCRA_LIMPO Alpha-scruin >gnl|BL_ORD_ID|1728... 55 2e-06
gi|21233534|ref|NP_639451.1| ring canal kelch-like protein [Xant... 55 3e-06
gi|18277872|sp|Q39610|DYHA_CHLRE Dynein alpha chain, flagellar o... 55 3e-06
gi|47230620|emb|CAF99813.1| unnamed protein product [Tetraodon n... 55 3e-06
gi|47220370|emb|CAF98469.1| unnamed protein product [Tetraodon n... 55 3e-06
gi|50732135|ref|XP_418495.1| PREDICTED: similar to kelch repeat ... 55 3e-06
gi|21355333|ref|NP_648590.1| CG4069-PA [Drosophila melanogaster]... 55 3e-06
gi|21244953|ref|NP_644535.1| ring canal kelch-like protein [Xant... 55 3e-06
gi|28974476|gb|AAO61640.1| ectoderm neural cortex related-2 [Xen... 54 4e-06
gi|32414181|ref|XP_327570.1| hypothetical protein [Neurospora cr... 54 4e-06
gi|49903391|gb|AAH76781.1| Encr-2 protein [Xenopus laevis] 54 4e-06
gi|23509871|ref|NP_702538.1| hypothetical protein [Plasmodium fa... 54 4e-06
gi|26336895|dbj|BAC32131.1| unnamed protein product [Mus musculus] 54 4e-06
gi|46447825|ref|NP_083712.4| DRE1 protein [Mus musculus] 54 4e-06
gi|40018614|ref|NP_060114.2| DRE1 protein [Homo sapiens] >gnl|BL... 54 4e-06
gi|47221969|emb|CAG08224.1| unnamed protein product [Tetraodon n... 54 4e-06
gi|45185703|ref|NP_983419.1| ACR016Wp [Eremothecium gossypii] >g... 54 4e-06
gi|26381170|dbj|BAB29759.2| unnamed protein product [Mus musculus] 54 4e-06
gi|18204103|gb|AAH21407.1| 4930429H24Rik protein [Mus musculus] 54 4e-06
gi|26333271|dbj|BAC30353.1| unnamed protein product [Mus musculus] 54 4e-06
gi|48958442|gb|AAT47774.1| AT19737p [Drosophila melanogaster] 54 4e-06
gi|38089468|ref|XP_146539.4| similar to gigaxonin [Mus musculus] 54 4e-06
gi|47215463|emb|CAF97024.1| unnamed protein product [Tetraodon n... 54 4e-06
gi|47847426|dbj|BAD21385.1| mFLJ00127 protein [Mus musculus] 54 5e-06
gi|50753918|ref|XP_414178.1| PREDICTED: similar to chromosome 16... 54 5e-06
gi|22122779|ref|NP_666331.1| cDNA sequence BC025816 [Mus musculu... 54 5e-06
gi|18676460|dbj|BAB84882.1| FLJ00127 protein [Homo sapiens] 54 5e-06
gi|50543530|ref|XP_499931.1| hypothetical protein [Yarrowia lipo... 54 5e-06
gi|34851817|ref|XP_226528.2| similar to Ubiquintin c-terminal hy... 54 7e-06
gi|27659404|ref|XP_226517.1| similar to gigaxonin [Rattus norveg... 54 7e-06
gi|23508751|ref|NP_701419.1| hypothetical protein [Plasmodium fa... 54 7e-06
gi|9633641|ref|NP_051873.1| M6 [Myxoma virus] >gnl|BL_ORD_ID|116... 54 7e-06
gi|27881802|gb|AAH43951.1| LOC398449 protein [Xenopus laevis] 53 9e-06
gi|6094684|gb|AAF03529.1| similar to Kelch proteins; similar to ... 53 9e-06
gi|18423971|ref|NP_568855.1| F-box family protein / LOV kelch pr... 53 9e-06
gi|45643138|ref|NP_277030.2| kelch-like 13; BTB and kelch domain... 53 9e-06
gi|47229999|emb|CAG10413.1| unnamed protein product [Tetraodon n... 53 9e-06
gi|40353042|gb|AAH64576.1| KLHL13 protein [Homo sapiens] 53 9e-06
gi|28278904|gb|AAH45427.1| Unknown (protein for MGC:55691) [Dani... 53 9e-06
gi|46107562|ref|XP_380840.1| conserved hypothetical protein [Gib... 53 9e-06
gi|33518618|sp|Q9P2N7|KH13_HUMAN Kelch-like protein 13 (BTB and ... 53 9e-06
gi|33514718|sp|Q80TF4|KH13_MOUSE Kelch-like protein 13 (BTB and ... 53 9e-06
gi|7242973|dbj|BAA92547.1| KIAA1309 protein [Homo sapiens] 53 9e-06
gi|46251288|gb|AAS84610.1| kelch-like protein Klhl [Danio rerio] 53 9e-06
gi|28972714|dbj|BAC65773.1| mKIAA1309 protein [Mus musculus] 53 9e-06
gi|24432026|ref|NP_116164.2| hypothetical protein FLJ14360 [Homo... 53 9e-06
gi|13385674|ref|NP_080443.1| kelch-like 13; BTB and kelch domain... 53 9e-06
gi|17105344|ref|NP_476539.1| sarcomeric muscle protein; kelch re... 53 9e-06
gi|37360340|dbj|BAC98148.1| mKIAA1354 protein [Mus musculus] 53 1e-05
gi|27370322|ref|NP_766459.1| RIKEN cDNA C530050O22 [Mus musculus... 53 1e-05
gi|31324562|ref|NP_852138.1| Dre1 protein [Rattus norvegicus] >g... 53 1e-05
gi|38109731|gb|EAA55555.1| hypothetical protein MG01206.4 [Magna... 53 1e-05
gi|34869494|ref|XP_233157.2| similar to Hypothetical protein KIA... 53 1e-05
gi|45361273|ref|NP_989214.1| hypothetical protein MGC75722 [Xeno... 53 1e-05
gi|23484538|gb|EAA19838.1| CCAAT-box DNA binding protein subunit... 52 2e-05
gi|31223234|ref|XP_317282.1| ENSANGP00000006827 [Anopheles gambi... 52 2e-05
gi|37522944|ref|NP_926321.1| unknown protein [Gloeobacter violac... 52 2e-05
gi|26338093|dbj|BAC32732.1| unnamed protein product [Mus musculus] 52 2e-05
gi|34933010|ref|XP_233297.2| similar to RIKEN cDNA 1200009K10 [R... 52 2e-05
gi|38074800|ref|XP_130293.2| similar to Kelch-related protein 1 ... 52 2e-05
gi|37805430|gb|AAH60277.1| Egfl4 protein [Mus musculus] 52 2e-05
gi|28972411|dbj|BAC65659.1| mKIAA0817 protein [Mus musculus] 52 2e-05
gi|22477194|gb|AAH36727.1| Egfl4 protein [Mus musculus] 52 2e-05
gi|31542246|ref|NP_079007.2| chromosome 16 open reading frame 44... 52 2e-05
gi|50417474|gb|AAH77340.1| Unknown (protein for MGC:80367) [Xeno... 52 2e-05
gi|46111973|ref|XP_383043.1| hypothetical protein FG02867.1 [Gib... 52 2e-05
gi|3047308|gb|AAC13686.1| sarcosin [Homo sapiens] 52 2e-05
gi|46395659|sp|P60882|EFL4_MOUSE Multiple EGF-like-domain protein 4 52 2e-05
gi|47938053|gb|AAH71523.1| Unknown (protein for MGC:55359) [Dani... 52 2e-05
gi|42741669|ref|NP_006054.2| kelch repeat and BTB (POZ) domain c... 52 2e-05
gi|34878263|ref|XP_344652.1| similar to Hypothetical protein KIA... 52 2e-05
gi|41054165|ref|NP_956124.1| Unknown (protein for MGC:55359); wu... 52 2e-05
gi|14532556|gb|AAK64006.1| AT5g57360/MSF19_2 [Arabidopsis thaliana] 52 3e-05
gi|50730174|ref|XP_416797.1| PREDICTED: similar to kelch-like 15... 52 3e-05
gi|47218059|emb|CAG09931.1| unnamed protein product [Tetraodon n... 52 3e-05
gi|15079732|gb|AAH11680.1| KLHDC4 protein [Homo sapiens] 52 3e-05
gi|47213195|emb|CAF95986.1| unnamed protein product [Tetraodon n... 52 3e-05
gi|2497945|sp|Q25386|SCRB_LIMPO Beta-scruin >gnl|BL_ORD_ID|61413... 52 3e-05
gi|17542058|ref|NP_501919.1| defective SPErmatogenesis SPE-26, k... 52 3e-05
gi|42542620|gb|AAH66513.1| Ivns1abpa protein [Danio rerio] 52 3e-05
gi|31239551|ref|XP_320189.1| ENSANGP00000011589 [Anopheles gambi... 51 3e-05
gi|23486190|gb|EAA20743.1| ERYTHROCYTE MEMBRANE PROTEIN PFEMP3 [... 51 3e-05
gi|33504511|ref|NP_878284.1| kelch-like ECH-associated protein 1... 51 3e-05
gi|47124791|gb|AAH70780.1| MGC83819 protein [Xenopus laevis] 51 3e-05
gi|50802914|ref|XP_428639.1| PREDICTED: similar to gigaxonin, pa... 51 3e-05
gi|47218065|emb|CAG09937.1| unnamed protein product [Tetraodon n... 51 3e-05
gi|23485023|gb|EAA20158.1| asparagine-rich protein [Plasmodium y... 51 3e-05
gi|50795479|ref|XP_428110.1| PREDICTED: similar to gigaxonin, pa... 51 3e-05
gi|10434090|dbj|BAB14124.1| unnamed protein product [Homo sapiens] 51 3e-05
gi|31874544|emb|CAD98027.1| hypothetical protein [Homo sapiens] 51 5e-05
gi|47202026|emb|CAF89400.1| unnamed protein product [Tetraodon n... 51 5e-05
gi|47222184|emb|CAG11610.1| unnamed protein product [Tetraodon n... 51 5e-05
gi|12844321|dbj|BAB26321.1| unnamed protein product [Mus musculus] 51 5e-05
gi|13432001|sp|Q9P2J3|YD54_HUMAN Hypothetical protein KIAA1354 >... 51 5e-05
gi|34872246|ref|XP_342964.1| similar to CG6758-PA [Rattus norveg... 51 5e-05
gi|40254217|ref|NP_766106.2| RIKEN cDNA 6720460I06 [Mus musculus... 51 5e-05
gi|26324812|dbj|BAC26160.1| unnamed protein product [Mus musculus] 51 5e-05
gi|24308181|ref|NP_061335.1| kelch-like 9 [Homo sapiens] >gnl|BL... 51 5e-05
gi|6324992|ref|NP_015060.1| Kelch-repeat protein, similar to Kel... 51 5e-05
gi|34869804|ref|XP_221268.2| similar to hypothetical protein FLJ... 51 5e-05
gi|10435614|dbj|BAB14623.1| unnamed protein product [Homo sapiens] 51 5e-05
gi|25408466|pir||G84779 hypothetical protein At2g36360 [imported... 51 5e-05
gi|13278259|gb|AAH03960.1| 6720460I06Rik protein [Mus musculus] 51 5e-05
gi|38079054|ref|XP_144142.3| similar to Hypothetical protein KIA... 50 6e-05
gi|34854774|ref|XP_230006.2| similar to RIKEN cDNA 4930429H24 [R... 50 6e-05
gi|50745724|ref|XP_420214.1| PREDICTED: similar to Hypothetical ... 50 6e-05
gi|42655624|ref|XP_375685.1| KIAA0469 gene product [Homo sapiens] 50 6e-05
gi|49117534|gb|AAH72626.1| Hypothetical protein C130068N17 [Mus ... 50 6e-05
gi|10439155|dbj|BAB15447.1| unnamed protein product [Homo sapiens] 50 6e-05
gi|27692548|gb|AAH34039.2| Similar to KIAA0469 gene product [Hom... 50 6e-05
gi|14286022|sp|Q9UJP4|Y469_HUMAN Hypothetical protein KIAA0469 50 6e-05
gi|4826435|emb|CAB42892.1| dJ126A5.4 (KIAA0469) [Homo sapiens] 50 6e-05
gi|40788269|dbj|BAA32314.2| KIAA0469 protein [Homo sapiens] 50 6e-05
gi|21748632|dbj|BAC03453.1| FLJ00393 protein [Homo sapiens] 50 6e-05
gi|2135585|pir||I54388 LZTR-1 - human >gnl|BL_ORD_ID|1042148 gi|... 50 6e-05
gi|28193646|gb|AAO27296.1| F-box protein ZEITLUPE [Brassica rapa... 50 6e-05
gi|47228060|emb|CAF97689.1| unnamed protein product [Tetraodon n... 50 8e-05
gi|9633816|ref|NP_051893.1| gp006L [Rabbit fibroma virus] >gnl|B... 50 8e-05
gi|17450863|ref|XP_048774.2| KIAA1332 protein [Homo sapiens] >gn... 50 8e-05
gi|27696695|gb|AAH43410.1| FBXO42 protein [Homo sapiens] 50 8e-05
gi|11056006|ref|NP_067646.1| kelch-like 12; kelch-like protein C... 50 8e-05
gi|47228383|emb|CAG05203.1| unnamed protein product [Tetraodon n... 50 8e-05
gi|18401112|ref|NP_566545.1| jacalin lectin family protein [Arab... 50 8e-05
gi|7243045|dbj|BAA92570.1| KIAA1332 protein [Homo sapiens] 50 8e-05
gi|50744860|ref|XP_419909.1| PREDICTED: similar to bA345L23.2 (n... 50 8e-05
gi|32422351|ref|XP_331619.1| hypothetical protein [Neurospora cr... 50 8e-05
gi|49898870|gb|AAH76641.1| Unknown (protein for MGC:78797) [Xeno... 50 8e-05
gi|47229660|emb|CAG06856.1| unnamed protein product [Tetraodon n... 50 8e-05
gi|12085123|ref|NP_073525.1| 140R protein [Yaba-like disease vir... 50 8e-05
gi|47212476|emb|CAF90272.1| unnamed protein product [Tetraodon n... 50 1e-04
gi|47215462|emb|CAF97023.1| unnamed protein product [Tetraodon n... 50 1e-04
gi|31873861|emb|CAD97868.1| hypothetical protein [Homo sapiens] 50 1e-04
gi|24308490|ref|NP_714952.1| kelch-like protein C3IP1 [Rattus no... 50 1e-04
gi|26329751|dbj|BAC28614.1| unnamed protein product [Mus musculus] 50 1e-04
gi|47224752|emb|CAG00346.1| unnamed protein product [Tetraodon n... 50 1e-04
gi|23508517|ref|NP_701186.1| hypothetical protein [Plasmodium fa... 50 1e-04
gi|20891929|ref|XP_148134.1| similar to RIKEN cDNA 1200009K10 [M... 50 1e-04
gi|31981790|ref|NP_663454.2| kelch-like [Mus musculus] >gnl|BL_O... 50 1e-04
gi|42656818|ref|XP_093813.6| similar to hypothetical protein [Ho... 50 1e-04
gi|47086563|ref|NP_997904.1| zgc:64224; wu:fj14e08 [Danio rerio]... 49 1e-04
gi|22973790|ref|ZP_00020285.1| hypothetical protein [Chloroflexu... 49 1e-04
gi|34880473|ref|XP_213898.2| similar to kelch family protein Nd1... 49 1e-04
gi|19263330|ref|NP_473443.1| influenza virus NS1A binding protei... 49 1e-04
gi|37360122|dbj|BAC98039.1| mKIAA0850 protein [Mus musculus] 49 1e-04
gi|50759321|ref|XP_417619.1| PREDICTED: similar to KIAA1332 prot... 49 1e-04
gi|50761272|ref|XP_419251.1| PREDICTED: similar to kelch-like 12... 49 1e-04
gi|23508458|ref|NP_701127.1| hypothetical protein [Plasmodium fa... 49 1e-04
gi|50756599|ref|XP_415234.1| PREDICTED: similar to hypothetical ... 49 1e-04
gi|39752649|ref|NP_945330.1| kelch repeat and BTB (POZ) domain c... 49 2e-04
gi|40255071|ref|NP_653312.2| hypothetical protein MGC22679 [Homo... 49 2e-04
gi|21754328|dbj|BAC04490.1| unnamed protein product [Homo sapiens] 49 2e-04
gi|50750473|ref|XP_422010.1| PREDICTED: similar to Kelch repeat ... 49 2e-04
gi|39593470|emb|CAE61762.1| Hypothetical protein CBG05722 [Caeno... 49 2e-04
gi|49176487|ref|NP_418730.3| orf, hypothetical protein; putative... 49 2e-04
gi|34872643|ref|XP_233701.2| similar to Hypothetical protein KIA... 49 2e-04
gi|41393123|ref|NP_958891.1| influenza virus NS1A binding protei... 49 2e-04
gi|7404491|sp|P39371|YJHT_ECOLI Hypothetical protein yjhT precursor 49 2e-04
gi|29725835|gb|AAO89208.1| hypothetical protein [Arabidopsis tha... 49 2e-04
gi|15227579|ref|NP_180520.1| kelch repeat-containing F-box famil... 49 2e-04
gi|19113131|ref|NP_596339.1| ral2 protein. [Schizosaccharomyces ... 49 2e-04
gi|21356823|ref|NP_650143.1| CG3571-PA [Drosophila melanogaster]... 48 3e-04
gi|47227237|emb|CAG00599.1| unnamed protein product [Tetraodon n... 48 3e-04
gi|24646172|ref|NP_731664.1| CG3571-PB [Drosophila melanogaster]... 48 3e-04
gi|38175442|dbj|BAD01248.1| putative F-box protein [Oryza sativa... 48 3e-04
gi|50417362|gb|AAH77093.1| Unknown (protein for MGC:101051) [Dan... 48 3e-04
gi|47228899|emb|CAG09414.1| unnamed protein product [Tetraodon n... 48 3e-04
gi|4186093|emb|CAA09975.1| M-T6 protein [Myxoma virus] 48 3e-04
gi|50806637|ref|XP_424470.1| PREDICTED: similar to mKIAA0850 pro... 48 3e-04
gi|28974466|gb|AAO61639.1| ectoderm neural cortex related-1 [Xen... 48 4e-04
gi|33285928|gb|AAQ01580.1| putative epithiospecifier protein [Br... 48 4e-04
gi|28422515|gb|AAH46953.1| MGC53471 protein [Xenopus laevis] 48 4e-04
gi|15804885|ref|NP_290926.1| orf, hypothetical protein [Escheric... 48 4e-04
gi|40788285|dbj|BAA25473.2| KIAA0547 protein [Homo sapiens] 48 4e-04
gi|8489835|gb|AAF75774.1| p21WAF1/CIP1 promoter-interacting prot... 48 4e-04
gi|25188199|ref|NP_055608.2| leucine carboxyl methyltransferase ... 48 4e-04
gi|47210055|emb|CAF92571.1| unnamed protein product [Tetraodon n... 48 4e-04
gi|47219897|emb|CAF97167.1| unnamed protein product [Tetraodon n... 48 4e-04
gi|22972131|ref|ZP_00019029.1| hypothetical protein [Chloroflexu... 47 5e-04
gi|26251196|ref|NP_757236.1| Hypothetical protein yjhT precursor... 47 5e-04
gi|34866376|ref|XP_236647.2| similar to hypothetical protein [Ra... 47 5e-04
gi|50760301|ref|XP_417963.1| PREDICTED: similar to RIKEN cDNA A6... 47 5e-04
gi|28812092|dbj|BAC65044.1| Kelch-like protein [Oryza sativa (ja... 47 5e-04
gi|11190493|emb|CAC16284.1| bA345L23.2 (novel protein with BTB/P... 47 5e-04
gi|30065435|ref|NP_839606.1| hypothetical protein S4469 [Shigell... 47 7e-04
gi|12697899|dbj|BAB21768.1| KIAA1677 protein [Homo sapiens] 47 7e-04
gi|16552933|dbj|BAB71415.1| unnamed protein product [Homo sapiens] 47 7e-04
gi|20551420|ref|XP_040383.3| KIAA1677 [Homo sapiens] 47 7e-04
gi|24115415|ref|NP_709925.1| orf, conserved hypothetical protein... 47 7e-04
gi|18640222|ref|NP_570296.1| SPV136 kelch-like protein [Swinepox... 47 7e-04
gi|18640409|ref|NP_570565.1| truncated kelch-like protein; CMLV1... 47 9e-04
gi|46125433|ref|XP_387270.1| hypothetical protein FG07094.1 [Gib... 47 9e-04
gi|21593470|gb|AAM65437.1| F-box protein ZEITLUPE/FKF/LKP/ADAGIO... 47 9e-04
gi|13278615|gb|AAH04092.1| Ivns1abp protein [Mus musculus] 47 9e-04
gi|23508022|ref|NP_700692.1| hypothetical protein [Plasmodium fa... 47 9e-04
gi|19718149|gb|AAG37674.1| CMP172R [Camelpox virus CMS] 47 9e-04
gi|27370426|ref|NP_766513.1| hypothetical protein D930047P17 [Mu... 47 9e-04
gi|27720833|ref|XP_236428.1| similar to hypothetical protein D93... 47 9e-04
gi|47230297|emb|CAG10711.1| unnamed protein product [Tetraodon n... 47 9e-04
gi|32489068|emb|CAE03998.1| OSJNBb0089B03.12 [Oryza sativa (japo... 46 0.001
gi|47605851|sp|Q80T74|KBT9_MOUSE Kelch repeat and BTB domain con... 46 0.001
gi|47605917|sp|Q96CT2|KBT9_HUMAN Kelch repeat and BTB domain con... 46 0.001
gi|47218494|emb|CAF97228.1| unnamed protein product [Tetraodon n... 46 0.001
gi|15559254|gb|AAH13982.1| KBTBD9 protein [Homo sapiens] 46 0.001
gi|15620901|dbj|BAB67814.1| KIAA1921 protein [Homo sapiens] 46 0.001
gi|47224072|emb|CAG12901.1| unnamed protein product [Tetraodon n... 46 0.001
gi|47217600|emb|CAG02527.1| unnamed protein product [Tetraodon n... 46 0.001
gi|48769980|ref|ZP_00274324.1| COG0249: Mismatch repair ATPase (... 46 0.001
gi|28972876|dbj|BAC65854.1| mKIAA1921 protein [Mus musculus] 46 0.001
gi|50746178|ref|XP_420390.1| PREDICTED: similar to Kelch-like 2,... 46 0.001
gi|38049280|ref|XP_126847.4| similar to mKIAA1921 protein [Mus m... 46 0.001
gi|50731407|ref|XP_417262.1| PREDICTED: similar to DRE1 protein ... 46 0.001
gi|26336801|dbj|BAC32083.1| unnamed protein product [Mus musculus] 46 0.001
gi|45593142|ref|NP_689606.2| kelch repeat and BTB (POZ) domain c... 46 0.001
gi|49118333|gb|AAH73337.1| Unknown (protein for MGC:80749) [Xeno... 46 0.001
gi|44680141|ref|NP_060128.2| BTB (POZ) domain containing 5 [Homo... 46 0.001
gi|34865635|ref|XP_234235.2| similar to RIKEN cDNA 4122402F11 [R... 46 0.001
gi|49087888|ref|XP_405829.1| hypothetical protein AN1692.2 [Aspe... 46 0.001
gi|13544089|gb|AAH06174.1| FBXO42 protein [Homo sapiens] 46 0.001
gi|48859003|ref|ZP_00312945.1| COG3209: Rhs family protein [Clos... 46 0.001
gi|21739921|emb|CAD38983.1| hypothetical protein [Homo sapiens] 46 0.001
gi|32411011|ref|XP_325986.1| predicted protein [Neurospora crass... 46 0.001
gi|24214459|ref|NP_711940.1| putative outermembrane protein [Lep... 45 0.002
gi|26249469|ref|NP_755509.1| Hypothetical protein yjhT precursor... 45 0.002
gi|50748976|ref|XP_421484.1| PREDICTED: similar to BTB (POZ) dom... 45 0.002
gi|19073986|ref|NP_584592.1| similarity to HYPOTHETICAL PROTEIN ... 45 0.002
gi|31198355|ref|XP_308125.1| ENSANGP00000017144 [Anopheles gambi... 45 0.003
gi|38112059|gb|EAA57533.1| hypothetical protein MG10605.4 [Magna... 45 0.003
gi|34869883|ref|XP_221290.2| similar to Kelch-like protein 6 [Ra... 45 0.003
gi|34863097|ref|XP_233955.2| similar to mKIAA1921 protein [Rattu... 45 0.003
>gi|17561284|ref|NP_506895.1| kelch domain containing 3 (48.2 kD)
(5Q134) [Caenorhabditis elegans]
gi|7504048|pir||T20253 hypothetical protein F53E4.1 -
Caenorhabditis elegans
gi|3875291|emb|CAB04012.1| Hypothetical protein F53E4.1
[Caenorhabditis elegans]
gi|3877454|emb|CAB03122.1| Hypothetical protein F53E4.1
[Caenorhabditis elegans]
Length = 426
Score = 702 bits (1812), Expect = 0.0
Identities = 325/325 (100%), Positives = 325/325 (100%)
Frame = -1
Query: 977 MATWTVHLEGGPRRVNHASIAVGSRIYSFGGYCSGEVTDAKDPLDVHVLNTENYRWIKMN 798
MATWTVHLEGGPRRVNHASIAVGSRIYSFGGYCSGEVTDAKDPLDVHVLNTENYRWIKMN
Sbjct: 1 MATWTVHLEGGPRRVNHASIAVGSRIYSFGGYCSGEVTDAKDPLDVHVLNTENYRWIKMN 60
Query: 797 PGYVYNNRIITKATIESPYSDSDKMFGAVPYQRYGHTVVEYQGKAYVWGGRNDDYGACNL 618
PGYVYNNRIITKATIESPYSDSDKMFGAVPYQRYGHTVVEYQGKAYVWGGRNDDYGACNL
Sbjct: 61 PGYVYNNRIITKATIESPYSDSDKMFGAVPYQRYGHTVVEYQGKAYVWGGRNDDYGACNL 120
Query: 617 LHEYDPEYNVWKKVEIEGFVPPSRDGHTAVVWNNQMFVFGGYEEDAQRFSQETYVFDFAT 438
LHEYDPEYNVWKKVEIEGFVPPSRDGHTAVVWNNQMFVFGGYEEDAQRFSQETYVFDFAT
Sbjct: 121 LHEYDPEYNVWKKVEIEGFVPPSRDGHTAVVWNNQMFVFGGYEEDAQRFSQETYVFDFAT 180
Query: 437 STWREMHTKNDPPRWRDFHTASVIDGMMYIFGGRSDESGQVGDEHLFHTIHDQYDDTLMA 258
STWREMHTKNDPPRWRDFHTASVIDGMMYIFGGRSDESGQVGDEHLFHTIHDQYDDTLMA
Sbjct: 181 STWREMHTKNDPPRWRDFHTASVIDGMMYIFGGRSDESGQVGDEHLFHTIHDQYDDTLMA 240
Query: 257 LNLATGAWTRTKVPENTMKPGGRRSHSTWVYDGKMYMFGGYLGTINVHYNELYCFDPKTS 78
LNLATGAWTRTKVPENTMKPGGRRSHSTWVYDGKMYMFGGYLGTINVHYNELYCFDPKTS
Sbjct: 241 LNLATGAWTRTKVPENTMKPGGRRSHSTWVYDGKMYMFGGYLGTINVHYNELYCFDPKTS 300
Query: 77 MWSVISVRGTYPSARRRHCSVVSNG 3
MWSVISVRGTYPSARRRHCSVVSNG
Sbjct: 301 MWSVISVRGTYPSARRRHCSVVSNG 325
Score = 67.8 bits (164), Expect = 4e-10
Identities = 56/226 (24%), Positives = 91/226 (39%), Gaps = 18/226 (7%)
Frame = -1
Query: 962 VHLEG--GPRRVNHASIAVGSRIYSFGGYCSGEVTDAKDPLDVHVLNTENYRWIKMNPGY 789
V +EG P R H ++ ++++ FGGY E + + +V + W +M+
Sbjct: 134 VEIEGFVPPSRDGHTAVVWNNQMFVFGGY---EEDAQRFSQETYVFDFATSTWREMH--- 187
Query: 788 VYNNRIITKATIESPYSDSDKMFGAVPYQRYGHTVVEYQGKAYVWGGRNDDYGAC---NL 618
T P P R HT G Y++GGR+D+ G +L
Sbjct: 188 ----------TKNDP-----------PRWRDFHTASVIDGMMYIFGGRSDESGQVGDEHL 226
Query: 617 LHEYDPEYN-----------VWKKVEI--EGFVPPSRDGHTAVVWNNQMFVFGGYEEDAQ 477
H +Y+ W + ++ P R H+ V++ +M++FGGY
Sbjct: 227 FHTIHDQYDDTLMALNLATGAWTRTKVPENTMKPGGRRSHSTWVYDGKMYMFGGYLGTIN 286
Query: 476 RFSQETYVFDFATSTWREMHTKNDPPRWRDFHTASVIDGMMYIFGG 339
E Y FD TS W + + P R H + V +G +Y+FGG
Sbjct: 287 VHYNELYCFDPKTSMWSVISVRGTYPSARRRHCSVVSNGKVYLFGG 332