Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= F53E4_1
         (977 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17561284|ref|NP_506895.1| kelch domain containing 3 (48.2 kD)...   702   0.0
gi|39590039|emb|CAE61037.1| Hypothetical protein CBG04780 [Caeno...   531   e-149
gi|47216693|emb|CAG05190.1| unnamed protein product [Tetraodon n...   280   5e-74
gi|17390341|gb|AAH18154.1| Kelch domain containing 3 [Mus muscul...   276   7e-73
gi|13397913|emb|CAC34582.1| hypothetical protein [Mus musculus]       276   7e-73
gi|17017965|ref|NP_082186.1| kelch domain containing 3; testis i...   276   7e-73
gi|14669812|dbj|BAB62016.1| Peas [Mus musculus]                       276   7e-73
gi|14495697|gb|AAH09460.1| KLHDC3 protein [Homo sapiens]              275   1e-72
gi|16945972|ref|NP_476502.1| testis intracellular mediator prote...   275   1e-72
gi|33416798|gb|AAH56132.1| Klhdc3-prov protein [Xenopus laevis]       275   1e-72
gi|31202503|ref|XP_310200.1| ENSANGP00000010968 [Anopheles gambi...   275   1e-72
gi|50738601|ref|XP_419322.1| PREDICTED: similar to testis intrac...   275   1e-72
gi|24640635|ref|NP_572494.1| CG12081-PA [Drosophila melanogaster...   266   5e-70
gi|47086101|ref|NP_998434.1| zgc:85727 [Danio rerio] >gnl|BL_ORD...   204   2e-51
gi|33991339|gb|AAH12987.1| KLHDC3 protein [Homo sapiens]              173   5e-42
gi|34874438|ref|XP_343533.1| similar to kelch domain containing ...   167   4e-40
gi|21757575|dbj|BAC05149.1| unnamed protein product [Homo sapiens]    166   7e-40
gi|27469391|gb|AAH41793.1| KLHDC3 protein [Homo sapiens] >gnl|BL...   122   2e-26
gi|50551299|ref|XP_503123.1| hypothetical protein [Yarrowia lipo...   108   2e-22
gi|19075851|ref|NP_588351.1| cell polarity protein tea1.tip elon...   107   5e-22
gi|32408643|ref|XP_324802.1| hypothetical protein [Neurospora cr...   103   6e-21
gi|15221158|ref|NP_177555.1| kelch repeat-containing protein [Ar...   102   2e-20
gi|24286648|gb|AAN46875.1| nucleotide exchange factor RasGEF F [...   102   2e-20
gi|25518069|pir||G86319 F25I16.5 protein - Arabidopsis thaliana ...   101   2e-20
gi|38100516|gb|EAA47632.1| hypothetical protein MG02875.4 [Magna...    98   2e-19
gi|18146791|dbj|BAB82454.1| D-protein [Hordeum vulgare]                97   4e-19
gi|7489916|pir||S72442 actin-fragmin kinase - slime mold (Physar...    96   9e-19
gi|15221823|ref|NP_173296.1| kelch repeat-containing protein [Ar...    96   2e-18
gi|34905476|ref|NP_914085.1| P0682B08.13 [Oryza sativa (japonica...    94   6e-18
gi|49094480|ref|XP_408701.1| hypothetical protein AN4564.2 [Aspe...    93   1e-17
gi|21950739|gb|AAM78582.1| RanGAP1 interacting protein [Arabidop...    91   3e-17
gi|49073320|ref|XP_400888.1| hypothetical protein UM03273.1 [Ust...    91   3e-17
gi|50728862|ref|XP_416319.1| PREDICTED: similar to host cell fac...    90   9e-17
gi|30686896|ref|NP_197360.2| kelch repeat-containing protein [Ar...    89   1e-16
gi|47226526|emb|CAG08542.1| unnamed protein product [Tetraodon n...    89   1e-16
gi|7019405|ref|NP_037452.1| host cell factor C2; host cell facto...    89   2e-16
gi|50287773|ref|XP_446316.1| unnamed protein product [Candida gl...    89   2e-16
gi|16306876|gb|AAH06558.1| HCFC2 protein [Homo sapiens]                89   2e-16
gi|31209199|ref|XP_313566.1| ENSANGP00000013413 [Anopheles gambi...    89   2e-16
gi|50258620|gb|EAL21307.1| hypothetical protein CNBD3610 [Crypto...    88   3e-16
gi|40714674|gb|AAR88580.1| putative transcription factor [Oryza ...    88   3e-16
gi|47123888|gb|AAH70638.1| MGC81491 protein [Xenopus laevis]           88   3e-16
gi|50289821|ref|XP_447342.1| unnamed protein product [Candida gl...    88   3e-16
gi|46128651|ref|XP_388879.1| hypothetical protein FG08703.1 [Gib...    87   4e-16
gi|40714667|gb|AAR88573.1| putative transcription factor [Oryza ...    87   6e-16
gi|42572263|ref|NP_974227.1| acyl-CoA binding family protein [Ar...    87   6e-16
gi|42563520|ref|NP_187193.3| acyl-CoA binding family protein [Ar...    87   6e-16
gi|47606005|sp|Q7M3S9|RNGB_DICDI Ring finger protein B (Protein ...    87   8e-16
gi|48096631|ref|XP_394735.1| similar to ENSANGP00000013413 [Apis...    84   5e-15
gi|50404934|ref|YP_054026.1| Kelch repeat-containing protein, pu...    84   6e-15
gi|50309287|ref|XP_454650.1| unnamed protein product [Kluyveromy...    84   6e-15
gi|47229997|emb|CAG10411.1| unnamed protein product [Tetraodon n...    82   1e-14
gi|45187724|ref|NP_983947.1| ADL149Wp [Eremothecium gossypii] >g...    82   1e-14
gi|30686755|ref|NP_850263.1| kelch repeat-containing protein [Ar...    82   1e-14
gi|18423130|ref|NP_568723.1| kelch repeat-containing protein [Ar...    81   3e-14
gi|9758913|dbj|BAB09450.1| unnamed protein product [Arabidopsis ...    81   3e-14
gi|6321677|ref|NP_011754.1| Protein that functions in a complex ...    81   3e-14
gi|34865674|ref|XP_234272.2| similar to kelch domain-containing ...    80   5e-14
gi|22832904|gb|AAH34400.1| Leucine-zipper-like transcriptional r...    80   7e-14
gi|47717139|ref|NP_006758.2| leucine-zipper-like transcriptional...    80   7e-14
gi|27229001|ref|NP_080084.2| leucine-zipper-like transcriptional...    80   7e-14
gi|26350531|dbj|BAC38905.1| unnamed protein product [Mus musculus]     80   7e-14
gi|34869814|ref|XP_341018.1| similar to leucine-zipper-like tran...    80   7e-14
gi|7497490|pir||T29816 hypothetical protein C46A5.9 - Caenorhabd...    80   9e-14
gi|6321952|ref|NP_012028.1| Protein required for proper cell fus...    80   9e-14
gi|17539228|ref|NP_501279.1| human HCF1 related (87.4 kD) (hcf-1...    80   9e-14
gi|31559945|ref|NP_663497.2| Rab9 effector p40 [Mus musculus] >g...    79   1e-13
gi|18043893|gb|AAH19800.1| Rab9 effector p40 [Mus musculus]            79   1e-13
gi|30142701|ref|NP_839984.1| kelch domain containing 1 [Mus musc...    79   1e-13
gi|46440743|gb|EAL00046.1| hypothetical protein CaO19.13511 [Can...    79   2e-13
gi|18398038|ref|NP_566316.1| kelch repeat-containing protein [Ar...    79   2e-13
gi|34533828|dbj|BAC86816.1| unnamed protein product [Homo sapiens]     78   3e-13
gi|50405047|ref|YP_054139.1| Kelch-domain protein [Paramecium te...    78   3e-13
gi|17862766|gb|AAL39860.1| LP01394p [Drosophila melanogaster]          77   5e-13
gi|24638987|ref|NP_569869.2| CG3711-PA [Drosophila melanogaster]...    77   5e-13
gi|19262942|emb|CAD24864.1| ND2 protein [Paramecium tetraurelia]       77   5e-13
gi|15724206|gb|AAL06496.1| AT5g04420/T32M21_20 [Arabidopsis thal...    77   8e-13
gi|22327105|ref|NP_198115.2| acyl-CoA binding family protein [Ar...    77   8e-13
gi|34853682|ref|XP_216042.2| similar to RIKEN cDNA 9530020D24 [R...    76   1e-12
gi|1708194|sp|P51611|HFC1_MESAU Host cell factor C1 (HCF) (VP16 ...    75   2e-12
gi|4098678|gb|AAD09225.1| C1 transcription factor [Mus musculus]       75   2e-12
gi|34328130|ref|NP_032250.2| host cell factor C1; VP16-accessory...    75   2e-12
gi|1293686|gb|AAB01163.1| transcription factor C1 (HCF) [Mus mus...    75   2e-12
gi|15292107|gb|AAK93322.1| LD38671p [Drosophila melanogaster]          75   2e-12
gi|40215875|gb|AAR82792.1| LD07466p [Drosophila melanogaster]          75   2e-12
gi|34881756|ref|XP_343844.1| similar to HCF [Rattus norvegicus]        75   2e-12
gi|47211433|emb|CAF93412.1| unnamed protein product [Tetraodon n...    75   2e-12
gi|34862433|ref|XP_235011.2| similar to host cell factor 2 [Ratt...    75   2e-12
gi|39795217|gb|AAH63435.1| Unknown (protein for MGC:70925) [Homo...    75   3e-12
gi|23616996|dbj|BAC20692.1| MET-10+related protein-like [Oryza s...    75   3e-12
gi|28829481|gb|AAL92369.2| similar to Homo sapiens (Human). Test...    75   3e-12
gi|476805|pir||A40718 host cell factor C1 precursor - human >gnl...    75   3e-12
gi|1708193|sp|P51610|HFC1_HUMAN Host cell factor C1 (HCF) (VP16 ...    75   3e-12
gi|38345333|emb|CAE03144.2| OSJNBa0081L15.6 [Oryza sativa (japon...    74   4e-12
gi|50345076|ref|NP_001002209.1| zgc:91813 [Danio rerio] >gnl|BL_...    74   4e-12
gi|50260592|gb|EAL23245.1| hypothetical protein CNBA3610 [Crypto...    74   5e-12
gi|15237715|ref|NP_196062.1| kelch repeat-containing protein [Ar...    74   5e-12
gi|47218255|emb|CAF96292.1| unnamed protein product [Tetraodon n...    74   7e-12
gi|49085698|ref|XP_404950.1| hypothetical protein AN0813.2 [Aspe...    74   7e-12
gi|26341942|dbj|BAC34633.1| unnamed protein product [Mus musculus]     73   9e-12
gi|21312320|ref|NP_081393.1| kelch domain containing 2 [Mus musc...    73   9e-12
gi|26006173|dbj|BAC41429.1| mKIAA0548 protein [Mus musculus]           73   1e-11
gi|25012507|gb|AAN71357.1| RE30283p [Drosophila melanogaster]          73   1e-11
gi|6753146|ref|NP_033860.1| attractin [Mus musculus] >gnl|BL_ORD...    73   1e-11
gi|22328346|ref|NP_567268.2| Met-10+ like family protein / kelch...    73   1e-11
gi|47227326|emb|CAF96875.1| unnamed protein product [Tetraodon n...    73   1e-11
gi|50748920|ref|XP_421458.1| PREDICTED: similar to kelch domain ...    73   1e-11
gi|25407284|pir||H85058 hypothetical protein AT4g04670 [imported...    73   1e-11
gi|34865313|ref|XP_216721.2| similar to RIKEN cDNA 2310022K15 [R...    73   1e-11
gi|24638603|ref|NP_524621.2| CG1710-PA [Drosophila melanogaster]...    73   1e-11
gi|13507075|gb|AAK28427.1| host cell factor HCF [Drosophila mela...    73   1e-11
gi|13431313|sp|Q9WU60|ATRN_MOUSE Attractin precursor (Mahogany p...    73   1e-11
gi|31228364|ref|XP_318042.1| ENSANGP00000003420 [Anopheles gambi...    72   1e-11
gi|12653463|gb|AAH00503.1| Rab9 effector p40 [Homo sapiens]            72   1e-11
gi|48145791|emb|CAG33118.1| RAB9P40 [Homo sapiens]                     72   1e-11
gi|47219691|emb|CAG12613.1| unnamed protein product [Tetraodon n...    72   1e-11
gi|2217970|emb|CAB09808.1| p40 [Homo sapiens]                          72   2e-11
gi|33695109|ref|NP_005824.2| Rab9 effector p40 [Homo sapiens] >g...    72   2e-11
gi|49456657|emb|CAG46649.1| RAB9P40 [Homo sapiens]                     72   2e-11
gi|41351310|gb|AAH65725.1| Rab9 effector p40 [Homo sapiens]            72   2e-11
gi|13542753|gb|AAH05581.1| Kelch domain containing 2 [Mus musculus]    72   2e-11
gi|16930101|dbj|BAB72012.1| attractin [Mesocricetus auratus]           72   2e-11
gi|33468619|emb|CAE30414.1| SI:zK13A21.2 (novel protein similar ...    72   2e-11
gi|28422692|gb|AAH47023.1| RAB9P40 protein [Homo sapiens]              72   2e-11
gi|50409688|ref|XP_456898.1| unnamed protein product [Debaryomyc...    72   2e-11
gi|4585307|gb|AAD25372.1| attractin [Mus musculus]                     71   3e-11
gi|19115011|ref|NP_594099.1| coiled-coil protein with low simila...    70   6e-11
gi|48146527|emb|CAG33486.1| KLHDC2 [Homo sapiens]                      70   6e-11
gi|7657301|ref|NP_055130.1| kelch domain containing 2; host cell...    70   6e-11
gi|50748922|ref|XP_421459.1| PREDICTED: similar to Kelch domain ...    70   7e-11
gi|26190616|ref|NP_751943.1| kelch domain containing 1 [Homo sap...    70   7e-11
gi|28380069|sp|Q8N7A1|KDC1_HUMAN Kelch domain containing protein...    70   7e-11
gi|41053734|ref|NP_956555.1| hypothetical protein MGC55663 [Dani...    70   9e-11
gi|31873204|emb|CAD97574.1| nd2-like protein [Paramecium tetraur...    69   1e-10
gi|50761262|ref|XP_419246.1| PREDICTED: similar to Leucine-zippe...    69   2e-10
gi|39595010|emb|CAE70878.1| Hypothetical protein CBG17668 [Caeno...    68   3e-10
gi|12275312|dbj|BAB21018.1| attractin [Rattus norvegicus]              68   3e-10
gi|13786196|ref|NP_112641.1| attractin [Rattus norvegicus] >gnl|...    68   3e-10
gi|16118838|gb|AAL14622.1| epithiospecifier [Arabidopsis thalian...    68   3e-10
gi|8118082|gb|AAF72881.1| membrane attractin precursor [Homo sap...    68   4e-10
gi|21450861|ref|NP_647537.1| attractin isoform 1; attractin-2; m...    68   4e-10
gi|13160051|emb|CAC32456.1| dJ741H3.1.1 (attractin (with dipepti...    68   4e-10
gi|1665797|dbj|BAA13395.1| KIAA0265 [Homo sapiens]                     68   4e-10
gi|13160052|emb|CAC32457.1| dJ741H3.1.2 (attractin (with dipepti...    68   4e-10
gi|44917619|ref|NP_055812.1| KIAA0265 protein [Homo sapiens] >gn...    68   4e-10
gi|27924400|gb|AAH44884.1| KIAA0265 protein [Homo sapiens]             68   4e-10
gi|21450848|ref|NP_036202.2| attractin isoform 3; attractin-2; m...    68   4e-10
gi|18422882|ref|NP_568692.1| kelch repeat-containing protein [Ar...    68   4e-10
gi|21450863|ref|NP_647538.1| attractin isoform 2; attractin-2; m...    68   4e-10
gi|4093196|gb|AAD03057.1| attractin-2 [Homo sapiens]                   68   4e-10
gi|8118083|gb|AAF72882.1| secreted attractin precursor [Homo sap...    68   4e-10
gi|38383171|gb|AAH62489.1| LOC394683 protein [Xenopus tropicalis]      67   5e-10
gi|48716283|dbj|BAD22898.1| acyl-CoA binding protein-like [Oryza...    67   5e-10
gi|50753950|ref|XP_414193.1| PREDICTED: similar to MGC53395 prot...    67   5e-10
gi|26333425|dbj|BAC30430.1| unnamed protein product [Mus musculu...    67   5e-10
gi|50510431|dbj|BAD32201.1| mKIAA0265 protein [Mus musculus]           67   5e-10
gi|15225787|ref|NP_180866.1| jacalin lectin family protein [Arab...    67   6e-10
gi|27806737|ref|NP_776420.1| attractin [Bos taurus] >gnl|BL_ORD_...    67   6e-10
gi|26351471|dbj|BAC39372.1| unnamed protein product [Mus musculus]     67   6e-10
gi|28522837|ref|XP_133019.2| RIKEN cDNA 2410127E18 [Mus musculus...    67   6e-10
gi|30695636|ref|NP_175806.3| kelch repeat-containing protein [Ar...    67   8e-10
gi|3676347|gb|AAC61902.1| Attractin; DPPT-L [Homo sapiens]             67   8e-10
gi|25405686|pir||A96581 hypothetical protein F15I1.12 [imported]...    66   1e-09
gi|19682977|gb|AAL92602.1| hypothetical protein [Dictyostelium d...    66   1e-09
gi|47218699|emb|CAG12423.1| unnamed protein product [Tetraodon n...    66   1e-09
gi|39596600|emb|CAE63219.1| Hypothetical protein CBG07577 [Caeno...    66   1e-09
gi|24650662|ref|NP_651571.2| CG5634-PA [Drosophila melanogaster]...    65   2e-09
gi|28071040|emb|CAD61901.1| unnamed protein product [Homo sapiens]     65   2e-09
gi|46229818|gb|EAK90636.1| kelch repeats protein [Cryptosporidiu...    65   2e-09
gi|31212257|ref|XP_315113.1| ENSANGP00000011459 [Anopheles gambi...    65   2e-09
gi|50756055|ref|XP_425257.1| PREDICTED: similar to KIAA0265 prot...    65   2e-09
gi|12846468|dbj|BAB27179.1| unnamed protein product [Mus musculus]     65   2e-09
gi|46798901|emb|CAG27306.1| kelch repeat containing protein [Ory...    64   4e-09
gi|32422751|ref|XP_331819.1| hypothetical protein [Neurospora cr...    64   4e-09
gi|49257422|gb|AAH73038.1| Unknown (protein for MGC:82652) [Xeno...    64   4e-09
gi|47497805|dbj|BAD19903.1| putative D-protein [Oryza sativa (ja...    64   4e-09
gi|46107556|ref|XP_380837.1| hypothetical protein FG00661.1 [Gib...    64   5e-09
gi|18029285|gb|AAL56463.1| similar to host cell factor [Oikopleu...    64   5e-09
gi|34499885|gb|AAQ73528.1| FKF1 [Mesembryanthemum crystallinum]        64   5e-09
gi|50543628|ref|XP_499980.1| hypothetical protein [Yarrowia lipo...    64   5e-09
gi|23509852|ref|NP_702519.1| protein serine/threonine phosphatas...    64   7e-09
gi|50420305|ref|XP_458686.1| unnamed protein product [Debaryomyc...    64   7e-09
gi|26341012|dbj|BAC34168.1| unnamed protein product [Mus musculus]     64   7e-09
gi|47215723|emb|CAG05734.1| unnamed protein product [Tetraodon n...    63   9e-09
gi|26343781|dbj|BAC35547.1| unnamed protein product [Mus musculus]     63   9e-09
gi|31542073|ref|NP_808439.1| expressed sequence AW545966 [Mus mu...    63   9e-09
gi|33872565|gb|AAH09977.2| KIAA0265 protein [Homo sapiens]             63   9e-09
gi|26353934|dbj|BAC40597.1| unnamed protein product [Mus musculus]     63   1e-08
gi|32422745|ref|XP_331816.1| hypothetical protein [Neurospora cr...    63   1e-08
gi|4885403|ref|NP_005325.1| host cell factor C1 (VP16-accessory ...    63   1e-08
gi|47230190|emb|CAG10604.1| unnamed protein product [Tetraodon n...    62   2e-08
gi|50415229|gb|AAH77434.1| Unknown (protein for MGC:82233) [Xeno...    62   2e-08
gi|50510519|dbj|BAD32245.1| mKIAA0534 protein [Mus musculus]           62   2e-08
gi|34499883|gb|AAQ73527.1| ZEITLUPE [Mesembryanthemum crystallinum]    62   2e-08
gi|21553993|gb|AAM63074.1| contains similarity to jasmonate indu...    62   2e-08
gi|7500382|pir||T21694 hypothetical protein F33C8.1 - Caenorhabd...    62   2e-08
gi|8777408|dbj|BAA96998.1| unnamed protein product [Arabidopsis ...    62   2e-08
gi|25152606|ref|NP_510443.2| attractin family member (140.8 kD) ...    62   2e-08
gi|23487680|gb|EAA21123.1| Drosophila melanogaster LP01394p [Pla...    62   2e-08
gi|25004949|emb|CAD56579.1| Hypothetical protein F33C8.1b [Caeno...    62   2e-08
gi|13173410|gb|AAK14396.1| attractin [Caenorhabditis elegans]          62   2e-08
gi|23483052|gb|EAA18849.1| protein serine/threonine phosphatase ...    62   3e-08
gi|38109767|gb|EAA55586.1| hypothetical protein MG01237.4 [Magna...    62   3e-08
gi|34534123|dbj|BAC86914.1| unnamed protein product [Homo sapiens]     62   3e-08
gi|20521073|dbj|BAA25460.2| KIAA0534 protein [Homo sapiens]            62   3e-08
gi|42659385|ref|XP_049349.11| KIAA0534 protein [Homo sapiens] >g...    62   3e-08
gi|23490528|gb|EAA22283.1| hypothetical protein [Plasmodium yoel...    61   3e-08
gi|50749835|ref|XP_421777.1| PREDICTED: similar to attractin-lik...    61   3e-08
gi|47216228|emb|CAG01262.1| unnamed protein product [Tetraodon n...    61   3e-08
gi|38083389|ref|XP_128971.2| similar to Hypothetical protein KIA...    61   4e-08
gi|50510643|dbj|BAD32307.1| mKIAA0795 protein [Mus musculus]           61   4e-08
gi|6651060|gb|AAF22156.1| host cell factor C1 [Mus musculus]           61   4e-08
gi|47218625|emb|CAG04954.1| unnamed protein product [Tetraodon n...    61   4e-08
gi|50510911|dbj|BAD32441.1| mKIAA1384 protein [Mus musculus]           61   4e-08
gi|47219779|emb|CAG03406.1| unnamed protein product [Tetraodon n...    60   6e-08
gi|31201411|ref|XP_309653.1| ENSANGP00000003873 [Anopheles gambi...    60   6e-08
gi|34855091|ref|XP_231567.2| similar to scruin like at the midli...    60   6e-08
gi|34849711|gb|AAH58359.1| Klhdc4 protein [Mus musculus]               60   6e-08
gi|3811109|gb|AAC69437.1| protein serine/threonine phosphatase a...    60   6e-08
gi|21704210|ref|NP_663580.1| kelch domain containing 4; cDNA seq...    60   8e-08
gi|37537238|gb|AAH23738.2| Kelch domain containing 4 [Mus musculus]    60   8e-08
gi|50732169|ref|XP_418512.1| PREDICTED: similar to hypothetical ...    60   8e-08
gi|23508459|ref|NP_701128.1| hypothetical protein [Plasmodium fa...    60   8e-08
gi|34864835|ref|XP_217657.2| similar to bA338L11.1 (novel CUB do...    60   1e-07
gi|22059219|ref|XP_035405.5| KIAA1384 protein [Homo sapiens]           60   1e-07
gi|34851835|ref|XP_226550.2| similar to cDNA sequence BC012312 [...    60   1e-07
gi|14286070|sp|Q9P2G3|KH14_HUMAN Kelch-like protein 14 >gnl|BL_O...    60   1e-07
gi|50737379|ref|XP_419184.1| PREDICTED: similar to Hypothetical ...    60   1e-07
gi|23612620|ref|NP_704181.1| kelch protein, putative [Plasmodium...    60   1e-07
gi|28631397|gb|AAO49695.1| similar to Arabidopsis thaliana (Mous...    60   1e-07
gi|9366610|emb|CAB95372.1| hypothetical protein [Trypanosoma bru...    59   1e-07
gi|10436213|dbj|BAB14756.1| unnamed protein product [Homo sapiens]     59   1e-07
gi|21314675|ref|NP_060036.2| kelch domain containing 4 [Homo sap...    59   1e-07
gi|12654437|gb|AAH01044.1| KLHDC4 protein [Homo sapiens]               59   1e-07
gi|12698095|dbj|BAB21874.1| hypothetical protein [Macaca fascicu...    59   1e-07
gi|33354238|ref|NP_877583.1| cDNA sequence BC027373 [Mus musculu...    59   2e-07
gi|27694842|gb|AAH43978.1| MGC53395 protein [Xenopus laevis]           59   2e-07
gi|50747464|ref|XP_420884.1| PREDICTED: similar to Attractin pre...    59   2e-07
gi|34857554|ref|XP_218809.2| similar to hypothetical protein FLJ...    59   2e-07
gi|6694745|gb|AAF25385.1| myrosinase-binding protein-like protei...    59   2e-07
gi|21592965|gb|AAM64914.1| putative lectin [Arabidopsis thaliana]      59   2e-07
gi|28829099|gb|AAO51661.1| hypothetical protein [Dictyostelium d...    59   2e-07
gi|39586332|emb|CAE66743.1| Hypothetical protein CBG12093 [Caeno...    59   2e-07
gi|30695633|ref|NP_850963.1| kelch repeat-containing protein [Ar...    58   3e-07
gi|15228197|ref|NP_188262.1| jacalin lectin family protein [Arab...    58   3e-07
gi|18401116|ref|NP_566546.1| jacalin lectin family protein [Arab...    58   3e-07
gi|4742003|gb|AAD28800.1| kelch protein [Takifugu rubripes]            58   3e-07
gi|24657743|ref|NP_611647.1| CG6758-PA [Drosophila melanogaster]...    58   4e-07
gi|49088908|ref|XP_406227.1| hypothetical protein AN2090.2 [Aspe...    58   4e-07
gi|11545731|ref|NP_071324.1| gigaxonin [Homo sapiens] >gnl|BL_OR...    57   5e-07
gi|42733925|gb|AAM43738.3| similar to Dictyostelium discoideum (...    57   5e-07
gi|10434165|dbj|BAB14155.1| unnamed protein product [Homo sapiens]     57   6e-07
gi|24582674|ref|NP_609180.2| CG7466-PA [Drosophila melanogaster]...    57   6e-07
gi|21362105|ref|NP_071925.2| hypothetical protein FLJ12587 [Homo...    57   6e-07
gi|30680514|ref|NP_565444.2| F-box family protein / LOV kelch pr...    57   6e-07
gi|13487070|gb|AAK27434.1| Adagio 2 [Arabidopsis thaliana] >gnl|...    57   6e-07
gi|7485778|pir||T01619 hypothetical protein At2g18910 [imported]...    57   6e-07
gi|37522738|ref|NP_926115.1| unknown protein [Gloeobacter violac...    57   6e-07
gi|30680520|ref|NP_849983.1| F-box family protein / LOV kelch pr...    57   6e-07
gi|12857673|dbj|BAB31073.1| unnamed protein product [Mus musculus]     57   8e-07
gi|46444169|gb|EAL03446.1| hypothetical protein CaO19.5009 [Cand...    56   1e-06
gi|29250379|gb|EAA41874.1| GLP_158_57500_62044 [Giardia lamblia ...    56   1e-06
gi|38197234|gb|AAH16388.1| Unknown (protein for IMAGE:3344095) [...    56   1e-06
gi|3882311|dbj|BAA34515.1| KIAA0795 protein [Homo sapiens]             56   1e-06
gi|31874001|emb|CAD97920.1| hypothetical protein [Homo sapiens]        56   1e-06
gi|30179881|sp|O94889|Y795_HUMAN Hypothetical protein KIAA0795 >...    56   1e-06
gi|38086533|ref|XP_194337.2| similar to EGF domain-containing pr...    56   1e-06
gi|48102809|ref|XP_395435.1| similar to kelch-like 10 [Apis mell...    55   2e-06
gi|47218517|emb|CAF98049.1| unnamed protein product [Tetraodon n...    55   2e-06
gi|34855354|ref|XP_341804.1| EGF-like-domain, multiple 4 [Rattus...    55   2e-06
gi|50306275|ref|XP_453109.1| unnamed protein product [Kluyveromy...    55   2e-06
gi|2497944|sp|Q25390|SCRA_LIMPO Alpha-scruin >gnl|BL_ORD_ID|1728...    55   2e-06
gi|21233534|ref|NP_639451.1| ring canal kelch-like protein [Xant...    55   3e-06
gi|18277872|sp|Q39610|DYHA_CHLRE Dynein alpha chain, flagellar o...    55   3e-06
gi|47230620|emb|CAF99813.1| unnamed protein product [Tetraodon n...    55   3e-06
gi|47220370|emb|CAF98469.1| unnamed protein product [Tetraodon n...    55   3e-06
gi|50732135|ref|XP_418495.1| PREDICTED: similar to kelch repeat ...    55   3e-06
gi|21355333|ref|NP_648590.1| CG4069-PA [Drosophila melanogaster]...    55   3e-06
gi|21244953|ref|NP_644535.1| ring canal kelch-like protein [Xant...    55   3e-06
gi|28974476|gb|AAO61640.1| ectoderm neural cortex related-2 [Xen...    54   4e-06
gi|32414181|ref|XP_327570.1| hypothetical protein [Neurospora cr...    54   4e-06
gi|49903391|gb|AAH76781.1| Encr-2 protein [Xenopus laevis]             54   4e-06
gi|23509871|ref|NP_702538.1| hypothetical protein [Plasmodium fa...    54   4e-06
gi|26336895|dbj|BAC32131.1| unnamed protein product [Mus musculus]     54   4e-06
gi|46447825|ref|NP_083712.4| DRE1 protein [Mus musculus]               54   4e-06
gi|40018614|ref|NP_060114.2| DRE1 protein [Homo sapiens] >gnl|BL...    54   4e-06
gi|47221969|emb|CAG08224.1| unnamed protein product [Tetraodon n...    54   4e-06
gi|45185703|ref|NP_983419.1| ACR016Wp [Eremothecium gossypii] >g...    54   4e-06
gi|26381170|dbj|BAB29759.2| unnamed protein product [Mus musculus]     54   4e-06
gi|18204103|gb|AAH21407.1| 4930429H24Rik protein [Mus musculus]        54   4e-06
gi|26333271|dbj|BAC30353.1| unnamed protein product [Mus musculus]     54   4e-06
gi|48958442|gb|AAT47774.1| AT19737p [Drosophila melanogaster]          54   4e-06
gi|38089468|ref|XP_146539.4| similar to gigaxonin [Mus musculus]       54   4e-06
gi|47215463|emb|CAF97024.1| unnamed protein product [Tetraodon n...    54   4e-06
gi|47847426|dbj|BAD21385.1| mFLJ00127 protein [Mus musculus]           54   5e-06
gi|50753918|ref|XP_414178.1| PREDICTED: similar to chromosome 16...    54   5e-06
gi|22122779|ref|NP_666331.1| cDNA sequence BC025816 [Mus musculu...    54   5e-06
gi|18676460|dbj|BAB84882.1| FLJ00127 protein [Homo sapiens]            54   5e-06
gi|50543530|ref|XP_499931.1| hypothetical protein [Yarrowia lipo...    54   5e-06
gi|34851817|ref|XP_226528.2| similar to Ubiquintin c-terminal hy...    54   7e-06
gi|27659404|ref|XP_226517.1| similar to gigaxonin [Rattus norveg...    54   7e-06
gi|23508751|ref|NP_701419.1| hypothetical protein [Plasmodium fa...    54   7e-06
gi|9633641|ref|NP_051873.1| M6 [Myxoma virus] >gnl|BL_ORD_ID|116...    54   7e-06
gi|27881802|gb|AAH43951.1| LOC398449 protein [Xenopus laevis]          53   9e-06
gi|6094684|gb|AAF03529.1| similar to Kelch proteins; similar to ...    53   9e-06
gi|18423971|ref|NP_568855.1| F-box family protein / LOV kelch pr...    53   9e-06
gi|45643138|ref|NP_277030.2| kelch-like 13; BTB and kelch domain...    53   9e-06
gi|47229999|emb|CAG10413.1| unnamed protein product [Tetraodon n...    53   9e-06
gi|40353042|gb|AAH64576.1| KLHL13 protein [Homo sapiens]               53   9e-06
gi|28278904|gb|AAH45427.1| Unknown (protein for MGC:55691) [Dani...    53   9e-06
gi|46107562|ref|XP_380840.1| conserved hypothetical protein [Gib...    53   9e-06
gi|33518618|sp|Q9P2N7|KH13_HUMAN Kelch-like protein 13 (BTB and ...    53   9e-06
gi|33514718|sp|Q80TF4|KH13_MOUSE Kelch-like protein 13 (BTB and ...    53   9e-06
gi|7242973|dbj|BAA92547.1| KIAA1309 protein [Homo sapiens]             53   9e-06
gi|46251288|gb|AAS84610.1| kelch-like protein Klhl [Danio rerio]       53   9e-06
gi|28972714|dbj|BAC65773.1| mKIAA1309 protein [Mus musculus]           53   9e-06
gi|24432026|ref|NP_116164.2| hypothetical protein FLJ14360 [Homo...    53   9e-06
gi|13385674|ref|NP_080443.1| kelch-like 13; BTB and kelch domain...    53   9e-06
gi|17105344|ref|NP_476539.1| sarcomeric muscle protein; kelch re...    53   9e-06
gi|37360340|dbj|BAC98148.1| mKIAA1354 protein [Mus musculus]           53   1e-05
gi|27370322|ref|NP_766459.1| RIKEN cDNA C530050O22 [Mus musculus...    53   1e-05
gi|31324562|ref|NP_852138.1| Dre1 protein [Rattus norvegicus] >g...    53   1e-05
gi|38109731|gb|EAA55555.1| hypothetical protein MG01206.4 [Magna...    53   1e-05
gi|34869494|ref|XP_233157.2| similar to Hypothetical protein KIA...    53   1e-05
gi|45361273|ref|NP_989214.1| hypothetical protein MGC75722 [Xeno...    53   1e-05
gi|23484538|gb|EAA19838.1| CCAAT-box DNA binding protein subunit...    52   2e-05
gi|31223234|ref|XP_317282.1| ENSANGP00000006827 [Anopheles gambi...    52   2e-05
gi|37522944|ref|NP_926321.1| unknown protein [Gloeobacter violac...    52   2e-05
gi|26338093|dbj|BAC32732.1| unnamed protein product [Mus musculus]     52   2e-05
gi|34933010|ref|XP_233297.2| similar to RIKEN cDNA 1200009K10 [R...    52   2e-05
gi|38074800|ref|XP_130293.2| similar to Kelch-related protein 1 ...    52   2e-05
gi|37805430|gb|AAH60277.1| Egfl4 protein [Mus musculus]                52   2e-05
gi|28972411|dbj|BAC65659.1| mKIAA0817 protein [Mus musculus]           52   2e-05
gi|22477194|gb|AAH36727.1| Egfl4 protein [Mus musculus]                52   2e-05
gi|31542246|ref|NP_079007.2| chromosome 16 open reading frame 44...    52   2e-05
gi|50417474|gb|AAH77340.1| Unknown (protein for MGC:80367) [Xeno...    52   2e-05
gi|46111973|ref|XP_383043.1| hypothetical protein FG02867.1 [Gib...    52   2e-05
gi|3047308|gb|AAC13686.1| sarcosin [Homo sapiens]                      52   2e-05
gi|46395659|sp|P60882|EFL4_MOUSE Multiple EGF-like-domain protein 4    52   2e-05
gi|47938053|gb|AAH71523.1| Unknown (protein for MGC:55359) [Dani...    52   2e-05
gi|42741669|ref|NP_006054.2| kelch repeat and BTB (POZ) domain c...    52   2e-05
gi|34878263|ref|XP_344652.1| similar to Hypothetical protein KIA...    52   2e-05
gi|41054165|ref|NP_956124.1| Unknown (protein for MGC:55359); wu...    52   2e-05
gi|14532556|gb|AAK64006.1| AT5g57360/MSF19_2 [Arabidopsis thaliana]    52   3e-05
gi|50730174|ref|XP_416797.1| PREDICTED: similar to kelch-like 15...    52   3e-05
gi|47218059|emb|CAG09931.1| unnamed protein product [Tetraodon n...    52   3e-05
gi|15079732|gb|AAH11680.1| KLHDC4 protein [Homo sapiens]               52   3e-05
gi|47213195|emb|CAF95986.1| unnamed protein product [Tetraodon n...    52   3e-05
gi|2497945|sp|Q25386|SCRB_LIMPO Beta-scruin >gnl|BL_ORD_ID|61413...    52   3e-05
gi|17542058|ref|NP_501919.1| defective SPErmatogenesis SPE-26, k...    52   3e-05
gi|42542620|gb|AAH66513.1| Ivns1abpa protein [Danio rerio]             52   3e-05
gi|31239551|ref|XP_320189.1| ENSANGP00000011589 [Anopheles gambi...    51   3e-05
gi|23486190|gb|EAA20743.1| ERYTHROCYTE MEMBRANE PROTEIN PFEMP3 [...    51   3e-05
gi|33504511|ref|NP_878284.1| kelch-like ECH-associated protein 1...    51   3e-05
gi|47124791|gb|AAH70780.1| MGC83819 protein [Xenopus laevis]           51   3e-05
gi|50802914|ref|XP_428639.1| PREDICTED: similar to gigaxonin, pa...    51   3e-05
gi|47218065|emb|CAG09937.1| unnamed protein product [Tetraodon n...    51   3e-05
gi|23485023|gb|EAA20158.1| asparagine-rich protein [Plasmodium y...    51   3e-05
gi|50795479|ref|XP_428110.1| PREDICTED: similar to gigaxonin, pa...    51   3e-05
gi|10434090|dbj|BAB14124.1| unnamed protein product [Homo sapiens]     51   3e-05
gi|31874544|emb|CAD98027.1| hypothetical protein [Homo sapiens]        51   5e-05
gi|47202026|emb|CAF89400.1| unnamed protein product [Tetraodon n...    51   5e-05
gi|47222184|emb|CAG11610.1| unnamed protein product [Tetraodon n...    51   5e-05
gi|12844321|dbj|BAB26321.1| unnamed protein product [Mus musculus]     51   5e-05
gi|13432001|sp|Q9P2J3|YD54_HUMAN Hypothetical protein KIAA1354 >...    51   5e-05
gi|34872246|ref|XP_342964.1| similar to CG6758-PA [Rattus norveg...    51   5e-05
gi|40254217|ref|NP_766106.2| RIKEN cDNA 6720460I06 [Mus musculus...    51   5e-05
gi|26324812|dbj|BAC26160.1| unnamed protein product [Mus musculus]     51   5e-05
gi|24308181|ref|NP_061335.1| kelch-like 9 [Homo sapiens] >gnl|BL...    51   5e-05
gi|6324992|ref|NP_015060.1| Kelch-repeat protein, similar to Kel...    51   5e-05
gi|34869804|ref|XP_221268.2| similar to hypothetical protein FLJ...    51   5e-05
gi|10435614|dbj|BAB14623.1| unnamed protein product [Homo sapiens]     51   5e-05
gi|25408466|pir||G84779 hypothetical protein At2g36360 [imported...    51   5e-05
gi|13278259|gb|AAH03960.1| 6720460I06Rik protein [Mus musculus]        51   5e-05
gi|38079054|ref|XP_144142.3| similar to Hypothetical protein KIA...    50   6e-05
gi|34854774|ref|XP_230006.2| similar to RIKEN cDNA 4930429H24 [R...    50   6e-05
gi|50745724|ref|XP_420214.1| PREDICTED: similar to Hypothetical ...    50   6e-05
gi|42655624|ref|XP_375685.1| KIAA0469 gene product [Homo sapiens]      50   6e-05
gi|49117534|gb|AAH72626.1| Hypothetical protein C130068N17 [Mus ...    50   6e-05
gi|10439155|dbj|BAB15447.1| unnamed protein product [Homo sapiens]     50   6e-05
gi|27692548|gb|AAH34039.2| Similar to KIAA0469 gene product [Hom...    50   6e-05
gi|14286022|sp|Q9UJP4|Y469_HUMAN Hypothetical protein KIAA0469         50   6e-05
gi|4826435|emb|CAB42892.1| dJ126A5.4 (KIAA0469) [Homo sapiens]         50   6e-05
gi|40788269|dbj|BAA32314.2| KIAA0469 protein [Homo sapiens]            50   6e-05
gi|21748632|dbj|BAC03453.1| FLJ00393 protein [Homo sapiens]            50   6e-05
gi|2135585|pir||I54388 LZTR-1 - human >gnl|BL_ORD_ID|1042148 gi|...    50   6e-05
gi|28193646|gb|AAO27296.1| F-box protein ZEITLUPE [Brassica rapa...    50   6e-05
gi|47228060|emb|CAF97689.1| unnamed protein product [Tetraodon n...    50   8e-05
gi|9633816|ref|NP_051893.1| gp006L [Rabbit fibroma virus] >gnl|B...    50   8e-05
gi|17450863|ref|XP_048774.2| KIAA1332 protein [Homo sapiens] >gn...    50   8e-05
gi|27696695|gb|AAH43410.1| FBXO42 protein [Homo sapiens]               50   8e-05
gi|11056006|ref|NP_067646.1| kelch-like 12; kelch-like protein C...    50   8e-05
gi|47228383|emb|CAG05203.1| unnamed protein product [Tetraodon n...    50   8e-05
gi|18401112|ref|NP_566545.1| jacalin lectin family protein [Arab...    50   8e-05
gi|7243045|dbj|BAA92570.1| KIAA1332 protein [Homo sapiens]             50   8e-05
gi|50744860|ref|XP_419909.1| PREDICTED: similar to bA345L23.2 (n...    50   8e-05
gi|32422351|ref|XP_331619.1| hypothetical protein [Neurospora cr...    50   8e-05
gi|49898870|gb|AAH76641.1| Unknown (protein for MGC:78797) [Xeno...    50   8e-05
gi|47229660|emb|CAG06856.1| unnamed protein product [Tetraodon n...    50   8e-05
gi|12085123|ref|NP_073525.1| 140R protein [Yaba-like disease vir...    50   8e-05
gi|47212476|emb|CAF90272.1| unnamed protein product [Tetraodon n...    50   1e-04
gi|47215462|emb|CAF97023.1| unnamed protein product [Tetraodon n...    50   1e-04
gi|31873861|emb|CAD97868.1| hypothetical protein [Homo sapiens]        50   1e-04
gi|24308490|ref|NP_714952.1| kelch-like protein C3IP1 [Rattus no...    50   1e-04
gi|26329751|dbj|BAC28614.1| unnamed protein product [Mus musculus]     50   1e-04
gi|47224752|emb|CAG00346.1| unnamed protein product [Tetraodon n...    50   1e-04
gi|23508517|ref|NP_701186.1| hypothetical protein [Plasmodium fa...    50   1e-04
gi|20891929|ref|XP_148134.1| similar to RIKEN cDNA 1200009K10 [M...    50   1e-04
gi|31981790|ref|NP_663454.2| kelch-like [Mus musculus] >gnl|BL_O...    50   1e-04
gi|42656818|ref|XP_093813.6| similar to hypothetical protein [Ho...    50   1e-04
gi|47086563|ref|NP_997904.1| zgc:64224; wu:fj14e08 [Danio rerio]...    49   1e-04
gi|22973790|ref|ZP_00020285.1| hypothetical protein [Chloroflexu...    49   1e-04
gi|34880473|ref|XP_213898.2| similar to kelch family protein Nd1...    49   1e-04
gi|19263330|ref|NP_473443.1| influenza virus NS1A binding protei...    49   1e-04
gi|37360122|dbj|BAC98039.1| mKIAA0850 protein [Mus musculus]           49   1e-04
gi|50759321|ref|XP_417619.1| PREDICTED: similar to KIAA1332 prot...    49   1e-04
gi|50761272|ref|XP_419251.1| PREDICTED: similar to kelch-like 12...    49   1e-04
gi|23508458|ref|NP_701127.1| hypothetical protein [Plasmodium fa...    49   1e-04
gi|50756599|ref|XP_415234.1| PREDICTED: similar to hypothetical ...    49   1e-04
gi|39752649|ref|NP_945330.1| kelch repeat and BTB (POZ) domain c...    49   2e-04
gi|40255071|ref|NP_653312.2| hypothetical protein MGC22679 [Homo...    49   2e-04
gi|21754328|dbj|BAC04490.1| unnamed protein product [Homo sapiens]     49   2e-04
gi|50750473|ref|XP_422010.1| PREDICTED: similar to Kelch repeat ...    49   2e-04
gi|39593470|emb|CAE61762.1| Hypothetical protein CBG05722 [Caeno...    49   2e-04
gi|49176487|ref|NP_418730.3| orf, hypothetical protein; putative...    49   2e-04
gi|34872643|ref|XP_233701.2| similar to Hypothetical protein KIA...    49   2e-04
gi|41393123|ref|NP_958891.1| influenza virus NS1A binding protei...    49   2e-04
gi|7404491|sp|P39371|YJHT_ECOLI Hypothetical protein yjhT precursor    49   2e-04
gi|29725835|gb|AAO89208.1| hypothetical protein [Arabidopsis tha...    49   2e-04
gi|15227579|ref|NP_180520.1| kelch repeat-containing F-box famil...    49   2e-04
gi|19113131|ref|NP_596339.1| ral2 protein. [Schizosaccharomyces ...    49   2e-04
gi|21356823|ref|NP_650143.1| CG3571-PA [Drosophila melanogaster]...    48   3e-04
gi|47227237|emb|CAG00599.1| unnamed protein product [Tetraodon n...    48   3e-04
gi|24646172|ref|NP_731664.1| CG3571-PB [Drosophila melanogaster]...    48   3e-04
gi|38175442|dbj|BAD01248.1| putative F-box protein [Oryza sativa...    48   3e-04
gi|50417362|gb|AAH77093.1| Unknown (protein for MGC:101051) [Dan...    48   3e-04
gi|47228899|emb|CAG09414.1| unnamed protein product [Tetraodon n...    48   3e-04
gi|4186093|emb|CAA09975.1| M-T6 protein [Myxoma virus]                 48   3e-04
gi|50806637|ref|XP_424470.1| PREDICTED: similar to mKIAA0850 pro...    48   3e-04
gi|28974466|gb|AAO61639.1| ectoderm neural cortex related-1 [Xen...    48   4e-04
gi|33285928|gb|AAQ01580.1| putative epithiospecifier protein [Br...    48   4e-04
gi|28422515|gb|AAH46953.1| MGC53471 protein [Xenopus laevis]           48   4e-04
gi|15804885|ref|NP_290926.1| orf, hypothetical protein [Escheric...    48   4e-04
gi|40788285|dbj|BAA25473.2| KIAA0547 protein [Homo sapiens]            48   4e-04
gi|8489835|gb|AAF75774.1| p21WAF1/CIP1 promoter-interacting prot...    48   4e-04
gi|25188199|ref|NP_055608.2| leucine carboxyl methyltransferase ...    48   4e-04
gi|47210055|emb|CAF92571.1| unnamed protein product [Tetraodon n...    48   4e-04
gi|47219897|emb|CAF97167.1| unnamed protein product [Tetraodon n...    48   4e-04
gi|22972131|ref|ZP_00019029.1| hypothetical protein [Chloroflexu...    47   5e-04
gi|26251196|ref|NP_757236.1| Hypothetical protein yjhT precursor...    47   5e-04
gi|34866376|ref|XP_236647.2| similar to hypothetical protein [Ra...    47   5e-04
gi|50760301|ref|XP_417963.1| PREDICTED: similar to RIKEN cDNA A6...    47   5e-04
gi|28812092|dbj|BAC65044.1| Kelch-like protein [Oryza sativa (ja...    47   5e-04
gi|11190493|emb|CAC16284.1| bA345L23.2 (novel protein with BTB/P...    47   5e-04
gi|30065435|ref|NP_839606.1| hypothetical protein S4469 [Shigell...    47   7e-04
gi|12697899|dbj|BAB21768.1| KIAA1677 protein [Homo sapiens]            47   7e-04
gi|16552933|dbj|BAB71415.1| unnamed protein product [Homo sapiens]     47   7e-04
gi|20551420|ref|XP_040383.3| KIAA1677 [Homo sapiens]                   47   7e-04
gi|24115415|ref|NP_709925.1| orf, conserved hypothetical protein...    47   7e-04
gi|18640222|ref|NP_570296.1| SPV136 kelch-like protein [Swinepox...    47   7e-04
gi|18640409|ref|NP_570565.1| truncated kelch-like protein; CMLV1...    47   9e-04
gi|46125433|ref|XP_387270.1| hypothetical protein FG07094.1 [Gib...    47   9e-04
gi|21593470|gb|AAM65437.1| F-box protein ZEITLUPE/FKF/LKP/ADAGIO...    47   9e-04
gi|13278615|gb|AAH04092.1| Ivns1abp protein [Mus musculus]             47   9e-04
gi|23508022|ref|NP_700692.1| hypothetical protein [Plasmodium fa...    47   9e-04
gi|19718149|gb|AAG37674.1| CMP172R [Camelpox virus CMS]                47   9e-04
gi|27370426|ref|NP_766513.1| hypothetical protein D930047P17 [Mu...    47   9e-04
gi|27720833|ref|XP_236428.1| similar to hypothetical protein D93...    47   9e-04
gi|47230297|emb|CAG10711.1| unnamed protein product [Tetraodon n...    47   9e-04
gi|32489068|emb|CAE03998.1| OSJNBb0089B03.12 [Oryza sativa (japo...    46   0.001
gi|47605851|sp|Q80T74|KBT9_MOUSE Kelch repeat and BTB domain con...    46   0.001
gi|47605917|sp|Q96CT2|KBT9_HUMAN Kelch repeat and BTB domain con...    46   0.001
gi|47218494|emb|CAF97228.1| unnamed protein product [Tetraodon n...    46   0.001
gi|15559254|gb|AAH13982.1| KBTBD9 protein [Homo sapiens]               46   0.001
gi|15620901|dbj|BAB67814.1| KIAA1921 protein [Homo sapiens]            46   0.001
gi|47224072|emb|CAG12901.1| unnamed protein product [Tetraodon n...    46   0.001
gi|47217600|emb|CAG02527.1| unnamed protein product [Tetraodon n...    46   0.001
gi|48769980|ref|ZP_00274324.1| COG0249: Mismatch repair ATPase (...    46   0.001
gi|28972876|dbj|BAC65854.1| mKIAA1921 protein [Mus musculus]           46   0.001
gi|50746178|ref|XP_420390.1| PREDICTED: similar to Kelch-like 2,...    46   0.001
gi|38049280|ref|XP_126847.4| similar to mKIAA1921 protein [Mus m...    46   0.001
gi|50731407|ref|XP_417262.1| PREDICTED: similar to DRE1 protein ...    46   0.001
gi|26336801|dbj|BAC32083.1| unnamed protein product [Mus musculus]     46   0.001
gi|45593142|ref|NP_689606.2| kelch repeat and BTB (POZ) domain c...    46   0.001
gi|49118333|gb|AAH73337.1| Unknown (protein for MGC:80749) [Xeno...    46   0.001
gi|44680141|ref|NP_060128.2| BTB (POZ) domain containing 5 [Homo...    46   0.001
gi|34865635|ref|XP_234235.2| similar to RIKEN cDNA 4122402F11 [R...    46   0.001
gi|49087888|ref|XP_405829.1| hypothetical protein AN1692.2 [Aspe...    46   0.001
gi|13544089|gb|AAH06174.1| FBXO42 protein [Homo sapiens]               46   0.001
gi|48859003|ref|ZP_00312945.1| COG3209: Rhs family protein [Clos...    46   0.001
gi|21739921|emb|CAD38983.1| hypothetical protein [Homo sapiens]        46   0.001
gi|32411011|ref|XP_325986.1| predicted protein [Neurospora crass...    46   0.001
gi|24214459|ref|NP_711940.1| putative outermembrane protein [Lep...    45   0.002
gi|26249469|ref|NP_755509.1| Hypothetical protein yjhT precursor...    45   0.002
gi|50748976|ref|XP_421484.1| PREDICTED: similar to BTB (POZ) dom...    45   0.002
gi|19073986|ref|NP_584592.1| similarity to HYPOTHETICAL PROTEIN ...    45   0.002
gi|31198355|ref|XP_308125.1| ENSANGP00000017144 [Anopheles gambi...    45   0.003
gi|38112059|gb|EAA57533.1| hypothetical protein MG10605.4 [Magna...    45   0.003
gi|34869883|ref|XP_221290.2| similar to Kelch-like protein 6 [Ra...    45   0.003
gi|34863097|ref|XP_233955.2| similar to mKIAA1921 protein [Rattu...    45   0.003


>gi|17561284|ref|NP_506895.1| kelch domain containing 3 (48.2 kD)
           (5Q134) [Caenorhabditis elegans]
 gi|7504048|pir||T20253 hypothetical protein F53E4.1 -
           Caenorhabditis elegans
 gi|3875291|emb|CAB04012.1| Hypothetical protein F53E4.1
           [Caenorhabditis elegans]
 gi|3877454|emb|CAB03122.1| Hypothetical protein F53E4.1
           [Caenorhabditis elegans]
          Length = 426

 Score =  702 bits (1812), Expect = 0.0
 Identities = 325/325 (100%), Positives = 325/325 (100%)
 Frame = -1

Query: 977 MATWTVHLEGGPRRVNHASIAVGSRIYSFGGYCSGEVTDAKDPLDVHVLNTENYRWIKMN 798
           MATWTVHLEGGPRRVNHASIAVGSRIYSFGGYCSGEVTDAKDPLDVHVLNTENYRWIKMN
Sbjct: 1   MATWTVHLEGGPRRVNHASIAVGSRIYSFGGYCSGEVTDAKDPLDVHVLNTENYRWIKMN 60

Query: 797 PGYVYNNRIITKATIESPYSDSDKMFGAVPYQRYGHTVVEYQGKAYVWGGRNDDYGACNL 618
           PGYVYNNRIITKATIESPYSDSDKMFGAVPYQRYGHTVVEYQGKAYVWGGRNDDYGACNL
Sbjct: 61  PGYVYNNRIITKATIESPYSDSDKMFGAVPYQRYGHTVVEYQGKAYVWGGRNDDYGACNL 120

Query: 617 LHEYDPEYNVWKKVEIEGFVPPSRDGHTAVVWNNQMFVFGGYEEDAQRFSQETYVFDFAT 438
           LHEYDPEYNVWKKVEIEGFVPPSRDGHTAVVWNNQMFVFGGYEEDAQRFSQETYVFDFAT
Sbjct: 121 LHEYDPEYNVWKKVEIEGFVPPSRDGHTAVVWNNQMFVFGGYEEDAQRFSQETYVFDFAT 180

Query: 437 STWREMHTKNDPPRWRDFHTASVIDGMMYIFGGRSDESGQVGDEHLFHTIHDQYDDTLMA 258
           STWREMHTKNDPPRWRDFHTASVIDGMMYIFGGRSDESGQVGDEHLFHTIHDQYDDTLMA
Sbjct: 181 STWREMHTKNDPPRWRDFHTASVIDGMMYIFGGRSDESGQVGDEHLFHTIHDQYDDTLMA 240

Query: 257 LNLATGAWTRTKVPENTMKPGGRRSHSTWVYDGKMYMFGGYLGTINVHYNELYCFDPKTS 78
           LNLATGAWTRTKVPENTMKPGGRRSHSTWVYDGKMYMFGGYLGTINVHYNELYCFDPKTS
Sbjct: 241 LNLATGAWTRTKVPENTMKPGGRRSHSTWVYDGKMYMFGGYLGTINVHYNELYCFDPKTS 300

Query: 77  MWSVISVRGTYPSARRRHCSVVSNG 3
           MWSVISVRGTYPSARRRHCSVVSNG
Sbjct: 301 MWSVISVRGTYPSARRRHCSVVSNG 325



 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 56/226 (24%), Positives = 91/226 (39%), Gaps = 18/226 (7%)
 Frame = -1

Query: 962 VHLEG--GPRRVNHASIAVGSRIYSFGGYCSGEVTDAKDPLDVHVLNTENYRWIKMNPGY 789
           V +EG   P R  H ++   ++++ FGGY   E    +   + +V +     W +M+
Sbjct: 134 VEIEGFVPPSRDGHTAVVWNNQMFVFGGY---EEDAQRFSQETYVFDFATSTWREMH--- 187

Query: 788 VYNNRIITKATIESPYSDSDKMFGAVPYQRYGHTVVEYQGKAYVWGGRNDDYGAC---NL 618
                     T   P           P  R  HT     G  Y++GGR+D+ G     +L
Sbjct: 188 ----------TKNDP-----------PRWRDFHTASVIDGMMYIFGGRSDESGQVGDEHL 226

Query: 617 LHEYDPEYN-----------VWKKVEI--EGFVPPSRDGHTAVVWNNQMFVFGGYEEDAQ 477
            H    +Y+            W + ++      P  R  H+  V++ +M++FGGY
Sbjct: 227 FHTIHDQYDDTLMALNLATGAWTRTKVPENTMKPGGRRSHSTWVYDGKMYMFGGYLGTIN 286

Query: 476 RFSQETYVFDFATSTWREMHTKNDPPRWRDFHTASVIDGMMYIFGG 339
               E Y FD  TS W  +  +   P  R  H + V +G +Y+FGG
Sbjct: 287 VHYNELYCFDPKTSMWSVISVRGTYPSARRRHCSVVSNGKVYLFGG 332




[DB home][top]