Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F54B11_9
(552 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17568117|ref|NP_510277.1| BMP receptor Associated protein (21... 388 e-107
gi|39586064|emb|CAE69140.1| Hypothetical protein CBG15170 [Caeno... 233 2e-60
gi|17553122|ref|NP_497292.1| BMP receptor Associated protein (24... 231 8e-60
gi|39596494|emb|CAE63113.1| Hypothetical protein CBG07410 [Caeno... 220 1e-56
gi|39586063|emb|CAE69139.1| Hypothetical protein CBG15169 [Caeno... 186 2e-46
gi|26324890|dbj|BAC26199.1| unnamed protein product [Mus musculus] 116 3e-25
gi|26346673|dbj|BAC36985.1| unnamed protein product [Mus musculus] 116 3e-25
gi|37590700|gb|AAH58999.1| Zmynd11 protein [Mus musculus] 116 3e-25
gi|42734403|ref|NP_976242.1| BS69 protein alpha isoform [Rattus ... 115 4e-25
gi|21362287|ref|NP_653099.1| zinc finger, MYND domain containing... 115 4e-25
gi|5729746|ref|NP_006615.1| zinc finger, MYND domain containing ... 115 4e-25
gi|42734407|ref|NP_976244.1| BS69 protein delta isoform [Rattus ... 115 4e-25
gi|42734505|ref|NP_976245.1| BS69 protein gamma isoform [Rattus ... 115 4e-25
gi|42734405|ref|NP_976243.1| BS69 protein beta isoform [Rattus n... 115 4e-25
gi|50732273|ref|XP_418557.1| PREDICTED: similar to Zinc finger M... 114 1e-24
gi|47228145|emb|CAF97774.1| unnamed protein product [Tetraodon n... 110 2e-23
gi|48108530|ref|XP_393096.1| similar to Zinc finger MYND domain ... 107 1e-22
gi|31205909|ref|XP_311906.1| ENSANGP00000018207 [Anopheles gambi... 87 3e-16
gi|47229319|emb|CAG04071.1| unnamed protein product [Tetraodon n... 83 3e-15
gi|41054493|ref|NP_955935.1| Unknown (protein for MGC:63775); wu... 82 8e-15
gi|47227298|emb|CAF96847.1| unnamed protein product [Tetraodon n... 81 1e-14
gi|34365373|emb|CAE46008.1| hypothetical protein [Homo sapiens] 81 1e-14
gi|34860715|ref|XP_215942.2| similar to 3632413B07Rik protein [R... 80 2e-14
gi|27697123|gb|AAH41797.1| 3632413B07Rik protein [Mus musculus] 80 2e-14
gi|39104556|dbj|BAC41468.4| mKIAA1125 protein [Mus musculus] 80 2e-14
gi|33695080|ref|NP_081506.2| protein kinase C binding protein 1 ... 80 2e-14
gi|37573982|gb|AAH48186.2| Unknown (protein for MGC:61398) [Mus ... 80 2e-14
gi|49898920|gb|AAH76654.1| Unknown (protein for MGC:79521) [Xeno... 80 3e-14
gi|50758715|ref|XP_417384.1| PREDICTED: similar to KIAA1125 prot... 80 3e-14
gi|34335264|ref|NP_898869.1| protein kinase C binding protein 1 ... 79 4e-14
gi|11385648|gb|AAG34905.1| CTCL tumor antigen se14-3 [Homo sapiens] 79 4e-14
gi|17980969|gb|AAL50790.1| se14-3r protein [Homo sapiens] 79 4e-14
gi|3142288|gb|AAC72244.1| protein kinase C-binding protein RACK7... 79 4e-14
gi|34335266|ref|NP_036540.3| protein kinase C binding protein 1 ... 79 4e-14
gi|6002353|emb|CAB56762.1| dJ890O15.2 (protein kinase C binding ... 79 4e-14
gi|34335262|ref|NP_898868.1| protein kinase C binding protein 1 ... 79 4e-14
gi|25453223|sp|Q9ULU4|PKCB_HUMAN Protein kinase C binding protei... 79 4e-14
gi|7960216|gb|AAF71262.1| RACK-like protein PRKCBP1 [Homo sapiens] 79 4e-14
gi|45946211|gb|AAH30721.2| PRKCBP1 protein [Homo sapiens] 79 4e-14
gi|6329749|dbj|BAA86439.1| KIAA1125 protein [Homo sapiens] 79 4e-14
gi|45552014|ref|NP_733441.2| CG1815-PA [Drosophila melanogaster]... 75 1e-12
gi|24651697|ref|NP_651881.2| CG1815-PC [Drosophila melanogaster]... 75 1e-12
gi|31206241|ref|XP_312072.1| ENSANGP00000016919 [Anopheles gambi... 73 3e-12
gi|29841058|gb|AAP06071.1| similar to GenBank Accession Number A... 65 6e-10
gi|19922106|ref|NP_610795.1| CG8569-PA [Drosophila melanogaster]... 63 4e-09
gi|47078243|ref|NP_997644.1| zinc finger, MYND domain containing... 51 2e-05
gi|21961557|gb|AAH34784.1| Zinc finger, MYND domain containing 1... 51 2e-05
gi|31982595|ref|NP_444483.2| zinc finger, MYND domain-containing... 49 6e-05
gi|25008175|sp|Q99ML0|ZM10_MOUSE Zinc finger MYND domain contain... 49 6e-05
gi|34851856|ref|XP_341710.1| similar to ETO/MTG8-related protein... 45 7e-04
gi|33585598|gb|AAH55951.1| Cbfa2t3h protein [Mus musculus] 45 8e-04
gi|6753302|ref|NP_033954.1| core-binding factor, runt domain, al... 45 8e-04
gi|3273411|gb|AAC24728.1| BLu protein testis isoform [Homo sapiens] 45 8e-04
gi|21739281|emb|CAD38688.1| hypothetical protein [Homo sapiens] 45 8e-04
gi|37594444|ref|NP_056980.2| zinc finger, MYND domain-containing... 45 8e-04
gi|50747654|ref|XP_420948.1| PREDICTED: similar to DEAF-1 relate... 45 8e-04
gi|47229804|emb|CAG07000.1| unnamed protein product [Tetraodon n... 44 0.001
gi|34865903|ref|XP_343477.1| similar to Blu protein [Rattus norv... 44 0.001
gi|45549186|ref|NP_523841.3| CG3385-PA [Drosophila melanogaster]... 44 0.002
gi|790600|gb|AAA92045.1| nervy 44 0.002
gi|8099673|gb|AAF72198.1| MTG8/ETOa [Gallus gallus] 44 0.002
gi|45382051|ref|NP_990075.1| MTG8/ETOb [Gallus gallus] >gnl|BL_O... 44 0.002
gi|47230517|emb|CAF99710.1| unnamed protein product [Tetraodon n... 43 0.003
gi|3273407|gb|AAC24726.1| BLu protein [Homo sapiens] 43 0.003
gi|17737659|ref|NP_524169.1| CG8567-PA [Drosophila melanogaster]... 43 0.004
gi|28626482|gb|AAO49160.1| LD06278p [Drosophila melanogaster] 43 0.004
gi|23612153|ref|NP_703733.1| MYND finger protein, putative [Plas... 42 0.006
gi|50753987|ref|XP_414206.1| PREDICTED: similar to ETO/MTG8-rela... 42 0.006
gi|45501288|gb|AAH67078.1| CBFA2T1 protein [Homo sapiens] 42 0.006
gi|26327957|dbj|BAC27719.1| unnamed protein product [Mus musculus] 42 0.006
gi|6753300|ref|NP_033952.1| CBFA2T1 identified gene homolog [Mus... 42 0.006
gi|4757916|ref|NP_004340.1| acute myelogenous leukemia 1 translo... 42 0.006
gi|32880091|gb|AAP88876.1| core-binding factor, runt domain, alp... 42 0.006
gi|28329419|ref|NP_783553.1| acute myelogenous leukemia 1 transl... 42 0.006
gi|28329416|ref|NP_783552.1| acute myelogenous leukemia 1 transl... 42 0.006
gi|3980111|emb|CAA56311.1| ETO [Homo sapiens] 42 0.006
gi|407727|dbj|BAA03089.1| AML1-MTG8 fusion protein [Homo sapiens] 42 0.006
gi|8170217|gb|AAB34819.2| AMLI-ETO fusion protein [Homo sapiens] 42 0.006
gi|34419242|ref|NP_899255.1| ClpP [Bacteriophage KVP40] >gnl|BL_... 42 0.007
gi|2246694|gb|AAB62704.1| suppressin [Homo sapiens] 42 0.007
gi|38016945|ref|NP_066288.2| suppressin [Homo sapiens] >gnl|BL_O... 42 0.009
gi|22256748|sp|O77562|DEAF_PANTR Deformed epidermal autoregulato... 42 0.009
gi|3293444|gb|AAC25716.1| suppressin [Homo sapiens] 42 0.009
gi|3293450|gb|AAC25719.1| suppressin [Homo sapiens] 42 0.009
gi|3309565|gb|AAC79677.1| nuclear DEAF-1 related transcriptional... 42 0.009
gi|28872805|ref|NP_787127.1| myeloid translocation gene-related ... 41 0.012
gi|20870456|ref|XP_127602.1| zinc finger, MYND domain containing... 41 0.012
gi|28872803|ref|NP_005178.4| myeloid translocation gene-related ... 41 0.012
gi|3256264|dbj|BAA29061.1| MTG8-related protein MTG16a [Homo sap... 41 0.012
gi|38511455|gb|AAH62624.1| CBFA2T3 protein [Homo sapiens] 41 0.012
gi|3293105|dbj|BAA31277.1| MTG16 [Homo sapiens] 41 0.012
gi|3293104|dbj|BAA31276.1| MTG16 [Homo sapiens] 41 0.012
gi|6678922|ref|NP_032646.1| macrophage activation 2; guanylate-b... 40 0.021
gi|47225950|emb|CAG04324.1| unnamed protein product [Tetraodon n... 40 0.021
gi|39597236|emb|CAE59464.1| Hypothetical protein CBG02847 [Caeno... 40 0.021
gi|46110345|ref|XP_382230.1| hypothetical protein FG02054.1 [Gib... 40 0.027
gi|17532903|ref|NP_496482.1| ubiquitin 1 (2L901) [Caenorhabditis... 40 0.036
gi|29570466|gb|AAO91715.1| Hypothetical protein F53H1.4b [Caenor... 40 0.036
gi|29570467|gb|AAO91716.1| Hypothetical protein F53H1.4c [Caenor... 40 0.036
gi|32140151|tpg|DAA01312.1| TPA: SET and MYND domain protein 2 [... 40 0.036
gi|23479124|gb|EAA16038.1| repeat organellar protein-related [Pl... 40 0.036
gi|25395995|pir||G88637 protein F53H1.4 [imported] - Caenorhabdi... 40 0.036
gi|46395487|ref|NP_997062.1| A-kinase anchor protein 9; hyperion... 40 0.036
gi|4092763|gb|AAC99460.1| kinesin related protein 1 [Nectria hae... 40 0.036
gi|25148366|ref|NP_500064.2| zn-finger-like, PHD finger family m... 40 0.036
gi|41055327|ref|NP_956691.1| hypothetical protein MGC63660 [Dani... 40 0.036
gi|47229412|emb|CAF99400.1| unnamed protein product [Tetraodon n... 40 0.036
gi|8393248|ref|NP_058570.1| suppressin [Mus musculus] >gnl|BL_OR... 39 0.047
gi|13929136|ref|NP_113989.1| DEAF-1 related transcriptional regu... 39 0.047
gi|3293442|gb|AAC25715.1| suppressin [Homo sapiens] 39 0.047
gi|285456|pir||A43950 vimentin - common carp >gnl|BL_ORD_ID|1041... 39 0.047
gi|48825577|ref|ZP_00286821.1| COG0419: ATPase involved in DNA r... 39 0.061
gi|25955657|gb|AAH40344.1| CBFA2T2 protein [Homo sapiens] 39 0.061
gi|2970656|gb|AAC64699.1| MTG8 related protein [Homo sapiens] 39 0.061
gi|12857504|dbj|BAB31024.1| unnamed protein product [Mus musculus] 39 0.061
gi|24460121|gb|AAN61565.1| JNK-associated leucine-zipper protein... 39 0.061
gi|28610156|ref|NP_787060.1| myeloid translocation gene-related ... 39 0.061
gi|21692611|emb|CAC08482.2| dJ63M2.1 (continued from dJ1137F22.1... 39 0.061
gi|39644928|gb|AAH16298.2| CBFA2T2 protein [Homo sapiens] 39 0.061
gi|29421278|gb|AAO59301.1| kinesin [Gibberella moniliformis] 39 0.061
gi|4826663|ref|NP_005084.1| myeloid translocation gene-related p... 39 0.061
gi|34873062|ref|XP_340880.1| similar to JNK-associated leucine-z... 39 0.061
gi|34865821|ref|XP_217249.2| similar to hypothetical protein FLJ... 39 0.061
gi|27436920|ref|NP_003962.3| sperm associated antigen 9 isoform ... 39 0.061
gi|31212023|ref|XP_314996.1| ENSANGP00000002367 [Anopheles gambi... 39 0.061
gi|25014086|ref|NP_081845.1| sperm associated antigen 9; JNK-ass... 39 0.061
gi|34851186|ref|XP_346518.1| hypothetical protein XP_346517 [Rat... 39 0.079
gi|23485010|gb|EAA20150.1| hypothetical protein [Plasmodium yoel... 39 0.079
gi|31208385|ref|XP_313159.1| ENSANGP00000013438 [Anopheles gambi... 39 0.079
gi|2981446|gb|AAC64701.1| MTG8-related protein [Homo sapiens] 39 0.079
gi|1389895|gb|AAC35994.1| suppressin [Rattus norvegicus] 39 0.079
gi|31208387|ref|XP_313160.1| ENSANGP00000023099 [Anopheles gambi... 39 0.079
gi|23613557|ref|NP_704578.1| hypothetical protein [Plasmodium fa... 39 0.079
gi|50400728|sp|Q61043|NIN_MOUSE Ninein 38 0.10
gi|39589320|emb|CAE74349.1| Hypothetical protein CBG22067 [Caeno... 38 0.10
gi|13518400|ref|NP_084759.1| Ycf1 protein [Oenothera elata subsp... 38 0.10
gi|37360452|dbj|BAC98204.1| mKIAA1565 protein [Mus musculus] 38 0.10
gi|19075145|ref|NP_586746.1| PROTEIN KINASE C (EPSILON TYPE) [En... 38 0.10
gi|11497403|ref|NP_051509.1| ErpX [Borrelia burgdorferi B31] >gn... 38 0.10
gi|32452111|emb|CAD38129.1| vimentin [Acipenser baerii] 38 0.10
gi|24585777|ref|NP_610136.1| CG15216-PA [Drosophila melanogaster... 38 0.10
gi|47219280|emb|CAG11742.1| unnamed protein product [Tetraodon n... 38 0.10
gi|38094645|ref|XP_135706.2| similar to Meningioma-expressed ant... 38 0.10
gi|27696944|gb|AAH44006.1| MGC53378 protein [Xenopus laevis] 38 0.14
gi|1353210|sp|P48673|VIMB_CARAU Vimentin beta >gnl|BL_ORD_ID|371... 38 0.14
gi|34395720|sp|Q9IAB2|MT8R_XENLA Protein CBFA2T2 (MTG8-like prot... 38 0.14
gi|39597380|emb|CAE59608.1| Hypothetical protein CBG03016 [Caeno... 38 0.14
gi|13929148|ref|NP_113997.1| cyclic nucleotide-gated channel bet... 38 0.14
gi|3293446|gb|AAC25717.1| suppressin [Homo sapiens] 38 0.14
gi|47220336|emb|CAF98435.1| unnamed protein product [Tetraodon n... 38 0.14
gi|31201249|ref|XP_309572.1| ENSANGP00000022279 [Anopheles gambi... 38 0.14
gi|6679062|ref|NP_032723.1| ninein [Mus musculus] >gnl|BL_ORD_ID... 38 0.14
gi|47215043|emb|CAF95897.1| unnamed protein product [Tetraodon n... 37 0.18
gi|50760144|ref|XP_417907.1| PREDICTED: similar to hypothetical ... 37 0.18
gi|23126072|ref|ZP_00107981.1| COG4995: Uncharacterized protein ... 37 0.18
gi|26333737|dbj|BAC30586.1| unnamed protein product [Mus musculus] 37 0.18
gi|47229893|emb|CAG07089.1| unnamed protein product [Tetraodon n... 37 0.18
gi|586120|sp|Q07283|TRHY_HUMAN Trichohyalin >gnl|BL_ORD_ID|13043... 37 0.18
gi|20872800|ref|XP_127666.1| RIKEN cDNA A430109M18 [Mus musculus] 37 0.18
gi|34395616|sp|O70374|MT8R_MOUSE Protein CBFA2T2 (MTG8-like prot... 37 0.18
gi|41152520|ref|NP_766448.1| core-binding factor, runt domain, a... 37 0.18
gi|6226787|sp|Q92155|VIME_CYPCA Vimentin >gnl|BL_ORD_ID|1784138 ... 37 0.18
gi|18859549|ref|NP_571947.1| vimentin [Danio rerio] >gnl|BL_ORD_... 37 0.18
gi|10956506|ref|NP_053788.1| Mob protein [Bacillus subtilis] >gn... 37 0.18
gi|34785885|gb|AAH57713.1| MGC68858 protein [Xenopus laevis] 37 0.23
gi|50426879|ref|XP_462038.1| unnamed protein product [Debaryomyc... 37 0.23
gi|47221547|emb|CAF97812.1| unnamed protein product [Tetraodon n... 37 0.23
gi|32129512|sp|Q91YE3|EGL1_MOUSE Egl nine homolog 1 (Hypoxia-ind... 37 0.23
gi|50751256|ref|XP_422314.1| PREDICTED: similar to hypothetical ... 37 0.23
gi|38105695|gb|EAA52091.1| predicted protein [Magnaporthe grisea... 37 0.23
gi|48104329|ref|XP_395757.1| similar to ENSANGP00000002367 [Apis... 37 0.23
gi|6325152|ref|NP_015220.1| Hypothetical ORF; Ypl105cp [Saccharo... 37 0.30
gi|15606308|ref|NP_213687.1| hypothetical protein aq_1006 [Aquif... 37 0.30
gi|17535507|ref|NP_496323.1| mynd domain containing (48.5 kD) (2... 37 0.30
gi|47226834|emb|CAG06676.1| unnamed protein product [Tetraodon n... 37 0.30
gi|7488433|pir||T01524 zinc finger protein homolog T10M13.22 - A... 37 0.30
gi|24641414|ref|NP_572750.2| CG32662-PA [Drosophila melanogaster... 37 0.30
gi|18411882|ref|NP_567225.1| zinc finger (MYND type) family prot... 37 0.30
gi|15292193|gb|AAK93365.1| LD41932p [Drosophila melanogaster] 37 0.30
gi|50749817|ref|XP_421768.1| PREDICTED: similar to tudor domain ... 37 0.30
gi|41017390|sp|Q93IE8|MUKB_ACTAC Chromosome partition protein mu... 37 0.30
gi|47229038|emb|CAG09553.1| unnamed protein product [Tetraodon n... 37 0.30
gi|16768870|gb|AAL28654.1| LD09503p [Drosophila melanogaster] 37 0.30
gi|24665295|ref|NP_730163.1| CG4877-PA [Drosophila melanogaster]... 37 0.30
gi|21355925|ref|NP_648406.1| CG8003-PA [Drosophila melanogaster]... 37 0.30
gi|48096897|ref|XP_392541.1| similar to ENSANGP00000014221 [Apis... 36 0.39
gi|34909740|ref|NP_916217.1| putative homeobox protein GLABRA2 [... 36 0.39
gi|47211780|emb|CAF94090.1| unnamed protein product [Tetraodon n... 36 0.39
gi|50420039|ref|XP_458552.1| unnamed protein product [Debaryomyc... 36 0.39
gi|46442117|gb|EAL01409.1| hypothetical protein CaO19.10253 [Can... 36 0.39
gi|46442359|gb|EAL01649.1| hypothetical protein CaO19.2739 [Cand... 36 0.39
gi|26554401|ref|NP_758335.1| hypothetical protein MYPE9520 [Myco... 36 0.39
gi|46444719|gb|EAL03992.1| hypothetical protein CaO19.4657 [Cand... 36 0.39
gi|31339111|dbj|BAC77162.1| GL2-type homeodomain protein [Oryza ... 36 0.39
gi|23507883|ref|NP_700553.1| hypothetical protein [Plasmodium fa... 36 0.39
gi|41056137|ref|NP_956386.1| accessory protein BAP31; si:bz30i22... 36 0.39
gi|23612278|ref|NP_703858.1| hypothetical protein [Plasmodium fa... 36 0.39
gi|13376818|ref|NP_079490.1| CTCL tumor antigen se57-1 [Homo sap... 36 0.39
gi|48096868|ref|XP_394789.1| similar to CG9170-PA [Apis mellifera] 36 0.39
gi|32403154|ref|XP_322190.1| hypothetical protein [Neurospora cr... 36 0.39
gi|23508398|ref|NP_701067.1| hypothetical protein [Plasmodium fa... 36 0.39
gi|45383279|ref|NP_989774.1| MIZIP protein [Gallus gallus] >gnl|... 36 0.39
gi|50749486|ref|XP_421657.1| PREDICTED: similar to associated mo... 36 0.39
gi|16273285|ref|NP_439526.1| cell division protein [Haemophilus ... 36 0.52
gi|42631674|ref|ZP_00157212.1| COG3096: Uncharacterized protein ... 36 0.52
gi|30520119|ref|NP_848824.1| RIKEN cDNA D130054N24 gene [Mus mus... 36 0.52
gi|48867057|ref|ZP_00320685.1| COG3096: Uncharacterized protein ... 36 0.52
gi|23482863|gb|EAA18721.1| glutamine-asparagine rich protein [Pl... 36 0.52
gi|41148619|ref|XP_045086.5| KIAA1764 protein [Homo sapiens] 36 0.52
gi|26329521|dbj|BAC28499.1| unnamed protein product [Mus musculus] 36 0.52
gi|48095254|ref|XP_392266.1| similar to ENSANGP00000006371 [Apis... 36 0.52
gi|34996503|ref|NP_919317.1| expressed sequence AI595338 [Mus mu... 36 0.52
gi|31228034|ref|XP_317984.1| ENSANGP00000010768 [Anopheles gambi... 36 0.52
gi|50750467|ref|XP_422007.1| PREDICTED: hypothetical protein XP_... 36 0.52
gi|26328207|dbj|BAC27844.1| unnamed protein product [Mus musculus] 36 0.52
gi|12698073|dbj|BAB21855.1| KIAA1764 protein [Homo sapiens] 36 0.52
gi|26324710|dbj|BAC26109.1| unnamed protein product [Mus musculus] 36 0.52
gi|16553984|dbj|BAB71626.1| unnamed protein product [Homo sapiens] 36 0.52
gi|34863314|ref|XP_343385.1| hypothetical protein XP_343384 [Rat... 36 0.52
gi|23612234|ref|NP_703814.1| ribonuclease, putative [Plasmodium ... 36 0.52
gi|29436408|gb|AAH49909.1| D130054N24Rik protein [Mus musculus] 36 0.52
gi|48121818|ref|XP_396497.1| similar to mKIAA1601 protein [Apis ... 36 0.52
gi|42795687|gb|AAS46254.1| glutamyltransferase [Bacillus pumilus] 36 0.52
gi|10956501|ref|NP_053784.1| mobilization protein [Bacillus subt... 36 0.52
gi|10956521|ref|NP_049443.1| Mob [Bacillus subtilis] >gnl|BL_ORD... 36 0.52
gi|34932914|ref|XP_341473.1| similar to Ubiquitin carboxyl-termi... 35 0.67
gi|49022846|dbj|BAC65678.4| mKIAA0891 protein [Mus musculus] 35 0.67
gi|48040522|ref|NP_001001516.1| ubiquitin specific protease 19; ... 35 0.67
gi|1236759|emb|CAA58041.1| 256 kD golgin [Homo sapiens] 35 0.67
gi|46229789|gb|EAK90607.1| SMC4'SMC4, chromosomal ATpase with gi... 35 0.67
gi|50730273|ref|XP_425572.1| PREDICTED: similar to U2 small nucl... 35 0.67
gi|731046|sp|P40818|UBP8_HUMAN Ubiquitin carboxyl-terminal hydro... 35 0.67
gi|50738731|ref|XP_419330.1| PREDICTED: similar to chromosome 20... 35 0.67
gi|6715600|ref|NP_002069.2| golgi autoantigen, golgin subfamily ... 35 0.67
gi|34786063|gb|AAH57969.1| Expressed sequence AI595338 [Mus musc... 35 0.67
gi|50758611|ref|XP_417339.1| PREDICTED: similar to myeloid trans... 35 0.67
gi|31324620|gb|AAP48572.1| swan [Ciona intestinalis] 35 0.67
gi|15605760|ref|NP_213137.1| putative protein [Aquifex aeolicus ... 35 0.67
gi|50304311|ref|XP_452105.1| unnamed protein product [Kluyveromy... 35 0.67
gi|28436934|gb|AAH46824.1| similar to ubiquitin-specific proteas... 35 0.67
gi|6323204|ref|NP_013276.1| major low affinity 55 kDa Centromere... 35 0.67
gi|23612104|ref|NP_703684.1| MYND finger domain protein [Plasmod... 35 0.67
gi|50417987|gb|AAH77802.1| Unknown (protein for MGC:80412) [Xeno... 35 0.67
gi|17509831|ref|NP_493291.1| predicted CDS, nonstructural protei... 35 0.67
gi|40789062|dbj|BAA06225.2| KIAA0055 [Homo sapiens] 35 0.67
gi|47224421|emb|CAG08671.1| unnamed protein product [Tetraodon n... 35 0.67
gi|14195008|sp|Q9JI55|PLE1_CRIGR Plectin 1 (PLTN) (PCN) (300-kDa... 35 0.67
gi|46409322|ref|NP_997226.1| hypothetical protein DKFZp547C195 [... 35 0.67
gi|37540724|ref|XP_208529.4| similar to RIKEN cDNA D130054N24 ge... 35 0.67
gi|46117524|ref|XP_384780.1| hypothetical protein FG04604.1 [Gib... 35 0.67
gi|19705218|ref|NP_602713.1| hydrolase (HD superfamily) [Fusobac... 35 0.67
gi|47225969|emb|CAG04343.1| unnamed protein product [Tetraodon n... 35 0.67
gi|14423962|sp|O94966|UB19_HUMAN Ubiquitin carboxyl-terminal hyd... 35 0.67
gi|47825366|ref|NP_082080.2| ubiquitin-specific protease 19; ubi... 35 0.67
gi|1173565|gb|AAC51791.1| golgin-245 [Homo sapiens] >gnl|BL_ORD_... 35 0.67
gi|42406407|gb|AAH65909.1| USP19 protein [Homo sapiens] 35 0.67
gi|50725209|dbj|BAD33960.1| putative ubiquitin-specific protease... 35 0.88
gi|17509133|ref|NP_492772.1| MYND type zinc finger containing pr... 35 0.88
gi|4539614|gb|AAD22132.1| FEMA [Staphylococcus haemolyticus] 35 0.88
gi|32564211|ref|NP_871849.1| MYND type zinc finger containing pr... 35 0.88
gi|46432876|gb|EAK92339.1| hypothetical protein CaO19.6345 [Cand... 35 0.88
gi|46432949|gb|EAK92409.1| hypothetical protein CaO19.13701 [Can... 35 0.88
gi|32563937|ref|NP_493222.2| putative nuclear protein, with 4 co... 35 0.88
gi|45549231|ref|NP_524488.3| CG6875-PA [Drosophila melanogaster]... 35 0.88
gi|31212075|ref|XP_315022.1| ENSANGP00000022262 [Anopheles gambi... 35 0.88
gi|40849892|gb|AAR95658.1| plectin 4 [Rattus norvegicus] >gnl|BL... 35 0.88
gi|22080670|emb|CAC84080.1| melanin concentrating hormone recept... 35 0.88
gi|42784018|ref|NP_981265.1| S-layer homology domain protein [Ba... 35 0.88
gi|20808479|ref|NP_623650.1| predicted Transcriptional regulator... 35 0.88
gi|20151637|gb|AAM11178.1| LD39479p [Drosophila melanogaster] 35 0.88
gi|49072560|ref|XP_400569.1| hypothetical protein UM02954.1 [Ust... 35 0.88
gi|40849888|gb|AAR95656.1| plectin 2 [Rattus norvegicus] 35 0.88
gi|23612198|ref|NP_703778.1| hypothetical protein [Plasmodium fa... 35 0.88
gi|40849898|gb|AAR95661.1| plectin 7 [Rattus norvegicus] 35 0.88
gi|46800552|emb|CAG25720.2| plectin [Rattus norvegicus] 35 0.88
gi|23510098|ref|NP_702764.1| hypothetical protein [Plasmodium fa... 35 0.88
gi|40849886|gb|AAR95655.1| plectin 1 [Rattus norvegicus] 35 0.88
gi|37725922|gb|AAO38039.1| reticulocyte binding-like protein 2b ... 35 0.88
gi|13540714|ref|NP_071796.1| plectin [Rattus norvegicus] >gnl|BL... 35 0.88
gi|47209457|emb|CAF92436.1| unnamed protein product [Tetraodon n... 35 0.88
gi|41614883|ref|NP_963381.1| NEQ086 [Nanoarchaeum equitans Kin4-... 35 0.88
gi|46143831|ref|ZP_00133959.2| COG3064: Membrane protein involve... 35 0.88
gi|40849904|gb|AAR95664.1| plectin 10 [Rattus norvegicus] 35 0.88
gi|17510093|ref|NP_490719.1| ankyrin and Zn-finger, MYND type (1... 35 0.88
gi|39584138|emb|CAE61513.1| Hypothetical protein CBG05413 [Caeno... 35 0.88
gi|50233906|ref|NP_956976.2| hypothetical protein MGC65888 [Dani... 35 0.88
gi|37748609|gb|AAH60019.1| LOC398795 protein [Xenopus laevis] 35 0.88
gi|19113364|ref|NP_596572.1| hypothetical protein [Schizosacchar... 35 0.88
gi|40849896|gb|AAR95660.1| plectin 6 [Rattus norvegicus] 35 0.88
gi|7511963|pir||T13845 microtubule-associated protein - fruit fl... 35 0.88
gi|40849890|gb|AAR95657.1| plectin 3 [Rattus norvegicus] 35 0.88
gi|7507324|pir||T24622 hypothetical protein T06G6.3 - Caenorhabd... 35 0.88
gi|13385526|ref|NP_080297.1| melanin concentrating hormone recep... 35 0.88
gi|34877086|ref|XP_237966.2| similar to hypothetical protein FLJ... 35 0.88
gi|40849906|gb|AAR95665.1| plectin 11 [Rattus norvegicus] 35 0.88
gi|40849900|gb|AAR95662.1| plectin 8 [Rattus norvegicus] 35 0.88
gi|26328669|dbj|BAC28073.1| unnamed protein product [Mus musculus] 35 0.88
gi|34875652|ref|XP_217381.2| similar to Traf2 and NCK interactin... 35 1.1
gi|31874763|emb|CAD98081.1| hypothetical protein [Homo sapiens] 35 1.1
gi|32412530|ref|XP_326745.1| related to samB [MIPS] [Neurospora ... 35 1.1
gi|3327188|dbj|BAA31662.1| KIAA0687 protein [Homo sapiens] 35 1.1
gi|19387031|gb|AAL87095.1| HSP70 [Actinomadura spadix] 35 1.1
gi|50760148|ref|XP_417909.1| PREDICTED: similar to KIAA1052 prot... 35 1.1
gi|12585495|sp|Q9U1G5|VATE_HETSC Vacuolar ATP synthase subunit E... 35 1.1
gi|14517626|dbj|BAB61031.1| keratin associated protein 1.7 [Homo... 35 1.1
gi|3334142|sp|O43102|CBF5_ASPFU Centromere/microtubule binding p... 35 1.1
gi|22035602|ref|NP_004825.2| mitogen-activated protein kinase ki... 35 1.1
gi|23613070|ref|NP_703392.1| hypothetical protein [Plasmodium fa... 35 1.1
gi|15226253|ref|NP_180971.1| hypothetical protein [Arabidopsis t... 35 1.1
gi|17532007|ref|NP_495360.1| CD2-binding protein, GYF (2G981) [C... 35 1.1
gi|29427585|sp|O95819|M4K4_HUMAN Mitogen-activated protein kinas... 35 1.1
gi|22204206|emb|CAD43420.1| SI:bZ30I22.4 (novel protein similar ... 35 1.1
gi|28207195|gb|AAO32626.1| Ste20 group protein kinase HGK [Homo ... 35 1.1
gi|3293448|gb|AAC25718.1| suppressin [Homo sapiens] 35 1.1
gi|46110595|ref|XP_382355.1| hypothetical protein FG02179.1 [Gib... 35 1.1
gi|50289199|ref|XP_447029.1| unnamed protein product [Candida gl... 35 1.1
gi|22035606|ref|NP_663720.1| mitogen-activated protein kinase ki... 35 1.1
gi|46446413|ref|YP_007778.1| hypothetical protein pc0779 [Parach... 35 1.1
gi|6679060|ref|NP_032722.1| mitogen-activated protein kinase kin... 35 1.1
gi|31377634|ref|NP_443173.2| guanylate binding protein 4 [Homo s... 35 1.1
gi|47123304|gb|AAH70055.1| Guanylate binding protein 4 [Homo sap... 35 1.1
gi|4322936|gb|AAD16137.1| HPK/GCK-like kinase HGK [Homo sapiens] 35 1.1
gi|38108457|gb|EAA54469.1| hypothetical protein MG02454.4 [Magna... 35 1.1
gi|28829018|gb|AAO51593.1| similar to Plasmodium falciparum (iso... 35 1.1
gi|6678475|ref|NP_033479.1| U2 small nuclear ribonucleoprotein a... 35 1.1
gi|22035604|ref|NP_663719.1| mitogen-activated protein kinase ki... 35 1.1
gi|11359883|pir||T46481 hypothetical protein DKFZp434A025.1 - hu... 35 1.1
gi|37360046|dbj|BAC98001.1| mKIAA0687 protein [Mus musculus] 35 1.1
gi|7494144|pir||T18372 repeat organellar protein - Plasmodium ch... 34 1.5
gi|31237232|ref|XP_319568.1| ENSANGP00000006371 [Anopheles gambi... 34 1.5
gi|50513245|ref|NP_005474.2| chromatin assembly factor 1, subuni... 34 1.5
gi|31197671|ref|XP_307783.1| ENSANGP00000012929 [Anopheles gambi... 34 1.5
gi|23508760|ref|NP_701428.1| hypothetical protein [Plasmodium fa... 34 1.5
gi|6753154|ref|NP_033864.1| pre-acrosome localization protein 1 ... 34 1.5
gi|31982986|gb|AAP72162.1| heat shock protein 90 [Thaumatomonas ... 34 1.5
gi|49115919|gb|AAH73650.1| Unknown (protein for MGC:82991) [Xeno... 34 1.5
gi|30851290|gb|AAH52620.1| CHAF1A protein [Homo sapiens] 34 1.5
gi|32413563|ref|XP_327261.1| predicted protein [Neurospora crass... 34 1.5
gi|19918838|gb|AAL25258.1| TraM [Legionella pneumophila] 34 1.5
gi|23507987|ref|NP_700657.1| hypothetical protein [Plasmodium fa... 34 1.5
gi|15789646|ref|NP_279470.1| Vng0394c [Halobacterium sp. NRC-1] ... 34 1.5
gi|47225951|emb|CAG04325.1| unnamed protein product [Tetraodon n... 34 1.5
gi|39585964|emb|CAE68253.1| Hypothetical protein CBG13930 [Caeno... 34 1.5
gi|46108988|ref|XP_381552.1| hypothetical protein FG01376.1 [Gib... 34 1.5
gi|34882756|ref|XP_239684.2| similar to myosin-like protein [Rat... 34 1.5
gi|32413429|ref|XP_327194.1| predicted protein [Neurospora crass... 34 1.5
gi|28830026|gb|AAO52516.1| similar to Kaposi's sarcoma-associate... 34 1.5
gi|47217186|emb|CAG11022.1| unnamed protein product [Tetraodon n... 34 1.5
gi|17373489|sp|Q13111|CAFA_HUMAN Chromatin assembly factor 1 sub... 34 1.5
gi|50748027|ref|XP_421078.1| PREDICTED: similar to golgi-associa... 34 1.5
gi|6120107|gb|AAF04291.1| chromatin assembly factor-I p150 subun... 34 1.5
gi|23509114|ref|NP_701782.1| hypothetical protein [Plasmodium fa... 34 1.5
gi|21553414|gb|AAM62507.1| unknown [Arabidopsis thaliana] 34 1.5
gi|34875618|ref|XP_340946.1| similar to pre-acrosome localizatio... 34 1.5
gi|20808536|ref|NP_623707.1| cyclic beta 1-2 glucan synthetase [... 34 1.5
gi|50290531|ref|XP_447697.1| unnamed protein product [Candida gl... 34 1.5
gi|34098944|ref|NP_898892.1| zinc finger, MYND domain containing... 34 1.5
gi|50750157|ref|XP_421895.1| PREDICTED: similar to Disco-interac... 34 1.5
gi|23508767|ref|NP_701435.1| hypothetical protein [Plasmodium fa... 34 1.5
gi|15606250|ref|NP_213628.1| cell division protein FtsY [Aquifex... 34 2.0
gi|39581504|emb|CAE64240.1| Hypothetical protein CBG08878 [Caeno... 34 2.0
gi|46047435|ref|NP_996769.1| sarcoma antigen NY-SAR-41 [Homo sap... 34 2.0
gi|32394958|gb|AAO37656.1| interferon alpha 1 [Macropus eugenii] 34 2.0
gi|50740224|ref|XP_419399.1| PREDICTED: similar to RIKEN cDNA A9... 34 2.0
gi|24212055|sp|Q9Y366|NGD5_HUMAN NGD5 protein homolog (CGI-53) 34 2.0
gi|24980824|gb|AAH39831.1| C20orf9 protein [Homo sapiens] 34 2.0
gi|3820624|gb|AAC69631.1| factor essential for methicillin resis... 34 2.0
gi|24644365|ref|NP_730984.1| CG2179-PA [Drosophila melanogaster]... 34 2.0
gi|24215159|ref|NP_712640.1| integrin homolog [Leptospira interr... 34 2.0
gi|45657373|ref|YP_001459.1| conserved hypothetical protein [Lep... 34 2.0
gi|7512169|pir||T14156 kinesin-related protein - African clawed ... 34 2.0
gi|50082957|gb|AAT70104.1| CurI [Lyngbya majuscula] 34 2.0
gi|15930025|gb|AAH15453.1| ANKMY2 protein [Homo sapiens] 34 2.0
gi|32420813|ref|XP_330850.1| related to histone-lysine N-methylt... 34 2.0
gi|31127098|gb|AAH52867.1| Unknown (protein for IMAGE:30073198) ... 34 2.0
gi|28830036|gb|AAO52526.1| similar to Xenopus laevis (African cl... 34 2.0
gi|39585893|emb|CAE61307.1| Hypothetical protein CBG05142 [Caeno... 34 2.0
gi|11545138|emb|CAC08390.2| dJ1028D15.1 (continued from dJ138B7.... 34 2.0
gi|50408744|ref|XP_456808.1| unnamed protein product [Debaryomyc... 34 2.0
gi|48735024|gb|AAH72068.1| Unknown (protein for MGC:78955) [Xeno... 34 2.0
gi|24644367|ref|NP_649572.2| CG2179-PB [Drosophila melanogaster]... 34 2.0
gi|2072290|gb|AAC60120.1| XL-INCENP [Xenopus laevis] 34 2.0
gi|46108572|ref|XP_381344.1| hypothetical protein FG01168.1 [Gib... 34 2.0
gi|15602474|ref|NP_245546.1| MukB [Pasteurella multocida Pm70] >... 34 2.0
gi|28461129|ref|NP_064715.1| ankyrin repeat and MYND domain cont... 34 2.0
gi|25005391|emb|CAD56488.1| M protein [Streptococcus pyogenes] 34 2.0
gi|34866042|ref|XP_342794.1| similar to hypothetical protein FLJ... 34 2.0
gi|50414862|gb|AAH77794.1| Unknown (protein for IMAGE:5154772) [... 34 2.0
gi|31209679|ref|XP_313806.1| ENSANGP00000003946 [Anopheles gambi... 34 2.0
gi|18202023|sp|O33600|RA50_SULAC DNA double-strand break repair ... 34 2.0
gi|45185210|ref|NP_982927.1| ABL020Wp [Eremothecium gossypii] >g... 33 2.6
gi|39586364|emb|CAE74021.1| Hypothetical protein CBG21669 [Caeno... 33 2.6
gi|33667105|ref|NP_878913.1| downregulated in ovarian cancer 1 i... 33 2.6
gi|586122|sp|P22793|TRHY_SHEEP Trichohyalin >gnl|BL_ORD_ID|21738... 33 2.6
gi|23508673|ref|NP_701342.1| MAEBL, putative [Plasmodium falcipa... 33 2.6
gi|461521|sp|P33621|APA4_MACFA Apolipoprotein A-IV precursor (Ap... 33 2.6
gi|34495237|gb|AAQ73468.1| erythrocyte binding protein 2 [Plasmo... 33 2.6
gi|28828961|gb|AAO51542.1| similar to Dictyostelium discoideum (... 33 2.6
gi|34784364|gb|AAH57170.1| Hypothetical protein E430029F06 [Mus ... 33 2.6
gi|27370144|ref|NP_766365.1| hypothetical protein E430029F06 [Mu... 33 2.6
gi|33325035|gb|AAQ08177.1| GPBP-interacting protein A [Homo sapi... 33 2.6
gi|47223952|emb|CAG06129.1| unnamed protein product [Tetraodon n... 33 2.6
gi|23480195|gb|EAA16824.1| Homo sapiens HSKM-B [Plasmodium yoeli... 33 2.6
gi|50547151|ref|XP_501045.1| hypothetical protein [Yarrowia lipo... 33 2.6
gi|25518467|pir||D86265 hypothetical protein F3F19.14 - Arabidop... 33 2.6
gi|28564888|gb|AAO32528.1| YPL105C [Saccharomyces castellii] 33 2.6
gi|34859901|ref|XP_227619.2| similar to 2810453L12Rik protein [R... 33 2.6
gi|23509626|ref|NP_702293.1| hypothetical protein [Plasmodium fa... 33 2.6
gi|16804923|ref|NP_472952.1| hypothetical protein [Plasmodium fa... 33 2.6
gi|34877035|ref|XP_237182.2| similar to ALS2CR12 gene product [R... 33 2.6
gi|49087246|ref|XP_405580.1| hypothetical protein AN1443.2 [Aspe... 33 2.6
gi|15222184|ref|NP_172771.1| expressed protein [Arabidopsis thal... 33 2.6
gi|11225489|gb|AAG33024.1| MTG8 [Homo sapiens] 33 2.6
gi|15894405|ref|NP_347754.1| Phage-related protein, YqbO B.subti... 33 2.6
gi|26332218|dbj|BAC29839.1| unnamed protein product [Mus musculus] 33 2.6
gi|46849741|ref|NP_666145.2| expressed sequence AI035571 [Mus mu... 33 2.6
gi|50555271|ref|XP_505044.1| hypothetical protein [Yarrowia lipo... 33 2.6
gi|50289285|ref|XP_447073.1| unnamed protein product [Candida gl... 33 2.6
gi|47214048|emb|CAG00706.1| unnamed protein product [Tetraodon n... 33 2.6
gi|17539164|ref|NP_501001.1| bicaudal D like (4H330) [Caenorhabd... 33 2.6
gi|159333|gb|AAA20179.1| glycoprotein 96-92 33 2.6
gi|47606042|sp|Q8MIT6|ROC1_BOVIN Rho-associated protein kinase 1... 33 2.6
gi|48103540|ref|XP_395596.1| similar to ENSANGP00000009214 [Apis... 33 2.6
gi|29654240|ref|NP_819932.1| conserved domain protein [Coxiella ... 33 2.6
gi|32423201|ref|XP_332038.1| predicted protein [Neurospora crass... 33 2.6
gi|41054808|ref|NP_956896.1| hypothetical protein MGC63548 [Dani... 33 2.6
gi|24762574|ref|NP_611890.1| CG3260-PA [Drosophila melanogaster]... 33 2.6
gi|48096160|ref|XP_394621.1| similar to ENSANGP00000019991 [Apis... 33 2.6
gi|21064263|gb|AAM29361.1| GM13546p [Drosophila melanogaster] 33 2.6
gi|37999758|sp|Q96PP9|GBP4_HUMAN Guanylate binding protein 4 >gn... 33 2.6
gi|27227801|emb|CAD59409.1| SMC1 protein [Oryza sativa] 33 2.6
gi|48124531|ref|XP_396558.1| similar to CG3493-PA [Apis mellifera] 33 2.6
gi|14591553|ref|NP_143635.1| chromosome assembly protein [Pyroco... 33 2.6
gi|24652184|ref|NP_610519.1| CG1625-PA [Drosophila melanogaster]... 33 2.6
gi|31202063|ref|XP_309979.1| ENSANGP00000015940 [Anopheles gambi... 33 2.6
gi|38107953|gb|EAA54055.1| hypothetical protein MG02040.4 [Magna... 33 2.6
gi|33325039|gb|AAQ08179.1| GPBP-interacting protein C [Homo sapi... 33 2.6
gi|34526533|dbj|BAC85144.1| FLJ00316 protein [Homo sapiens] 33 2.6
gi|34495238|gb|AAQ73469.1| erythrocyte binding protein 3 [Plasmo... 33 2.6
gi|48095571|ref|XP_392322.1| similar to ENSANGP00000005249 [Apis... 33 2.6
gi|6320620|ref|NP_010700.1| Protein required for cell viability;... 33 2.6
gi|47221320|emb|CAG13256.1| unnamed protein product [Tetraodon n... 33 2.6
gi|6503031|gb|AAF14556.1| F-box protein 27 [Xenopus laevis] 33 3.3
gi|47217022|emb|CAG01650.1| unnamed protein product [Tetraodon n... 33 3.3
gi|35038601|ref|NP_919268.1| hypothetical protein DKFZp761A078 [... 33 3.3
gi|50732563|ref|XP_418695.1| PREDICTED: similar to ankyrin repea... 33 3.3
gi|32405024|ref|XP_323125.1| hypothetical protein [Neurospora cr... 33 3.3
gi|11595644|emb|CAC18264.1| conserved hypothetical protein [Neur... 33 3.3
gi|29247036|gb|EAA38612.1| GLP_226_37125_38774 [Giardia lamblia ... 33 3.3
gi|33416544|gb|AAH55915.1| BC055915 protein [Mus musculus] 33 3.3
gi|32419413|ref|XP_330150.1| hypothetical protein [Neurospora cr... 33 3.3
gi|38648822|gb|AAH63133.1| TDRD1 protein [Homo sapiens] 33 3.3
gi|42475558|ref|NP_775179.1| SMG-7 homolog isoform 1; ever short... 33 3.3
gi|18976707|ref|NP_578064.1| flagella-related protein d, putativ... 33 3.3
gi|29346206|ref|NP_809709.1| conserved hypothetical protein [Bac... 33 3.3
gi|27372208|dbj|BAC53621.1| SMG-7 [Homo sapiens] 33 3.3
gi|38049332|ref|XP_129366.4| hypothetical protein XP_129366 [Mus... 33 3.3
gi|38108806|gb|EAA54767.1| hypothetical protein MG05558.4 [Magna... 33 3.3
gi|47230690|emb|CAF99883.1| unnamed protein product [Tetraodon n... 33 3.3
gi|28279861|gb|AAH44103.1| Smyd2-prov protein [Xenopus laevis] 33 3.3
gi|23612374|ref|NP_703954.1| SET-domain protein, putative [Plasm... 33 3.3
gi|14017819|dbj|BAB47430.1| KIAA1801 protein [Homo sapiens] 33 3.3
gi|46361248|emb|CAG25109.1| SET-domain protein, putative; putati... 33 3.3
gi|39594954|emb|CAE70822.1| Hypothetical protein CBG17593 [Caeno... 33 3.3
gi|28828505|gb|AAO51113.1| similar to Dictyostelium discoideum (... 33 3.3
gi|50404938|ref|YP_054030.1| hypothetical protein PTMB.102c [Par... 33 3.3
gi|38505161|ref|NP_942090.1| tudor domain containing 1; tudor do... 33 3.3
gi|39586701|emb|CAE69421.1| Hypothetical protein CBG15585 [Caeno... 33 3.3
gi|32418808|ref|XP_329882.1| predicted protein [Neurospora crass... 33 3.3
gi|50355696|ref|NP_001002238.1| tudor domain containing 1 isofor... 33 3.3
gi|26325742|dbj|BAC26625.1| unnamed protein product [Mus musculus] 33 3.3
gi|2495725|sp|Q92540|Y250_HUMAN Hypothetical protein KIAA0250 33 3.3
gi|38607488|gb|AAR25620.1| breast cancer-associated antigen SGA-... 33 3.3
gi|48097916|ref|XP_391974.1| similar to ENSANGP00000012283 [Apis... 33 3.3
gi|50252264|dbj|BAD28270.1| putative ubiquitin-specific protease... 33 3.3
gi|17550806|ref|NP_509975.1| intracellular protein transport lik... 33 3.3
gi|18406916|ref|NP_564765.1| expressed protein [Arabidopsis thal... 33 3.3
gi|7489885|pir||T14867 interaptin - slime mold (Dictyostelium di... 33 3.3
gi|3044185|gb|AAC13303.1| mature parasite-infected erythrocyte s... 33 3.3
gi|42659342|ref|XP_370565.2| similar to hypothetical protein FLJ... 33 3.3
gi|34852384|ref|XP_228081.2| similar to pericentrin [Rattus norv... 33 3.3
gi|34864564|ref|XP_217641.2| similar to tudor repeat protein [Ra... 33 3.3
gi|12313900|emb|CAC19685.1| dJ127C7.1 (KIAA0250 protein) [Homo s... 33 3.3
gi|47228961|emb|CAG09476.1| unnamed protein product [Tetraodon n... 33 3.3
gi|45188246|ref|NP_984469.1| ADR373Wp [Eremothecium gossypii] >g... 33 3.3
gi|23612249|ref|NP_703829.1| hypothetical protein [Plasmodium fa... 33 3.3
gi|47226824|emb|CAG06666.1| unnamed protein product [Tetraodon n... 33 3.3
gi|13508375|ref|NP_110325.1| ribosome releasing factor [Mycoplas... 33 3.3
gi|17539660|ref|NP_501873.1| myosin heavy chain (4K994) [Caenorh... 33 3.3
gi|39592280|emb|CAE75501.1| Hypothetical protein CBG23510 [Caeno... 33 3.3
gi|47221503|emb|CAG08165.1| unnamed protein product [Tetraodon n... 33 3.3
gi|39579358|emb|CAE56909.1| Hypothetical protein CBG24752 [Caeno... 33 3.3
gi|17384366|emb|CAD13202.1| involucrin [Sus scrofa] 33 3.3
gi|38566954|emb|CAE76256.1| conserved hypothetical protein [Neur... 33 3.3
gi|31238506|ref|XP_319789.1| ENSANGP00000005190 [Anopheles gambi... 33 3.3
gi|49899767|gb|AAH76808.1| Unknown (protein for MGC:83761) [Xeno... 33 3.3
gi|48865872|ref|ZP_00319730.1| COG0497: ATPase involved in DNA r... 33 3.3
gi|24379903|ref|NP_721858.1| putative chromosome segregation ATP... 33 3.3
gi|50740296|ref|XP_419420.1| PREDICTED: similar to SET and MYND ... 33 3.3
gi|10433748|dbj|BAB14022.1| unnamed protein product [Homo sapiens] 33 3.3
>gi|17568117|ref|NP_510277.1| BMP receptor Associated protein (21.5
kD) (bra-1) [Caenorhabditis elegans]
gi|7504125|pir||T22604 hypothetical protein F54B11.6 -
Caenorhabditis elegans
gi|3877565|emb|CAA94138.1| Hypothetical protein F54B11.6
[Caenorhabditis elegans]
Length = 183
Score = 388 bits (997), Expect = e-107
Identities = 183/183 (100%), Positives = 183/183 (100%)
Frame = +1
Query: 1 MSEEAEAGPSPKVNGENGNGTNTFDDLYVDDKMRRMIVDLQRQWLTDYHDSREKSLVALT 180
MSEEAEAGPSPKVNGENGNGTNTFDDLYVDDKMRRMIVDLQRQWLTDYHDSREKSLVALT
Sbjct: 1 MSEEAEAGPSPKVNGENGNGTNTFDDLYVDDKMRRMIVDLQRQWLTDYHDSREKSLVALT 60
Query: 181 EKLHQEFMEDQERVRRDLLVQFKIELDQTKEELEKKHAENLKEEIEKLSEKHQRELAVAK 360
EKLHQEFMEDQERVRRDLLVQFKIELDQTKEELEKKHAENLKEEIEKLSEKHQRELAVAK
Sbjct: 61 EKLHQEFMEDQERVRRDLLVQFKIELDQTKEELEKKHAENLKEEIEKLSEKHQRELAVAK 120
Query: 361 KKQWCWQCNSEAIYHCCWNTAYCSVECQQGHWQIHRKFCRRKKSNGGAPGPVQPIAEPTQ 540
KKQWCWQCNSEAIYHCCWNTAYCSVECQQGHWQIHRKFCRRKKSNGGAPGPVQPIAEPTQ
Sbjct: 121 KKQWCWQCNSEAIYHCCWNTAYCSVECQQGHWQIHRKFCRRKKSNGGAPGPVQPIAEPTQ 180
Query: 541 SQQ 549
SQQ
Sbjct: 181 SQQ 183