Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F54C9_4
(864 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17532625|ref|NP_495810.1| COLlagen structural gene (col-38) [... 335 6e-91
gi|39587116|emb|CAE57583.1| Hypothetical protein CBG00562 [Caeno... 304 1e-81
gi|39589676|emb|CAE66911.1| Hypothetical protein CBG12296 [Caeno... 141 2e-32
gi|17552372|ref|NP_498729.1| COLlagen structural gene (30.6 kD) ... 139 8e-32
gi|17551258|ref|NP_510522.1| COLlagen structural gene (col-41) [... 137 2e-31
gi|39596631|emb|CAE63250.1| Hypothetical protein CBG07618 [Caeno... 137 2e-31
gi|39589674|emb|CAE66909.1| Hypothetical protein CBG12293 [Caeno... 133 4e-30
gi|687636|gb|AAA62505.1| collagen [Caenorhabditis elegans] 108 1e-22
gi|17539720|ref|NP_502372.1| COLlagen structural gene (28.8 kD) ... 95 2e-18
gi|39585657|emb|CAE59859.1| Hypothetical protein CBG03334 [Caeno... 92 2e-17
gi|32563747|ref|NP_494878.2| COLlagen structural gene (col-17) [... 90 7e-17
gi|25148392|ref|NP_741318.1| COLlagen structural gene (28.5 kD) ... 88 3e-16
gi|687634|gb|AAA62504.1| collagen 86 8e-16
gi|17508163|ref|NP_492936.1| COLlagen structural gene (col-65) [... 86 1e-15
gi|39596219|emb|CAE69856.1| Hypothetical protein CBG16184 [Caeno... 81 3e-14
gi|39585958|emb|CAE68247.1| Hypothetical protein CBG13922 [Caeno... 81 3e-14
gi|17563992|ref|NP_505484.1| COLlagen structural gene (27.4 kD) ... 78 2e-13
gi|23482650|gb|EAA18573.1| hypothetical protein [Plasmodium yoel... 78 2e-13
gi|39593091|emb|CAE64560.1| Hypothetical protein CBG09310 [Caeno... 78 3e-13
gi|17550832|ref|NP_509555.1| COLlagen structural gene (28.5 kD) ... 77 4e-13
gi|39594640|emb|CAE72218.1| Hypothetical protein CBG19329 [Caeno... 77 5e-13
gi|17552762|ref|NP_498533.1| COLlagen structural gene (col-8) [C... 77 6e-13
gi|33591257|gb|AAL06398.2| unknown [Francisella tularensis subsp... 77 6e-13
gi|39580427|emb|CAE69309.1| Hypothetical protein CBG15367 [Caeno... 76 8e-13
gi|39592587|emb|CAE63664.1| Hypothetical protein CBG08166 [Caeno... 76 1e-12
gi|17561556|ref|NP_505902.1| COLlagen structural gene (col-156) ... 75 2e-12
gi|17532627|ref|NP_496309.1| COLlagen structural gene (31.6 kD) ... 75 2e-12
gi|39593952|emb|CAE70062.1| Hypothetical protein CBG16497 [Caeno... 74 3e-12
gi|115404|sp|P18833|CC08_CAEEL Cuticle collagen 8 precursor >gnl... 74 5e-12
gi|17567005|ref|NP_510248.1| COLlagen structural gene (col-184) ... 73 7e-12
gi|39596526|emb|CAE63145.1| Hypothetical protein CBG07447 [Caeno... 73 7e-12
gi|17563988|ref|NP_505486.1| COLlagen structural gene (27.2 kD) ... 73 9e-12
gi|39594639|emb|CAE72217.1| Hypothetical protein CBG19328 [Caeno... 72 1e-11
gi|17560252|ref|NP_504525.1| COLlagen structural gene (col-140) ... 72 1e-11
gi|39594379|emb|CAE71957.1| Hypothetical protein CBG19026 [Caeno... 71 3e-11
gi|17564310|ref|NP_504735.1| COLlagen structural gene (col-141) ... 70 5e-11
gi|17505583|ref|NP_492091.1| COLlagen structural gene (col-62) [... 70 6e-11
gi|17532621|ref|NP_494879.1| COLlagen structural gene (col-20) [... 70 8e-11
gi|20138902|sp|O97432|MRJ5_APIME Major royal jelly protein 5 pre... 70 8e-11
gi|39592028|emb|CAE75248.1| Hypothetical protein CBG23205 [Caeno... 68 2e-10
gi|39595564|emb|CAE67065.1| Hypothetical protein CBG12473 [Caeno... 68 3e-10
gi|17506917|ref|NP_491595.1| DumPY : shorter than wild-type DPY-... 67 4e-10
gi|39592976|emb|CAE62590.1| Hypothetical protein CBG06704 [Caeno... 67 4e-10
gi|22096340|sp|P18835|CC19_CAEEL Cuticle collagen 19 precursor >... 67 4e-10
gi|17558722|ref|NP_506300.1| COLlagen structural gene (col-161) ... 67 5e-10
gi|39593008|emb|CAE62622.1| Hypothetical protein CBG06744 [Caeno... 67 5e-10
gi|39597389|emb|CAE59618.1| Hypothetical protein CBG03027 [Caeno... 67 7e-10
gi|17543526|ref|NP_502966.1| predicted CDS, COLlagen structural ... 59 8e-10
gi|17565206|ref|NP_506334.1| COLlagen structural gene (col-162) ... 66 9e-10
gi|17158629|ref|NP_478050.1| wsv528 [shrimp white spot syndrome ... 65 1e-09
gi|17505581|ref|NP_492090.1| COLlagen structural gene (col-7) [C... 64 6e-09
gi|39595517|emb|CAE60555.1| Hypothetical protein CBG04182 [Caeno... 64 6e-09
gi|25150119|ref|NP_505374.2| COLlagen structural gene (col-144) ... 63 9e-09
gi|39582632|emb|CAE73736.1| Hypothetical protein CBG21262 [Caeno... 62 1e-08
gi|39594071|emb|CAE70181.1| Hypothetical protein CBG16654 [Caeno... 62 2e-08
gi|17531719|ref|NP_496310.1| COLlagen structural gene (31.3 kD) ... 62 2e-08
gi|17507107|ref|NP_491694.1| COLlagen structural gene (col-54) [... 61 3e-08
gi|17541560|ref|NP_502297.1| COLlagen structural gene (33.5 kD) ... 61 3e-08
gi|23510135|ref|NP_702801.1| hypothetical protein [Plasmodium fa... 61 3e-08
gi|39593314|emb|CAE64784.1| Hypothetical protein CBG09577 [Caeno... 61 3e-08
gi|39595633|emb|CAE67135.1| Hypothetical protein CBG12558 [Caeno... 61 4e-08
gi|17539048|ref|NP_500094.1| COLlagen structural gene (col-107) ... 61 4e-08
gi|39593890|emb|CAE62183.1| Hypothetical protein CBG06230 [Caeno... 61 4e-08
gi|39594380|emb|CAE71958.1| Hypothetical protein CBG19027 [Caeno... 60 5e-08
gi|32566500|ref|NP_872105.1| COLlagen structural gene (27.6 kD) ... 59 2e-07
gi|39595378|emb|CAE60416.1| Hypothetical protein CBG04022 [Caeno... 59 2e-07
gi|39587940|emb|CAE67959.1| Hypothetical protein CBG13563 [Caeno... 58 3e-07
gi|34878291|ref|XP_346097.1| similar to opioid growth factor rec... 58 3e-07
gi|39594381|emb|CAE71959.1| Hypothetical protein CBG19029 [Caeno... 57 4e-07
gi|42601246|gb|AAS21320.1| major royal jelly protein MRJP5 precu... 57 4e-07
gi|50419503|ref|XP_458278.1| unnamed protein product [Debaryomyc... 57 5e-07
gi|1705738|sp|P51861|CDR1_HUMAN Cerebellar-degeneration-related ... 57 5e-07
gi|39593374|emb|CAE64844.1| Hypothetical protein CBG09640 [Caeno... 57 5e-07
gi|23612220|ref|NP_703800.1| myosin-like protein, putative [Plas... 57 5e-07
gi|39597390|emb|CAE59619.1| Hypothetical protein CBG03028 [Caeno... 57 5e-07
gi|50424619|ref|XP_460899.1| unnamed protein product [Debaryomyc... 57 7e-07
gi|39586236|emb|CAE66647.1| Hypothetical protein CBG11984 [Caeno... 56 1e-06
gi|23613570|ref|NP_704591.1| E1-E2_ATPase/hydrolase, putative [P... 56 1e-06
gi|32564228|ref|NP_499057.3| CoLlagen, Basement membrane type, a... 48 1e-06
gi|17538706|ref|NP_499957.1| predicted CDS, COLlagen structural ... 55 2e-06
gi|30348551|emb|CAC84343.1| hypothetical protein [Saimiriine her... 55 2e-06
gi|17557220|ref|NP_505647.1| COLlagen structural gene (col-150) ... 55 2e-06
gi|39586197|emb|CAE66608.1| Hypothetical protein CBG11934 [Caeno... 55 2e-06
gi|23485922|gb|EAA20646.1| hypothetical protein [Plasmodium yoel... 55 2e-06
gi|5669894|gb|AAD46501.1| latent nuclear antigen [Human herpesvi... 55 3e-06
gi|2246532|gb|AAB62657.1| ORF 73, contains large complex repeat ... 55 3e-06
gi|13936996|gb|AAK50002.1| ORF73 [Human herpesvirus 8] 55 3e-06
gi|11037008|gb|AAG27458.1| latent nuclear antigen [Human herpesv... 55 3e-06
gi|9886896|gb|AAG01636.1| Orf73 [Human herpesvirus 8] 55 3e-06
gi|39586186|emb|CAE66597.1| Hypothetical protein CBG11921 [Caeno... 54 3e-06
gi|23468050|ref|ZP_00123621.1| COG5295: Autotransporter adhesin ... 38 4e-06
gi|18846043|ref|NP_572129.1| ORF 73; extensive acidic domains, p... 54 4e-06
gi|17557828|ref|NP_505635.1| COLlagen structural gene (col-148) ... 54 4e-06
gi|23612236|ref|NP_703816.1| hypothetical protein [Plasmodium fa... 54 6e-06
gi|50311883|ref|XP_455973.1| unnamed protein product [Kluyveromy... 54 6e-06
gi|38488737|ref|NP_942112.1| starmaker [Danio rerio] >gnl|BL_ORD... 54 6e-06
gi|32566102|ref|NP_508100.2| COLlagen structural gene (col-19) [... 53 8e-06
gi|44889483|ref|NP_004056.2| cerebellar degeneration-related pro... 53 8e-06
gi|39593302|emb|CAE64772.1| Hypothetical protein CBG09563 [Caeno... 53 8e-06
gi|23484285|gb|EAA19671.1| Ran-binding protein [Plasmodium yoeli... 53 1e-05
gi|84432|pir||JS0170 collagen col-19 - Caenorhabditis elegans >g... 53 1e-05
gi|39592187|emb|CAE75407.1| Hypothetical protein CBG23397 [Caeno... 53 1e-05
gi|26554099|ref|NP_758033.1| DNA topoisomerase IV subunit A [Myc... 52 1e-05
gi|39593182|emb|CAE64651.1| Hypothetical protein CBG09422 [Caeno... 52 1e-05
gi|45360527|ref|NP_988936.1| hypothetical protein MGC75993 [Xeno... 52 2e-05
gi|23619248|ref|NP_705210.1| hypothetical protein, conserved [Pl... 52 2e-05
gi|16804923|ref|NP_472952.1| hypothetical protein [Plasmodium fa... 52 2e-05
gi|17552984|ref|NP_498814.1| COLlagen structural gene (col-91) [... 51 3e-05
gi|48838606|ref|ZP_00295547.1| COG0457: FOG: TPR repeat [Methano... 51 4e-05
gi|33285196|gb|AAF99925.2| Collagen protein 111 [Caenorhabditis ... 51 4e-05
gi|50554953|ref|XP_504885.1| hypothetical protein [Yarrowia lipo... 50 5e-05
gi|17509327|ref|NP_491194.1| COLlagen structural gene (col-50) [... 50 5e-05
gi|46227256|gb|EAK88206.1| similar to hypothetical protein [Cryp... 50 6e-05
gi|39580220|emb|CAE72976.1| Hypothetical protein CBG20316 [Caeno... 50 6e-05
gi|482198|pir||S40991 collagen alpha 1(IV) chain precursor - Cae... 39 9e-05
gi|17552718|ref|NP_498862.1| C.Elegans Chromodomain protein (33.... 49 1e-04
gi|34881243|ref|XP_228548.2| similar to paternally expressed 10;... 49 1e-04
gi|32455487|ref|NP_862613.1| unknown; OrfX [Lactococcus lactis s... 49 1e-04
gi|23508016|ref|NP_700686.1| 10b antigen, putative [Plasmodium f... 49 1e-04
gi|23510031|ref|NP_702697.1| hypothetical protein [Plasmodium fa... 49 1e-04
gi|7508686|pir||T15143 hypothetical protein T28F2.8 - Caenorhabd... 49 1e-04
gi|23482074|gb|EAA18164.1| hypothetical protein [Plasmodium yoel... 49 2e-04
gi|17537701|ref|NP_496783.1| predicted CDS, COLlagen structural ... 49 2e-04
gi|39591984|emb|CAE75204.1| Hypothetical protein CBG23151 [Caeno... 49 2e-04
gi|32419885|ref|XP_330386.1| predicted protein [Neurospora crass... 49 2e-04
gi|17385615|emb|CAD12627.1| involucrin [Sus scrofa] 49 2e-04
gi|15228477|ref|NP_189519.1| expressed protein [Arabidopsis thal... 48 2e-04
gi|7512169|pir||T14156 kinesin-related protein - African clawed ... 48 2e-04
gi|47226278|emb|CAG09246.1| unnamed protein product [Tetraodon n... 48 2e-04
gi|50545197|ref|XP_500136.1| hypothetical protein [Yarrowia lipo... 48 2e-04
gi|50754161|ref|XP_414265.1| PREDICTED: similar to KIAA0800 prot... 48 2e-04
gi|7474144|pir||T30321 hypothetical protein - Lactococcus lactis... 48 2e-04
gi|25385147|pir||A88640 protein C34H4.4 [imported] - Caenorhabdi... 47 4e-04
gi|17569903|ref|NP_508386.1| COLlagen structural gene (38.6 kD) ... 47 5e-04
gi|12854115|dbj|BAB29931.1| unnamed protein product [Mus musculus] 47 5e-04
gi|38090700|ref|XP_137221.4| RIKEN cDNA 4930503E15 [Mus musculus] 47 5e-04
gi|47220033|emb|CAG12181.1| unnamed protein product [Tetraodon n... 47 7e-04
gi|15789646|ref|NP_279470.1| Vng0394c [Halobacterium sp. NRC-1] ... 47 7e-04
gi|17564308|ref|NP_504736.1| COLlagen structural gene (col-142) ... 47 7e-04
gi|15792502|ref|NP_282325.1| highly acidic protein [Campylobacte... 46 0.001
gi|46444759|gb|EAL04032.1| hypothetical protein CaO19.4697 [Cand... 46 0.001
gi|23619548|ref|NP_705510.1| hypothetical protein [Plasmodium fa... 46 0.001
gi|47228390|emb|CAG05210.1| unnamed protein product [Tetraodon n... 46 0.001
gi|46444915|gb|EAL04187.1| hypothetical protein CaO19.12167 [Can... 46 0.001
gi|50405059|ref|YP_054151.1| hypothetical protein PTMB.222 [Para... 46 0.001
gi|4519619|dbj|BAA75669.1| collagen pro alpha-chain [Haliotis di... 46 0.001
gi|23619284|ref|NP_705246.1| hypothetical protein [Plasmodium fa... 46 0.001
gi|31198993|ref|XP_308444.1| ENSANGP00000017898 [Anopheles gambi... 46 0.001
gi|23509556|ref|NP_702223.1| NAD(P)H-dependent glutamate synthas... 46 0.001
gi|7489885|pir||T14867 interaptin - slime mold (Dictyostelium di... 46 0.001
gi|23509871|ref|NP_702538.1| hypothetical protein [Plasmodium fa... 45 0.002
gi|39546248|emb|CAE04257.3| OSJNBa0089N06.18 [Oryza sativa (japo... 45 0.002
gi|26347067|dbj|BAC37182.1| unnamed protein product [Mus musculus] 45 0.002
gi|7494171|pir||T28635 glutamate synthase (NADH2) (EC 1.4.1.14) ... 45 0.002
gi|23508683|ref|NP_701352.1| antigen 332, putative [Plasmodium f... 45 0.002
gi|34865002|ref|XP_235088.2| similar to KIAA1801 protein [Rattus... 45 0.002
gi|17540820|ref|NP_500070.1| COLlagen structural gene (28.0 kD) ... 45 0.002
gi|25411550|pir||F84514 hypothetical protein At2g14140 [imported... 45 0.002
gi|39586155|emb|CAE69231.1| Hypothetical protein CBG15273 [Caeno... 45 0.002
gi|23612990|ref|NP_704529.1| hypothetical protein [Plasmodium fa... 45 0.002
gi|17559062|ref|NP_506053.1| COLlagen structural gene (col-37) [... 45 0.002
gi|46438498|gb|EAK97828.1| hypothetical protein CaO19.976 [Candi... 45 0.002
gi|1814029|gb|AAB41793.1| cuticle collagen [Caenorhabditis brigg... 45 0.002
gi|4519617|dbj|BAA75668.1| collagen pro alpha-chain [Haliotis di... 45 0.002
gi|23613038|ref|NP_703360.1| interspersed repeat antigen, putati... 45 0.002
gi|39581569|emb|CAE58354.1| Hypothetical protein CBG01475 [Caeno... 45 0.002
gi|22832760|gb|AAH13626.1| Col3a1 protein [Mus musculus] 45 0.002
gi|46228936|gb|EAK89785.1| hypothetical protein with signal pept... 45 0.002
gi|499385|emb|CAA53511.1| collectin-43 [Bos taurus] 45 0.002
gi|1083017|pir||A53570 collectin-43 - bovine 45 0.002
gi|2119163|pir||S59856 collagen alpha 1(III) chain precursor - m... 45 0.002
gi|26334217|dbj|BAC30826.1| unnamed protein product [Mus musculus] 45 0.002
gi|5921190|sp|P08121|CA13_MOUSE Collagen alpha 1(III) chain prec... 45 0.002
gi|33859526|ref|NP_034060.1| procollagen, type III, alpha 1; min... 45 0.002
gi|26339398|dbj|BAC33370.1| unnamed protein product [Mus musculus] 45 0.002
gi|20380522|gb|AAH28248.1| Col3a1 protein [Mus musculus] 45 0.002
gi|23619193|ref|NP_705155.1| hypothetical protein [Plasmodium fa... 45 0.002
gi|32398688|emb|CAD98648.1| retinitis pigmentosa GTPase regulato... 45 0.002
gi|39583551|emb|CAE65655.1| Hypothetical protein CBG10720 [Caeno... 45 0.002
gi|1711421|sp|P54705|SNWA_DICDI Protein snwA >gnl|BL_ORD_ID|9602... 45 0.003
gi|29893526|gb|AAN16519.1| merozoite surface protein-9 [Plasmodi... 45 0.003
gi|29028613|ref|NP_803303.1| tail fiber [Staphylococcus aureus p... 45 0.003
gi|9837385|gb|AAG00554.1| retinitis pigmentosa GTPase regulator-... 45 0.003
gi|46433288|gb|EAK92734.1| hypothetical protein CaO19.11951 [Can... 45 0.003
gi|19112576|ref|NP_595784.1| hypothetical coiled-coil protein [S... 45 0.003
gi|17426290|ref|NP_510956.1| hypothetical protein [Bacteriophage... 45 0.003
gi|46442629|gb|EAL01917.1| hypothetical protein CaO19.11787 [Can... 45 0.003
gi|49121568|ref|XP_412424.1| hypothetical protein AN8287.2 [Aspe... 45 0.003
gi|37536608|ref|NP_922606.1| putative kinesin-related protein [O... 45 0.003
gi|46308601|ref|ZP_00210793.1| COG0532: Translation initiation f... 45 0.003
gi|50748622|ref|XP_421330.1| PREDICTED: similar to chromogranin ... 45 0.003
gi|17540706|ref|NP_499982.1| COLlagen structural gene (33.8 kD) ... 45 0.003
gi|15230788|ref|NP_189665.1| hypothetical protein [Arabidopsis t... 44 0.003
gi|46442648|gb|EAL01936.1| hypothetical protein CaO19.11806 [Can... 44 0.003
gi|47938675|gb|AAH72337.1| LOC432244 protein [Xenopus laevis] 44 0.003
gi|84434|pir||PS0036 collagen col-7 - Caenorhabditis elegans (fr... 44 0.003
gi|46442513|gb|EAL01802.1| hypothetical protein CaO19.4330 [Cand... 44 0.003
gi|28829494|gb|AAO52027.1| similar to Dictyostelium discoideum (... 44 0.003
gi|1709211|sp|P54697|MYSJ_DICDI Myosin IJ heavy chain >gnl|BL_OR... 44 0.003
gi|28850409|gb|AAO53177.1| similar to Dictyostelium discoideum (... 44 0.003
gi|1589173|prf||2210342A myosin:SUBUNIT=heavy chain 44 0.003
gi|39588428|emb|CAE72779.1| Hypothetical protein CBG20034 [Caeno... 44 0.003
gi|1070603|pir||CGHU7L collagen alpha 1(III) chain precursor - h... 44 0.005
gi|4502951|ref|NP_000081.1| alpha 1 type III collagen; Collagen ... 44 0.005
gi|42569025|ref|NP_179030.2| hypothetical protein [Arabidopsis t... 44 0.005
gi|46437473|gb|EAK96819.1| hypothetical protein CaO19.10369 [Can... 44 0.005
gi|33329250|gb|AAQ10025.1| putative esophageal gland cell secret... 44 0.005
gi|24711753|gb|AAN62757.1| larval allergen [Brugia malayi] 44 0.005
gi|2894106|emb|CAB01633.1| Collagen alpha1 [Rattus norvegicus] 44 0.005
gi|27688933|ref|XP_213440.1| similar to Collagen alpha1 [Rattus ... 44 0.005
gi|30794342|ref|NP_851369.1| surfactant, pulmonary-associated pr... 44 0.005
gi|29570599|emb|CAD69922.1| surfactant protein D [Bos taurus] 44 0.005
gi|3288491|emb|CAA75877.1| COL1A1 and PDGFB fusion transcript [H... 44 0.005
gi|23613218|ref|NP_703540.1| hypothetical protein [Plasmodium fa... 44 0.005
gi|2119161|pir||I50696 collagen alpha 1(III) chain - chicken (fr... 44 0.005
gi|50746907|ref|XP_420670.1| PREDICTED: similar to Centromeric p... 44 0.005
gi|20380052|gb|AAH28178.1| COL3A1 protein [Homo sapiens] 44 0.005
gi|23508760|ref|NP_701428.1| hypothetical protein [Plasmodium fa... 44 0.005
gi|46981263|gb|AAT07581.1| putative SMC protein [Oryza sativa (j... 44 0.006
gi|11358993|pir||A59292 probable type II myosin heavy chain - sl... 44 0.006
gi|4379341|emb|CAA08789.1| fibrillar collagen [Podocoryne carnea] 44 0.006
gi|16805171|ref|NP_473199.1| hypothetical protein [Plasmodium fa... 44 0.006
gi|28829349|gb|AAO51891.1| similar to C33G8.2.p [Caenorhabditis ... 44 0.006
gi|47551001|ref|NP_999674.1| alpha-1 collagen [Strongylocentrotu... 44 0.006
gi|38090084|ref|XP_356186.1| RIKEN cDNA B930007L02 gene [Mus mus... 44 0.006
gi|930045|emb|CAA33387.1| alpha-1 (III) collagen [Homo sapiens] 44 0.006
gi|27806257|ref|NP_776945.1| collagen, type I, alpha 2 [Bos taur... 44 0.006
gi|23957728|ref|NP_473185.2| hypothetical protein, conserved [Pl... 44 0.006
gi|23508433|ref|NP_701102.1| asparagine-rich protein [Plasmodium... 44 0.006
gi|48096535|ref|XP_394707.1| similar to M-phase phosphoprotein 1... 44 0.006
gi|46442495|gb|EAL01784.1| hypothetical protein CaO19.4312 [Cand... 44 0.006
gi|630905|pir||S42731 collagen alpha 1 chain - sea urchin (Hemic... 44 0.006
gi|13325096|gb|AAB30065.2| fibrillar collagen alpha 120 and 140 ... 44 0.006
gi|31982388|ref|NP_783630.2| conglutinin 1 [Bos taurus] >gnl|BL_... 44 0.006
gi|461774|sp|P23805|CONG_BOVIN Conglutinin precursor >gnl|BL_ORD... 44 0.006
gi|50355694|ref|NP_001002237.1| collectin-43 [Bos taurus] >gnl|B... 44 0.006
gi|395268|emb|CAA50665.1| conglutinin [Bos taurus] 44 0.006
gi|23481834|gb|EAA17992.1| probable RNA 3'-terminal phosphate cy... 44 0.006
gi|3242649|dbj|BAA29028.1| alpha 1 type I collagen [Rana catesbe... 44 0.006
gi|26325342|dbj|BAC26425.1| unnamed protein product [Mus musculus] 44 0.006
gi|30354436|gb|AAH52161.1| Procollagen, type XI, alpha 1 [Mus mu... 43 0.008
gi|6680958|ref|NP_031755.1| procollagen, type XI, alpha 1; pro-a... 43 0.008
gi|30023|emb|CAA68709.1| unnamed protein product [Homo sapiens] 43 0.008
gi|2388555|gb|AAB69977.1| alpha2(I) collagen [Homo sapiens] 43 0.008
gi|3172000|emb|CAA06511.1| collagen alpha 1 (XI) [Rattus norvegi... 43 0.008
gi|20066260|gb|AAM09367.1| similar to Dictyostelium discoideum (... 43 0.008
gi|17541194|ref|NP_499905.1| COLlagen structural gene (col-101) ... 43 0.008
gi|23612443|ref|NP_704004.1| hypothetical protein [Plasmodium fa... 43 0.008
gi|11036458|gb|AAG27134.1| HIV-1 Vpr-binding protein [Homo sapiens] 43 0.008
gi|50548039|ref|XP_501489.1| hypothetical protein [Yarrowia lipo... 43 0.008
gi|39585160|emb|CAE57403.1| Hypothetical protein CBG00356 [Caeno... 43 0.008
gi|40788369|dbj|BAA34520.2| KIAA0800 protein [Homo sapiens] 43 0.008
gi|23509944|ref|NP_702611.1| hypothetical protein [Plasmodium fa... 43 0.008
gi|41393113|ref|NP_958886.1| collagen, type I, alpha 3 [Danio re... 43 0.008
gi|42542708|gb|AAH66384.1| Collagen, type I, alpha 3 [Danio rerio] 43 0.008
gi|42656737|ref|XP_376232.1| Vpr-binding protein [Homo sapiens] ... 43 0.008
gi|7662316|ref|NP_055518.1| Vpr-binding protein [Homo sapiens] 43 0.008
gi|49258206|ref|NP_001001856.1| collectin 46 [Bos taurus] >gnl|B... 43 0.008
gi|10947027|gb|AAC62178.2| type IIA procollagen [Canis familiaris] 43 0.008
gi|27734646|sp||P02454_1 [Segment 1 of 2] Collagen alpha 1(I) chain 43 0.008
gi|1070605|pir||CGHU2S collagen alpha 2(I) chain precursor - human 43 0.008
gi|1418930|emb|CAA98969.1| prepro-alpha2(I) collagen [Homo sapiens] 43 0.008
gi|32451581|gb|AAH54498.1| Alpha 2 type I collagen [Homo sapiens... 43 0.008
gi|2735715|gb|AAB93981.1| pro-alpha 2(I) collagen [Homo sapiens] 43 0.008
gi|179596|gb|AAB59374.1| pre-pro-alpha-2 type I collagen [Homo s... 43 0.008
gi|48762934|ref|NP_000080.2| alpha 2 type I collagen; Collagen I... 43 0.008
gi|19855162|sp|P08123|CA21_HUMAN Collagen alpha 2(I) chain precu... 43 0.008
gi|7512691|pir||T12529 hypothetical protein DKFZp434P113.1 - hum... 43 0.008
gi|34859869|ref|XP_342327.1| procollagen type XI alpha 1 [Rattus... 43 0.008
gi|71403|pir||CGRT1S collagen alpha 1(I) chain - rat (tentative ... 43 0.008
gi|552001|gb|AAA99987.1| [Streptococcus pyogenes DNA sequence, o... 43 0.008
gi|23508771|ref|NP_701439.1| hypothetical protein [Plasmodium fa... 43 0.008
gi|48771947|ref|ZP_00276289.1| hypothetical protein Reut02000697... 43 0.010
gi|86224|pir||A05269 collagen alpha 1(III) chain precursor - chi... 43 0.010
gi|41688505|sp|Q90584|CA1G_CHICK Collagen alpha 1(XVII) chain (B... 43 0.010
gi|115290|sp|P04258|CA13_BOVIN Collagen alpha 1(III) chain >gnl|... 43 0.010
gi|23486696|gb|EAA20872.1| hypothetical protein [Plasmodium yoel... 43 0.010
gi|21431496|sp||P12105_1 [Segment 1 of 3] Collagen alpha 1(III) ... 43 0.010
gi|28850332|gb|AAM08494.2| similar to Mus musculus (Mouse). GABA... 43 0.010
gi|3645944|gb|AAC60380.1| yotiao [Homo sapiens] 43 0.010
gi|7513208|pir||T08880 NMDA receptor-binding protein yotiao - hu... 43 0.010
gi|29387355|gb|AAH48221.1| COL2A1 protein [Xenopus laevis] 43 0.010
gi|214042|gb|AAA49678.1| alpha-1 type II collagen 43 0.010
gi|104010|pir||B40333 collagen alpha 1(II) chain precursor - Afr... 43 0.010
gi|50750043|ref|XP_421847.1| PREDICTED: similar to [Segment 3 of... 43 0.010
gi|22538389|ref|NP_671695.1| A-kinase anchor protein 9 isoform 4... 43 0.010
gi|50749759|ref|XP_421744.1| PREDICTED: similar to novel collage... 43 0.010
gi|423283|pir||S33603 surfactant protein D - bovine 43 0.010
gi|39597669|emb|CAE68360.1| Hypothetical protein CBG14099 [Caeno... 43 0.010
gi|9453839|dbj|BAB03273.1| myosin [Chara corallina] 43 0.010
gi|49481187|ref|YP_039199.1| spermidine synthase [Bacillus thuri... 43 0.010
gi|22538393|ref|NP_671714.1| A-kinase anchor protein 9 isoform 3... 43 0.010
gi|5051743|dbj|BAA78718.1| Centrosome- and Golgi-localized PKN-a... 43 0.010
gi|38173761|gb|AAH60753.1| MGC69046 protein [Xenopus laevis] 43 0.010
gi|841122|gb|AAA67751.1| putative collagen alpha-2 (XI) chain [M... 43 0.010
gi|6472600|dbj|BAA87057.1| unconventional myosin heavy chain [Ch... 43 0.010
gi|22538391|ref|NP_671700.1| A-kinase anchor protein 9 isoform 1... 43 0.010
gi|28828396|gb|AAO51028.1| similar to Dictyostelium discoideum (... 43 0.010
gi|15292565|gb|AAK93551.1| SD07741p [Drosophila melanogaster] 43 0.010
gi|17385617|emb|CAD12628.1| involucrin [Sus scrofa] 43 0.010
gi|22538387|ref|NP_005742.4| A-kinase anchor protein 9 isoform 2... 43 0.010
gi|17508599|ref|NP_492171.1| AdaPTin or adaptin-related protein ... 43 0.010
gi|38570069|gb|AAR24536.1| chihuahua [Danio rerio] 43 0.010
gi|38649122|gb|AAH63249.1| Col1a1 protein [Danio rerio] 43 0.010
gi|8134352|sp|O46392|CA21_CANFA Collagen alpha 2(I) chain precur... 43 0.010
gi|4584423|emb|CAB40713.1| AKAP450 protein [Homo sapiens] 43 0.010
gi|15232767|ref|NP_190311.1| hypothetical protein [Arabidopsis t... 43 0.010
gi|50745970|ref|XP_420320.1| PREDICTED: similar to alpha 5 type ... 43 0.010
gi|17508597|ref|NP_492170.1| AdaPTin or adaptin-related protein ... 43 0.010
gi|28172191|emb|CAD62259.1| bM340H1.1 (novel collagen triple hel... 42 0.013
gi|50754535|ref|XP_425157.1| PREDICTED: similar to type VII coll... 42 0.013
gi|6680978|ref|NP_031767.1| procollagen, type IX, alpha 2 [Mus m... 42 0.013
gi|20988703|gb|AAH29697.1| Procollagen, type IX, alpha 2 [Mus mu... 42 0.013
gi|23613492|ref|NP_703336.1| P. falciparum RESA-like protein wit... 42 0.013
gi|28830050|gb|AAO52540.1| similar to Entamoeba histolytica. Myo... 42 0.013
gi|23613862|ref|NP_704883.1| vesicle transport protein, putative... 42 0.013
gi|38454234|ref|NP_942042.1| collagen, type XXVII, alpha 1; coll... 42 0.013
gi|37589348|gb|AAH59289.1| LOC398739 protein [Xenopus laevis] 42 0.013
gi|30851190|gb|AAH52575.1| Collagen, type VI, alpha 1, precursor... 42 0.013
gi|115436|sp|P18856|CAF1_EPHMU Collagen EMF1-alpha precursor (Fi... 42 0.013
gi|23612722|ref|NP_704261.1| hypothetical protein [Plasmodium fa... 42 0.013
gi|13929148|ref|NP_113997.1| cyclic nucleotide-gated channel bet... 42 0.013
gi|23491066|gb|EAA22695.1| hypothetical protein [Plasmodium yoel... 42 0.013
gi|23509448|ref|NP_702115.1| hypothetical protein [Plasmodium fa... 42 0.013
gi|283871|pir||S23296 collagen alpha 2(IX) chain precursor - chi... 42 0.013
gi|30689268|ref|NP_173925.3| phytochrome and flowering time regu... 42 0.013
gi|23508608|ref|NP_701277.1| hypothetical protein [Plasmodium fa... 42 0.013
gi|558073|gb|AAC47832.1| polymorphic antigen [Plasmodium falcipa... 42 0.013
gi|23485010|gb|EAA20150.1| hypothetical protein [Plasmodium yoel... 42 0.013
gi|50405040|ref|YP_054132.1| hypothetical protein PTMB.204c [Par... 42 0.013
gi|33329236|gb|AAQ10018.1| putative esophageal gland cell secret... 42 0.013
gi|39579438|emb|CAE56766.1| Hypothetical protein CBG24569 [Caeno... 42 0.013
gi|4558862|gb|AAD22767.1| A-kinase anchoring protein AKAP350 [Ho... 42 0.013
gi|20386036|gb|AAM21558.1| MEK1 interacting protein 1 [Dictyoste... 42 0.013
gi|47220201|emb|CAF98966.1| unnamed protein product [Tetraodon n... 42 0.013
gi|39585781|emb|CAE59983.1| Hypothetical protein CBG03475 [Caeno... 42 0.013
gi|50511151|dbj|BAD32561.1| mKIAA1870 protein [Mus musculus] 42 0.013
gi|45767838|gb|AAH67716.1| Unknown (protein for IMAGE:6965582) [... 42 0.013
gi|37202117|ref|NP_079961.2| procollagen, type XXVII, alpha 1 [M... 42 0.013
gi|17539404|ref|NP_503048.1| COLlagen structural gene (28.0 kD) ... 42 0.013
gi|23613490|ref|NP_703334.1| hypothetical protein [Plasmodium fa... 42 0.013
gi|23509422|ref|NP_702089.1| hypothetical protein [Plasmodium fa... 42 0.013
gi|263810|gb|AAB24972.1| collagen alpha chain [Riftia pachyptila... 42 0.013
gi|399170|sp|P30754|CAFF_RIFPA Fibril-forming collagen alpha chain 42 0.013
gi|2119156|pir||S28774 collagen alpha chain - tube worm (Riftia ... 42 0.013
gi|48098605|ref|XP_392096.1| similar to CG16858-PA [Apis mellifera] 42 0.013
gi|25518714|pir||G86385 hypothetical protein F2J7.4 [imported] -... 42 0.013
gi|159004|gb|AAA29119.1| alpha collagen 42 0.013
gi|450048|prf||1920343A fibrillar collagen 42 0.013
gi|41203898|ref|XP_372522.1| similar to Plasmodium falciparum tr... 42 0.013
gi|50424679|ref|XP_460929.1| unnamed protein product [Debaryomyc... 42 0.017
gi|39579269|emb|CAE56956.1| Hypothetical protein CBG24806 [Caeno... 42 0.017
gi|8134354|sp|Q9XSJ7|CA11_CANFA Collagen alpha 1(I) chain precur... 42 0.017
gi|39586237|emb|CAE66648.1| Hypothetical protein CBG11985 [Caeno... 42 0.017
gi|17559060|ref|NP_505677.1| COLlagen structural gene (col-13) [... 42 0.017
gi|17559058|ref|NP_505678.1| COLlagen structural gene (30.1 kD) ... 42 0.017
gi|115399|sp|P16252|CAC2_HAECO Cuticle collagen 2C >gnl|BL_ORD_I... 42 0.017
gi|321007|pir||B44984 collagen - nematode (Haemonchus contortus)... 42 0.017
gi|45383788|ref|NP_989495.1| collagen, type XVIII, alpha 1 [Gall... 42 0.017
gi|48140714|ref|XP_393523.1| similar to ENSANGP00000019179 [Apis... 42 0.017
gi|115328|sp|P20909|CA1B_RAT COLLAGEN ALPHA 1(XI) CHAIN >gnl|BL_... 42 0.017
gi|32140760|ref|NP_116277.2| collagen, type XXVII, alpha 1 [Homo... 42 0.017
gi|50728154|ref|XP_416008.1| PREDICTED: similar to ankyrin repea... 42 0.017
gi|28317085|gb|AAO39561.1| LP07855p [Drosophila melanogaster] 42 0.017
gi|2506305|sp|P11087|CA11_MOUSE Collagen alpha 1(I) chain precur... 42 0.017
gi|24655483|ref|NP_728652.1| CG7971-PC [Drosophila melanogaster]... 42 0.017
gi|34328108|ref|NP_031768.2| procollagen, type I, alpha 1 [Mus m... 42 0.017
gi|48762667|ref|NP_892013.2| collagen, type I, alpha 2 [Danio re... 42 0.017
gi|15209312|emb|CAC51030.1| procollagen type I alpha 2 chain [Da... 42 0.017
gi|30016|emb|CAA30731.1| unnamed protein product [Homo sapiens] ... 42 0.017
gi|46437420|gb|EAK96767.1| hypothetical protein CaO19.2850 [Cand... 42 0.017
gi|1888409|emb|CAA67261.1| collagen type I alpha 1 [Homo sapiens] 42 0.017
gi|21450271|ref|NP_659141.1| nuclear receptor coactivator 5 [Mus... 42 0.017
gi|47213964|emb|CAF94062.1| unnamed protein product [Tetraodon n... 42 0.017
gi|4502945|ref|NP_000079.1| alpha 1 type I collagen preproprotei... 42 0.017
gi|2144803|pir||CGHU1S collagen alpha 1(I) chain precursor - human 42 0.017
gi|22328092|gb|AAH36531.1| Alpha 1 type I collagen, preproprotei... 42 0.017
gi|4755085|gb|AAB94054.2| pro alpha 1(I) collagen [Homo sapiens] 42 0.017
gi|15292193|gb|AAK93365.1| LD41932p [Drosophila melanogaster] 42 0.017
gi|24954545|gb|AAN64674.1| M protein [Streptococcus pyogenes] 42 0.017
gi|115269|sp|P02452|CA11_HUMAN Collagen alpha 1(I) chain precursor 42 0.017
gi|630472|pir||A54138 acidic repetitive protein arp1 - Tetrahyme... 42 0.017
gi|24655488|ref|NP_647642.2| CG7971-PA [Drosophila melanogaster]... 42 0.017
gi|18157524|dbj|BAB83839.1| collagen type XI alpha 2~partially s... 42 0.017
gi|24647474|ref|NP_650558.1| CG14889-PA [Drosophila melanogaster... 42 0.017
gi|17535253|ref|NP_495759.1| COLlagen structural gene (29.4 kD) ... 42 0.017
gi|7335658|gb|AAC27083.2| M protein [Streptococcus pyogenes] 42 0.017
gi|11096147|gb|AAG30213.1| collagen-like surface protein [Strept... 42 0.017
gi|124736|sp|P14708|INVO_PONPY Involucrin >gnl|BL_ORD_ID|1318093... 42 0.017
gi|37589303|gb|AAH59281.1| Col1a1 protein [Mus musculus] 42 0.017
gi|34852376|ref|XP_215375.2| similar to collagen alpha1 type VI-... 42 0.017
gi|13182888|gb|AAK14972.1| collagen type I alpha 1 [Macaca mulatta] 42 0.017
gi|24641414|ref|NP_572750.2| CG32662-PA [Drosophila melanogaster... 42 0.017
gi|34851186|ref|XP_346518.1| hypothetical protein XP_346517 [Rat... 42 0.017
gi|4140029|dbj|BAA36973.1| alpha 1 type I collagen [Cynops pyrrh... 42 0.017
gi|27476088|gb|AAO17019.1| Hypothetical protein [Oryza sativa (j... 42 0.017
gi|179594|gb|AAB59373.1| alpha-1 type I collagen 42 0.017
gi|28828426|gb|AAL96730.2| similar to Dictyostelium discoideum (... 42 0.017
gi|14017957|dbj|BAB47499.1| KIAA1870 protein [Homo sapiens] 42 0.017
gi|6325002|ref|NP_015070.1| Protein that forms a complex with Ka... 42 0.017
gi|16198129|gb|AAL13867.1| LD33732p [Drosophila melanogaster] 42 0.017
gi|50730849|ref|XP_417045.1| PREDICTED: similar to KIAA0853 prot... 42 0.017
gi|24655493|ref|NP_728653.1| CG7971-PB [Drosophila melanogaster]... 42 0.017
gi|39592202|emb|CAE75423.1| Hypothetical protein CBG23416 [Caeno... 42 0.017
gi|23507999|ref|NP_700669.1| hypothetical protein [Plasmodium fa... 42 0.023
gi|45361285|ref|NP_989220.1| hypothetical protein MGC75588 [Xeno... 42 0.023
gi|49898946|gb|AAH76669.1| MGC76284 protein [Xenopus tropicalis] 42 0.023
gi|47228931|emb|CAG09446.1| unnamed protein product [Tetraodon n... 42 0.023
gi|17510331|ref|NP_491088.1| COLlagen structural gene (col-48) [... 42 0.023
gi|1657698|gb|AAC52049.1| hyaluronan receptor [Homo sapiens] 42 0.023
gi|37360452|dbj|BAC98204.1| mKIAA1565 protein [Mus musculus] 42 0.023
gi|21434789|gb|AAL14257.1| type XVIII collagen short variant [Xe... 42 0.023
gi|17566500|ref|NP_507918.1| protein tyrosine phosphatase family... 42 0.023
gi|23509548|ref|NP_702215.1| hypothetical protein [Plasmodium fa... 42 0.023
gi|115268|sp|P02457|CA11_CHICK Collagen alpha 1(I) chain precursor 42 0.023
gi|48104621|ref|XP_392960.1| similar to alpha 1 type IX collagen... 42 0.023
gi|17558380|ref|NP_504774.1| putative nuclear protein, with a co... 42 0.023
gi|32404256|ref|XP_322741.1| DYNACTIN, 150 KD ISOFORM (150 KD DY... 42 0.023
gi|7271901|gb|AAF44681.1| collagen IV a1 chain [Gallus gallus] 42 0.023
gi|7493975|pir||T18364 ro-3 protein - Neurospora crassa >gnl|BL_... 42 0.023
gi|23508404|ref|NP_701073.1| hypothetical protein [Plasmodium fa... 42 0.023
gi|11096151|gb|AAG30215.1| collagen-like surface protein [Strept... 42 0.023
gi|50400728|sp|Q61043|NIN_MOUSE Ninein 42 0.023
gi|39596361|emb|CAE69999.1| Hypothetical protein CBG16406 [Caeno... 42 0.023
gi|19075870|ref|NP_588370.1| hypothetical coiled-coil protein [S... 42 0.023
gi|45361317|ref|NP_989236.1| hypothetical protein MGC76284 [Xeno... 42 0.023
gi|71405|pir||CGCH1S collagen alpha 1(I) chain - chicken (tentat... 42 0.023
gi|17566482|ref|NP_507901.1| plasmodium falciparum trophozoite a... 42 0.023
gi|23612979|ref|NP_704518.1| hypothetical protein [Plasmodium fa... 42 0.023
gi|14164347|dbj|BAB55661.1| collagen a1(I) [Oncorhynchus mykiss] 42 0.023
gi|1828|emb|CAA35992.1| trichohyalin [Ovis sp.] 42 0.023
gi|29436389|gb|AAH49829.1| Col1a1-prov protein [Xenopus laevis] 42 0.023
gi|23488370|gb|EAA21291.1| hypothetical protein [Plasmodium yoel... 42 0.023
gi|6679062|ref|NP_032723.1| ninein [Mus musculus] >gnl|BL_ORD_ID... 42 0.023
gi|23612152|ref|NP_703732.1| translation initiation factor IF-2,... 42 0.023
gi|17537301|ref|NP_494562.1| COLlagen structural gene (37.0 kD) ... 42 0.023
gi|460246|gb|AAC46611.1| a2 (IV) basement membrane collagen 42 0.023
gi|7670050|dbj|BAA94972.1| type I collagen alpha 1 [Xenopus laevis] 42 0.023
gi|47125402|gb|AAH70281.1| HMMR protein [Homo sapiens] 42 0.023
gi|46118844|ref|ZP_00175702.2| COG1196: Chromosome segregation A... 42 0.023
gi|29466785|dbj|BAC66859.1| heat shock protein GrpE [Lactobacill... 42 0.023
gi|50730534|ref|XP_416951.1| PREDICTED: similar to collagen IV a... 42 0.023
gi|34875810|ref|XP_343564.1| procollagen, type III, alpha 1 [Rat... 41 0.030
gi|23509848|ref|NP_702515.1| dynein beta chain, putative [Plasmo... 41 0.030
gi|39595524|emb|CAE60562.1| Hypothetical protein CBG04191 [Caeno... 41 0.030
gi|85719|pir||A40333 collagen alpha 1'(II) chain precursor - Afr... 41 0.030
gi|23486663|gb|EAA20861.1| strong similarity to unknown protein-... 41 0.030
gi|47213961|emb|CAF94059.1| unnamed protein product [Tetraodon n... 41 0.030
gi|46048885|ref|NP_990121.1| alpha 1 (V) collagen [Gallus gallus... 41 0.030
gi|1083016|pir||A24450 collagen alpha 2(VIII) chain - bovine (fr... 41 0.030
gi|46437637|gb|EAK96980.1| hypothetical protein CaO19.9753 [Cand... 41 0.030
gi|2135413|pir||JC5016 hyaluronan receptor - human 41 0.030
gi|11384448|pir||S02771 myosin heavy chain A [similarity] - Caen... 41 0.030
gi|47220812|emb|CAG00019.1| unnamed protein product [Tetraodon n... 41 0.030
gi|10180804|gb|AAG14291.1| glutamic acid-rich protein [Plasmodiu... 41 0.030
gi|23508577|ref|NP_701246.1| hypothetical protein [Plasmodium fa... 41 0.030
gi|47219686|emb|CAG12608.1| unnamed protein product [Tetraodon n... 41 0.030
gi|7532790|gb|AAF63232.1| ORF-401-like protein [prophage P-EibA] 41 0.030
gi|11120710|ref|NP_068528.1| collagen, type V, alpha 3; procolla... 41 0.030
gi|45383309|ref|NP_989757.1| alpha 1 type IIA collagen precursor... 41 0.030
gi|50759792|ref|XP_417784.1| PREDICTED: similar to PTB-associate... 41 0.030
gi|6688939|emb|CAB65345.1| PR7 protein [Plasmodium falciparum] 41 0.030
gi|23508155|ref|NP_700825.1| hypothetical protein [Plasmodium fa... 41 0.030
gi|23613112|ref|NP_703434.1| hypothetical protein [Plasmodium fa... 41 0.030
gi|23112832|ref|ZP_00098266.1| COG3468: Type V secretory pathway... 41 0.030
gi|31340542|gb|AAO33039.2| alpha 1 type II procollagen [Gallus g... 41 0.030
gi|18676606|dbj|BAB84955.1| FLJ00201 protein [Homo sapiens] 41 0.030
gi|1334716|emb|CAA25398.1| collagen [Gallus gallus] 41 0.030
gi|38343901|emb|CAE51956.2| M protein [Streptococcus pyogenes] 41 0.030
gi|17542184|ref|NP_501700.1| COLlagen structural gene (29.4 kD) ... 41 0.030
gi|32964830|ref|NP_005193.1| collagen, type VIII, alpha 2; colla... 41 0.030
gi|7108351|ref|NP_036617.1| hyaluronan-mediated motility recepto... 41 0.030
gi|9631239|ref|NP_048021.1| orf 48 [Ateline herpesvirus 3] >gnl|... 41 0.030
gi|50757087|ref|XP_429250.1| PREDICTED: hypothetical protein XP_... 41 0.030
gi|39579304|emb|CAE56323.1| Hypothetical protein CBG23988 [Caeno... 41 0.030
gi|7656989|ref|NP_056534.1| collagen, type V, alpha 3 preproprot... 41 0.030
gi|34866357|ref|XP_238554.2| similar to type VII collagen [Rattu... 41 0.030
gi|27924402|gb|AAH44962.1| LOC397739 protein [Xenopus laevis] 41 0.030
gi|214044|gb|AAA49679.1| alpha-1 type II' collagen 41 0.030
gi|50744820|ref|XP_419890.1| PREDICTED: similar to collagen alph... 41 0.030
gi|7108349|ref|NP_036616.1| hyaluronan-mediated motility recepto... 41 0.030
gi|6048422|gb|AAF02223.1| surfactant protein A [Macaca mulatta] 41 0.030
gi|32566139|ref|NP_506065.2| MYOsin heavy chain structural gene,... 41 0.030
gi|34783674|gb|AAH57235.1| HMMR protein [Homo sapiens] 41 0.030
gi|42734064|gb|AAS38936.1| similar to Plasmodium falciparum (iso... 41 0.030
gi|17559154|ref|NP_505981.1| COLlagen structural gene (33.2 kD) ... 41 0.030
gi|17540078|ref|NP_500607.1| COLlagen structural gene (col-111) ... 41 0.030
gi|47229302|emb|CAG04054.1| unnamed protein product [Tetraodon n... 41 0.030
gi|50405018|ref|YP_054110.1| hypothetical protein with coiled-co... 41 0.039
gi|39594827|emb|CAE70695.1| Hypothetical protein CBG17418 [Caeno... 41 0.039
gi|34865500|ref|XP_345960.1| similar to hypothetical protein [Ra... 41 0.039
gi|11384452|pir||S05697 myosin heavy chain C [similarity] - Caen... 41 0.039
gi|17533115|ref|NP_494880.1| COLlagen structural gene (col-73) [... 41 0.039
gi|34860979|ref|XP_342600.1| similar to alpha-3 type IX collagen... 41 0.039
gi|586120|sp|Q07283|TRHY_HUMAN Trichohyalin >gnl|BL_ORD_ID|13043... 41 0.039
gi|19745166|ref|NP_604447.1| collagen, type V, alpha 1 [Rattus n... 41 0.039
gi|156396|gb|AAA28122.1| myosin II 41 0.039
gi|13624305|ref|NP_112440.1| procollagen, type II, alpha 1; disp... 41 0.039
gi|200216|gb|AAA68102.1| pro-alpha-1 type II collagen 41 0.039
gi|34876989|ref|XP_343608.1| similar to alpha-3 type IV collagen... 41 0.039
>gi|17532625|ref|NP_495810.1| COLlagen structural gene (col-38)
[Caenorhabditis elegans]
gi|7504153|pir||T22637 hypothetical protein F54C9.4 -
Caenorhabditis elegans
gi|3947565|emb|CAA90250.1| C. elegans COL-38 protein (corresponding
sequence F54C9.4) [Caenorhabditis elegans]
Length = 287
Score = 335 bits (860), Expect = 6e-91
Identities = 188/287 (65%), Positives = 188/287 (65%)
Frame = -1
Query: 864 MSKYLVPVCASISLVAVFGALVAMHSIVVDIDTMREEIVTGVHDMKVMSDDAWNRMIGFT 685
MSKYLVPVCASISLVAVFGALVAMHSIVVDIDTMREEIVTGVHDMKVMSDDAWNRMIGFT
Sbjct: 1 MSKYLVPVCASISLVAVFGALVAMHSIVVDIDTMREEIVTGVHDMKVMSDDAWNRMIGFT 60
Query: 684 KPSLDSESRSAAFASVFRNKRSAYPSQCNCDANSQXXXXXXXXXXXXXXXXXXXXXXGDK 505
KPSLDSESRSAAFASVFRNKRSAYPSQCNCDANSQ GDK
Sbjct: 61 KPSLDSESRSAAFASVFRNKRSAYPSQCNCDANSQGCPPGPPGPPGLPGGRGDQGPSGDK 120
Query: 504 GRDGASGVSLAVTHHLXXXXXXXXXXXXGETGPDGDIGEPGFPGASGSAGQCGEDGAPGE 325
GRDGASGVSLAVTHHL GETGPDGDIGEPGFPGASGSAGQCGEDGAPGE
Sbjct: 121 GRDGASGVSLAVTHHLPGGCIQCPQGPPGETGPDGDIGEPGFPGASGSAGQCGEDGAPGE 180
Query: 324 AGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGEPGKNGDSXXXXX 145
AGI GEPGKNGDS
Sbjct: 181 AGITGEQGPQGEPGTEGSEGPTGQDGTIGGPGLPGQPGTPGWPGSQGEPGKNGDSGVDGE 240
Query: 144 XXXXXXXXXXXXXXXXXDNGQPGLPGKDGSIGPDANYCPCPARAKKH 4
DNGQPGLPGKDGSIGPDANYCPCPARAKKH
Sbjct: 241 QGPQGPQGPDGQPGRDADNGQPGLPGKDGSIGPDANYCPCPARAKKH 287