Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F54D5_4
(996 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17534355|ref|NP_496468.1| DNaJ domain (prokaryotic heat shock... 498 e-139
gi|39597250|emb|CAE59478.1| Hypothetical protein CBG02862 [Caeno... 454 e-126
gi|15240968|ref|NP_195759.1| DNAJ heat shock protein, putative [... 221 2e-56
gi|15235310|ref|NP_194577.1| DNAJ heat shock family protein [Ara... 219 6e-56
gi|15225377|ref|NP_179646.1| DNAJ heat shock family protein [Ara... 214 3e-54
gi|15218901|ref|NP_176181.1| DNAJ heat shock protein, putative [... 211 2e-53
gi|34811738|gb|AAQ82702.1| potyviral capsid protein interacting ... 210 4e-53
gi|15228294|ref|NP_190377.1| DNAJ heat shock protein, putative [... 207 2e-52
gi|6631085|ref|NP_008965.2| DnaJ (Hsp40) homolog, subfamily B, m... 206 5e-52
gi|41054271|ref|NP_956067.1| DnaJ (Hsp40) homolog, subfamily B, ... 206 9e-52
gi|50751414|ref|XP_422386.1| PREDICTED: similar to DnaJ (Hsp40) ... 204 2e-51
gi|34860961|ref|XP_215722.2| similar to DnaJ homolog subfamily B... 204 2e-51
gi|21313156|ref|NP_080202.1| DnaJ (Hsp40) homolog, subfamily B, ... 204 3e-51
gi|21593202|gb|AAM65151.1| putative heat-shock protein [Arabidop... 203 4e-51
gi|15218515|ref|NP_172506.1| DNAJ heat shock protein, putative [... 203 4e-51
gi|21312512|ref|NP_081563.1| DnaJ (Hsp40) homolog, subfamily B, ... 202 1e-50
gi|30421322|gb|AAP31274.1| DNAJ-1 [Drosophila mauritiana] 201 3e-50
gi|31199405|ref|XP_308650.1| ENSANGP00000011260 [Anopheles gambi... 200 4e-50
gi|30421332|gb|AAP31279.1| DNAJ-1 [Drosophila melanogaster] 200 5e-50
gi|24658555|ref|NP_523936.2| CG10578-PA [Drosophila melanogaster... 200 5e-50
gi|30421326|gb|AAP31276.1| DNAJ-1 [Drosophila simulans] >gnl|BL_... 199 6e-50
gi|30421318|gb|AAP31272.1| DNAJ-1 [Drosophila teissieri] 199 8e-50
gi|15082401|gb|AAH12115.1| DNAJB5 protein [Homo sapiens] 199 1e-49
gi|30421316|gb|AAP31271.1| DNAJ-1 [Drosophila erecta] 198 1e-49
gi|34867171|ref|XP_233767.2| similar to heat shock protein hsp40... 198 2e-49
gi|48095889|ref|XP_394545.1| similar to CG5001-PA [Apis mellifera] 198 2e-49
gi|9845259|ref|NP_063927.1| DnaJ (Hsp40) homolog, subfamily B, m... 198 2e-49
gi|18202150|sp|O75953|DJB5_HUMAN DnaJ homolog subfamily B member... 198 2e-49
gi|30421312|gb|AAP31269.1| DNAJ-1 [Drosophila mimetica] 197 2e-49
gi|47223894|emb|CAG06071.1| unnamed protein product [Tetraodon n... 197 2e-49
gi|50418455|gb|AAH77166.1| Unknown (protein for MGC:91922) [Dani... 197 3e-49
gi|3228367|gb|AAC23584.1| droj1 [Drosophila melanogaster] 197 4e-49
gi|30421320|gb|AAP31273.1| DNAJ-1 [Drosophila yakuba] 197 4e-49
gi|30421324|gb|AAP31275.1| DNAJ-1 [Drosophila sechellia] 196 5e-49
gi|30421314|gb|AAP31270.1| DNAJ-1 [Drosophila orena] 195 1e-48
gi|50415468|gb|AAH78100.1| Unknown (protein for MGC:83507) [Xeno... 194 3e-48
gi|49168458|emb|CAG38724.1| DNAJB1 [Homo sapiens] 194 3e-48
gi|5453690|ref|NP_006136.1| DnaJ (Hsp40) homolog, subfamily B, m... 194 3e-48
gi|50417181|gb|AAH77119.1| Unknown (protein for MGC:101068) [Dan... 191 2e-47
gi|47206629|emb|CAF95110.1| unnamed protein product [Tetraodon n... 191 2e-47
gi|9055242|ref|NP_061278.1| DnaJ (Hsp40) homolog, subfamily B, m... 191 3e-47
gi|24580827|ref|NP_608586.1| CG5001-PA [Drosophila melanogaster]... 190 4e-47
gi|280797|pir||S20062 heat shock protein dnaJ homolog - human 190 4e-47
gi|34851465|ref|XP_341664.1| similar to heat shock protein 40 [R... 190 4e-47
gi|30851|emb|CAA44287.1| homologue to E.coli DnaJ protein [Homo ... 190 5e-47
gi|41053046|dbj|BAD07976.1| putative heat shock protein 40 [Oryz... 187 2e-46
gi|21361413|ref|NP_036398.2| DnaJ (Hsp40) homolog, subfamily B, ... 187 2e-46
gi|19262995|dbj|BAB85846.1| heat shock protein 40 [Ciona intesti... 187 3e-46
gi|23613489|ref|NP_703333.1| protein with DNAJ domain, dnj1/sis1... 186 5e-46
gi|31236521|ref|XP_319428.1| ENSANGP00000014413 [Anopheles gambi... 184 2e-45
gi|50426829|ref|XP_462012.1| unnamed protein product [Debaryomyc... 184 2e-45
gi|47215424|emb|CAG01121.1| unnamed protein product [Tetraodon n... 184 2e-45
gi|7494093|pir||T30538 heat shock protein homolog dnaJ - Trypano... 182 1e-44
gi|7441927|pir||T09133 heat shock protein homolog DNAJ - Trypano... 181 2e-44
gi|13346428|gb|AAK19734.1| co-chaperone protein [Trypanosoma cruzi] 180 5e-44
gi|45184816|ref|NP_982534.1| AAL008Wp [Eremothecium gossypii] >g... 178 1e-43
gi|16805018|ref|NP_473047.1| heat shock 40 kDa protein, putative... 176 1e-42
gi|50254787|gb|EAL17532.1| hypothetical protein CNBM0990 [Crypto... 170 4e-41
gi|39204547|ref|NP_705842.2| testis spermatogenesis apoptosis-re... 167 5e-40
gi|6179940|gb|AAF05720.1| DnaJ-like protein [Nicotiana tabacum] 165 2e-39
gi|34904486|ref|NP_913590.1| putative heat shock protein 40 [Ory... 164 2e-39
gi|11863723|emb|CAC16088.2| DnaJ like protein [Lycopersicon escu... 164 3e-39
gi|48716890|dbj|BAD23586.1| putative DnaJ-like protein [Oryza sa... 164 4e-39
gi|29648322|ref|NP_705755.2| spermatogenesis apoptosis-related p... 163 5e-39
gi|34980327|gb|AAN32703.2| testis spermatogenesis apoptosis-rela... 163 5e-39
gi|27678482|ref|XP_218960.1| similar to Spermatogenesis apoptosi... 162 8e-39
gi|47222579|emb|CAG02944.1| unnamed protein product [Tetraodon n... 162 1e-38
gi|15231987|ref|NP_187503.1| DNAJ heat shock protein, putative [... 157 3e-37
gi|21618097|gb|AAM67147.1| putative heat shock protein [Arabidop... 157 3e-37
gi|46391158|gb|AAS90685.1| putative DnaJ [Oryza sativa (japonica... 157 5e-37
gi|34905276|ref|NP_913985.1| putative heat shock protein 40 [Ory... 157 5e-37
gi|50731385|ref|XP_417251.1| PREDICTED: similar to spermatogenes... 155 1e-36
gi|34811740|gb|AAQ82703.1| potyviral capsid protein interacting ... 154 2e-36
gi|50552988|ref|XP_503904.1| hypothetical protein [Yarrowia lipo... 152 9e-36
gi|7488735|pir||T09338 DnaJ-like protein MsJ1 - alfalfa >gnl|BL_... 152 1e-35
gi|15239455|ref|NP_197935.1| DNAJ heat shock protein, putative [... 151 3e-35
gi|1362225|pir||S55900 DNAJ-like protein homolog - fission yeast... 150 3e-35
gi|19075977|ref|NP_588477.1| psi protein [Schizosaccharomyces po... 150 3e-35
gi|34811736|gb|AAQ82701.1| potyviral capsid protein interacting ... 150 4e-35
gi|23613035|ref|NP_703357.1| heat shock protein, putative [Plasm... 145 1e-33
gi|18858081|ref|NP_572633.1| CG2887-PA [Drosophila melanogaster]... 145 2e-33
gi|15225376|ref|NP_179645.1| DNAJ chaperone C-terminal domain-co... 144 2e-33
gi|46434985|gb|EAK94377.1| hypothetical protein CaO19.3861 [Cand... 144 2e-33
gi|30693796|ref|NP_175080.2| DNAJ chaperone C-terminal domain-co... 144 4e-33
gi|25405159|pir||G96505 hypothetical protein T7O23.16 [imported]... 144 4e-33
gi|48117980|ref|XP_393200.1| similar to testis spermatogenesis a... 140 6e-32
gi|15220265|ref|NP_172571.1| DNAJ chaperone C-terminal domain-co... 137 3e-31
gi|32404842|ref|XP_323034.1| hypothetical protein ( (AL513467) r... 135 1e-30
gi|29250418|gb|EAA41912.1| GLP_39_30615_31604 [Giardia lamblia A... 134 2e-30
gi|23490827|gb|EAA22509.1| DnaJ C terminal region, putative [Pla... 134 4e-30
gi|40253343|dbj|BAD05275.1| putative DnaJ, heat shock protein hs... 130 5e-29
gi|7441928|pir||F71623 protein with DnaJ domain PFB0090c - malar... 130 6e-29
gi|23593261|ref|NP_472947.2| hypothetical protein, conserved [Pl... 130 6e-29
gi|11496255|ref|NP_067397.1| heat shock protein, DNAJ-like 4 [Mu... 128 2e-28
gi|34863417|ref|XP_217147.2| similar to mmDj4 [Rattus norvegicus] 128 2e-28
gi|42525193|ref|NP_970573.1| DnaJ protein [Bdellovibrio bacterio... 127 3e-28
gi|6324321|ref|NP_014391.1| HSP40 family chaperone; Sis1p [Sacch... 127 4e-28
gi|50306601|ref|XP_453274.1| unnamed protein product [Kluyveromy... 125 2e-27
gi|38111668|gb|EAA57211.1| hypothetical protein MG08180.4 [Magna... 124 3e-27
gi|9954877|pdb|1C3G|A Chain A, S. Cerevisiae Heat Shock Protein ... 124 3e-27
gi|50762236|ref|XP_424983.1| PREDICTED: similar to DnaJ homolog ... 122 1e-26
gi|46121509|ref|XP_385309.1| hypothetical protein FG05133.1 [Gib... 122 1e-26
gi|39593154|emb|CAE64623.1| Hypothetical protein CBG09381 [Caeno... 118 2e-25
gi|29840996|gb|AAP06009.1| similar to GenBank Accession Number Q... 118 2e-25
gi|17563890|ref|NP_504452.1| DNaJ domain (prokaryotic heat shock... 117 5e-25
gi|34907316|ref|NP_915005.1| putative heat shock protein [Oryza ... 115 1e-24
gi|49075818|ref|XP_401947.1| hypothetical protein UM04332.1 [Ust... 115 2e-24
gi|47210685|emb|CAG06349.1| unnamed protein product [Tetraodon n... 114 3e-24
gi|50289051|ref|XP_446955.1| unnamed protein product [Candida gl... 114 3e-24
gi|31236518|ref|XP_319427.1| ENSANGP00000023631 [Anopheles gambi... 113 6e-24
gi|49089298|ref|XP_406375.1| hypothetical protein AN2238.2 [Aspe... 113 6e-24
gi|34861654|ref|XP_227809.2| similar to DnaJ homolog subfamily B... 112 1e-23
gi|46391136|gb|AAS90663.1| putative DnaJ [Oryza sativa (japonica... 110 5e-23
gi|47226687|emb|CAG07846.1| unnamed protein product [Tetraodon n... 110 7e-23
gi|7512480|pir||G02272 heat shock protein hsp40 homolog - human ... 110 7e-23
gi|1943502|pdb|1HDJ| Human Hsp40 (Hdj-1), Nmr 107 3e-22
gi|24655623|ref|NP_647662.1| CG12020-PA [Drosophila melanogaster... 107 3e-22
gi|47086707|ref|NP_997830.1| DnaJ (Hsp40) homolog, subfamily A, ... 107 3e-22
gi|1169384|sp|P43644|DNJH_ATRNU DnaJ protein homolog ANJ1 >gnl|B... 107 6e-22
gi|34868995|ref|XP_233053.2| similar to DnaJ homolog subfamily B... 107 6e-22
gi|46439078|gb|EAK98400.1| hypothetical protein CaO19.506 [Candi... 106 7e-22
gi|46439171|gb|EAK98492.1| hypothetical protein CaO19.8136 [Cand... 106 7e-22
gi|10945669|gb|AAG24642.1| J1P [Daucus carota] >gnl|BL_ORD_ID|56... 106 9e-22
gi|461942|sp|Q03363|DNJ1_ALLPO DnaJ protein homolog 1 (DNAJ-1) >... 106 9e-22
gi|4008159|dbj|BAA35121.1| DnaJ homolog [Salix gilgiana] 106 9e-22
gi|7441930|pir||T07371 dnaJ protein homolog - potato >gnl|BL_ORD... 105 2e-21
gi|5802244|gb|AAD51625.1| seed maturation protein PM37 [Glycine ... 105 2e-21
gi|50355737|gb|AAT75262.1| putative DnaJ like protein [Oryza sa... 104 3e-21
gi|7595798|gb|AAF64454.1| DnaJ protein [Euphorbia esula] 104 4e-21
gi|1169382|sp|P42824|DNJ2_ALLPO DnaJ protein homolog 2 >gnl|BL_O... 104 4e-21
gi|47224128|emb|CAG13048.1| unnamed protein product [Tetraodon n... 103 5e-21
gi|29375878|ref|NP_815032.1| dnaJ protein [Enterococcus faecalis... 103 6e-21
gi|461944|sp|Q04960|DNJH_CUCSA DnaJ protein homolog (DNAJ-1) >gn... 103 6e-21
gi|50811832|ref|NP_998658.1| similar to DnaJ subfamily A member ... 103 6e-21
gi|15010708|gb|AAK74013.1| AT3g44110/F26G5_60 [Arabidopsis thali... 103 6e-21
gi|50310423|ref|XP_455231.1| unnamed protein product [Kluyveromy... 103 8e-21
gi|27151816|gb|AAN87055.1| tuber-induction protein [Solanum tube... 103 8e-21
gi|23465107|ref|NP_695710.1| chaperone protein similar to DnaJ [... 102 1e-20
gi|23483973|gb|EAA19462.1| DnaJ domain, putative [Plasmodium yoe... 102 2e-20
gi|15924569|ref|NP_372103.1| DnaJ protein [Staphylococcus aureus... 102 2e-20
gi|49483827|ref|YP_041051.1| chaperone protein [Staphylococcus a... 102 2e-20
gi|15229874|ref|NP_189997.1| DNAJ heat shock protein, putative (... 102 2e-20
gi|535588|gb|AAB86799.1| putative [Arabidopsis thaliana] >gnl|BL... 100 4e-20
gi|10304376|gb|AAG16227.1| heat shock 40kD protein 1 [Sus scrofa] 100 5e-20
gi|2129577|pir||S71199 dnaJ protein homolog atj3 - Arabidopsis t... 100 5e-20
gi|50554861|ref|XP_504839.1| hypothetical protein [Yarrowia lipo... 100 7e-20
gi|16079600|ref|NP_390424.1| heat-shock protein [Bacillus subtil... 100 7e-20
gi|421809|pir||S35581 dnaJ protein homolog DnaJ-1 - cucumber 100 7e-20
gi|46142067|ref|ZP_00147640.2| COG0484: DnaJ-class molecular cha... 100 7e-20
gi|48824061|ref|ZP_00285490.1| COG0484: DnaJ-class molecular cha... 100 9e-20
gi|48838226|ref|ZP_00295173.1| COG0484: DnaJ-class molecular cha... 100 9e-20
gi|4210948|gb|AAD12055.1| DnaJ protein [Hevea brasiliensis] 99 1e-19
gi|1169372|sp|P45555|DNAJ_STAAU Chaperone protein dnaJ (HSP40) >... 99 1e-19
gi|3152378|emb|CAA73791.1| DnaJ protein [Homo sapiens] 99 2e-19
gi|27468184|ref|NP_764821.1| DnaJ protein [Staphylococcus epider... 99 2e-19
gi|18420428|ref|NP_568412.1| DNAJ heat shock protein, putative [... 99 2e-19
gi|5031741|ref|NP_005871.1| DnaJ subfamily A member 2; cell cycl... 99 2e-19
gi|31324241|gb|AAP47195.1| testis spermatogenesis apoptosis-rela... 99 2e-19
gi|50752156|ref|XP_422682.1| PREDICTED: similar to DnaJ homolog ... 98 3e-19
gi|11132491|sp|Q9UXR9|DNAJ_METTE Chaperone protein dnaJ (Heat sh... 98 3e-19
gi|29367357|gb|AAO72551.1| DNAJ-like protein [Oryza sativa (japo... 98 3e-19
gi|23336118|ref|ZP_00121345.1| COG2214: DnaJ-class molecular cha... 98 3e-19
gi|23099422|ref|NP_692888.1| heat shock protein [Oceanobacillus ... 98 3e-19
gi|544177|sp|Q05646|DNAJ_ERYRH Chaperone protein dnaJ >gnl|BL_OR... 97 4e-19
gi|2494151|sp|Q45552|DNAJ_BACST Chaperone protein dnaJ >gnl|BL_O... 97 4e-19
gi|42783440|ref|NP_980687.1| chaperone protein dnaJ [Bacillus ce... 97 6e-19
gi|30264384|ref|NP_846761.1| chaperone protein dnaJ [Bacillus an... 97 6e-19
gi|30022392|ref|NP_834023.1| Chaperone protein dnaJ [Bacillus ce... 97 6e-19
gi|47569309|ref|ZP_00239993.1| dnaJ protein [Bacillus cereus G92... 97 6e-19
gi|9309334|dbj|BAB03216.1| dnaJ [Geobacillus thermoglucosidasius] 97 6e-19
gi|20805917|gb|AAM28895.1| DnaJ [Meiothermus ruber] 97 6e-19
gi|6782421|gb|AAF28382.1| DnaJ-like protein [Lycopersicon escule... 97 6e-19
gi|16800577|ref|NP_470845.1| heat shock protein DnaJ [Listeria i... 97 6e-19
gi|16803512|ref|NP_464997.1| heat shock protein DnaJ [Listeria m... 97 6e-19
gi|28302332|gb|AAH46660.1| MGC52928 protein [Xenopus laevis] 97 7e-19
gi|46907700|ref|YP_014089.1| chaperone protein DnaJ [Listeria mo... 97 7e-19
gi|9789937|ref|NP_062768.1| DnaJ (Hsp40) homolog, subfamily A, m... 97 7e-19
gi|27529856|dbj|BAC53943.1| DnaJ homolog [Nicotiana tabacum] 96 1e-18
gi|34541399|ref|NP_905878.1| dnaJ protein [Porphyromonas gingiva... 96 1e-18
gi|50753733|ref|XP_414110.1| PREDICTED: similar to DnaJ homolog ... 96 1e-18
gi|28422719|gb|AAH46954.1| MGC53478 protein [Xenopus laevis] 96 1e-18
gi|6324265|ref|NP_014335.1| yeast dnaJ homolog (nuclear envelope... 96 1e-18
gi|14091768|ref|NP_114468.1| DnaJ (Hsp40) homolog, subfamily A, ... 96 1e-18
gi|25296019|pir||G84611 probable DnaJ protein [imported] - Arabi... 96 1e-18
gi|18399949|ref|NP_565533.1| DNAJ heat shock family protein [Ara... 96 1e-18
gi|30794072|gb|AAP40480.1| putative DnaJ protein [Arabidopsis th... 96 1e-18
gi|21536561|gb|AAM60893.1| putative DnaJ protein [Arabidopsis th... 96 1e-18
gi|49250545|gb|AAH74569.1| Unknown (protein for MGC:69518) [Xeno... 96 1e-18
gi|14140154|emb|CAC39071.1| DnaJ-like protein [Oryza sativa] 96 1e-18
gi|49388562|dbj|BAD25681.1| putative DnaJ-like protein MsJ1 [Ory... 96 1e-18
gi|47220868|emb|CAG03075.1| unnamed protein product [Tetraodon n... 96 2e-18
gi|45187616|ref|NP_983839.1| ADL257Cp [Eremothecium gossypii] >g... 96 2e-18
gi|31222162|ref|XP_317136.1| ENSANGP00000018254 [Anopheles gambi... 96 2e-18
gi|7441932|pir||T01643 DnaJ protein homolog ZMDJ1 - maize >gnl|B... 96 2e-18
gi|25090177|sp|Q9LCQ4|DNAJ_BRECH Chaperone protein dnaJ >gnl|BL_... 96 2e-18
gi|144832|gb|AAA23247.1| dnaJ 95 2e-18
gi|48835289|ref|ZP_00292290.1| COG0484: DnaJ-class molecular cha... 95 2e-18
gi|15894565|ref|NP_347914.1| Molecular chaperones DnaJ (HSP40 fa... 95 2e-18
gi|18420568|ref|NP_568076.1| DNAJ heat shock family protein [Ara... 95 2e-18
gi|7441920|pir||T06102 heat shock protein T5J17.130, dnaJ-type -... 95 2e-18
gi|31544354|ref|NP_852932.1| DnaJ [Mycoplasma gallisepticum R] >... 95 3e-18
gi|21402360|ref|NP_658345.1| DnaJ_C, DnaJ C terminal region [Bac... 95 3e-18
gi|48847091|ref|ZP_00301349.1| COG2214: DnaJ-class molecular cha... 95 3e-18
gi|50086568|ref|YP_048078.1| heat shock protein (Hsp40), co-chap... 95 3e-18
gi|47459320|ref|YP_016182.1| heat shock protein DnaJ [Mycoplasma... 94 4e-18
gi|47222088|emb|CAG12114.1| unnamed protein product [Tetraodon n... 94 4e-18
gi|21205842|gb|AAM43823.1| DnaJ [Acholeplasma laidlawii] 94 4e-18
gi|32450159|gb|AAH53791.1| Dnaja2-prov protein [Xenopus laevis] 94 4e-18
gi|11132149|sp|O69269|DNAJ_BACSH Chaperone protein dnaJ >gnl|BL_... 94 4e-18
gi|50291421|ref|XP_448143.1| unnamed protein product [Candida gl... 94 5e-18
gi|26554350|ref|NP_758284.1| heat shock protein DnaJ [Mycoplasma... 94 5e-18
gi|48870606|ref|ZP_00323327.1| COG0484: DnaJ-class molecular cha... 94 5e-18
gi|45361185|ref|NP_989180.1| hypothetical protein MGC75796 [Xeno... 94 5e-18
gi|42526145|ref|NP_971243.1| chaperone protein DnaJ [Treponema d... 94 6e-18
gi|21228606|ref|NP_634528.1| Chaperone protein [Methanosarcina m... 94 6e-18
gi|31215420|ref|XP_316024.1| ENSANGP00000010793 [Anopheles gambi... 94 6e-18
gi|50728194|ref|XP_416026.1| PREDICTED: similar to microvascular... 93 8e-18
gi|38605843|emb|CAD41609.2| OSJNBb0034G17.1 [Oryza sativa (japon... 93 8e-18
gi|14582419|gb|AAK69493.1| heat shock protein DnaJ [Lactococcus ... 93 8e-18
gi|2731574|gb|AAC27389.1| DnaJ homolog [Babesia bovis] 93 8e-18
gi|21674304|ref|NP_662369.1| DnaJ protein [Chlorobium tepidum TL... 93 8e-18
gi|42543071|pdb|1NLT|A Chain A, The Crystal Structure Of Hsp40 Ydj1 93 1e-17
gi|50260032|gb|EAL22695.1| hypothetical protein CNBB1440 [Crypto... 93 1e-17
gi|22972332|ref|ZP_00019216.1| hypothetical protein [Chloroflexu... 93 1e-17
gi|421419|pir||A47079 heat shock protein dnaJ - Lactococcus lactis 93 1e-17
gi|15674206|ref|NP_268381.1| DnaJ [Lactococcus lactis subsp. lac... 93 1e-17
gi|49072108|ref|XP_400343.1| hypothetical protein UM02728.1 [Ust... 93 1e-17
gi|49523192|gb|AAH75137.1| Unknown (protein for MGC:81924) [Xeno... 93 1e-17
gi|15613911|ref|NP_242214.1| heat-shock protein (activation of D... 92 1e-17
gi|20090338|ref|NP_616413.1| heat shock protein 40 [Methanosarci... 92 1e-17
gi|18311014|ref|NP_562948.1| heat shock protein [Clostridium per... 92 1e-17
gi|34497100|ref|NP_901315.1| heat shock protein dnaJ; chaperone ... 92 1e-17
gi|24378607|ref|NP_720562.1| heat shock protein DnaJ (HSP-40) [S... 92 1e-17
gi|28422711|gb|AAH46936.1| Dnajb9-prov protein [Xenopus laevis] 92 2e-17
gi|39995125|ref|NP_951076.1| phage prohead protease, HK97 family... 92 2e-17
gi|46446102|ref|YP_007467.1| probable heat shock protein dnaJ [P... 92 2e-17
gi|21911066|ref|NP_665334.1| heat-shock (chaperone) protein [Str... 92 2e-17
gi|17547353|ref|NP_520755.1| PROBABLE CHAPERONE PROTEIN [Ralston... 92 2e-17
gi|15902500|ref|NP_358050.1| Heat-shock protein (activation of D... 92 2e-17
gi|10566912|dbj|BAB16032.1| Streptococcus pneumoniae DnaJ protei... 92 2e-17
gi|15900433|ref|NP_345037.1| dnaJ protein [Streptococcus pneumon... 92 2e-17
gi|50365232|ref|YP_053657.1| heat shock protein chaperone [Mesop... 92 2e-17
gi|15675605|ref|NP_269779.1| heat-shock (chaperone) protein [Str... 92 2e-17
gi|19746713|ref|NP_607849.1| heat-shock (chaperone) protein [Str... 92 2e-17
gi|34557617|ref|NP_907432.1| CO-CHAPERONE-CURVED DNA BINDING PRO... 92 2e-17
gi|48768621|ref|ZP_00272970.1| COG0484: DnaJ-class molecular cha... 92 2e-17
gi|1750265|gb|AAB39222.1| DnaJ [Streptococcus pneumoniae] 92 2e-17
gi|7706495|ref|NP_057390.1| DnaJ (Hsp40) homolog, subfamily B, m... 91 3e-17
gi|30584551|gb|AAP36528.1| Homo sapiens DnaJ (Hsp40) homolog, su... 91 3e-17
gi|41723704|ref|ZP_00150614.1| COG0484: DnaJ-class molecular cha... 91 3e-17
gi|45521649|ref|ZP_00173167.1| COG0484: DnaJ-class molecular cha... 91 3e-17
gi|3859851|gb|AAC72887.1| heat shock protein Ddj1 [Dictyostelium... 91 3e-17
gi|16331768|ref|NP_442496.1| DnaJ protein [Synechocystis sp. PCC... 91 4e-17
gi|15617956|ref|NP_224240.1| Heat Shock Protein J [Chlamydophila... 91 4e-17
gi|48146309|emb|CAG33377.1| DNAJB11 [Homo sapiens] 91 4e-17
gi|14579002|gb|AAK69110.1| PWP1-interacting protein 4 [Homo sapi... 91 4e-17
gi|11132184|sp|O87778|DNAJ_LACSK Chaperone protein dnaJ >gnl|BL_... 91 4e-17
gi|46228849|gb|EAK89719.1| DNAJ like chaperone [Cryptosporidium ... 91 4e-17
gi|49090814|ref|XP_406868.1| hypothetical protein AN2731.2 [Aspe... 91 4e-17
gi|31204407|ref|XP_311152.1| ENSANGP00000020449 [Anopheles gambi... 91 4e-17
gi|24654066|ref|NP_725541.1| CG8448-PA [Drosophila melanogaster]... 91 5e-17
gi|15792553|ref|NP_282376.1| putative curved-DNA binding protein... 91 5e-17
gi|39939189|ref|NP_950955.1| molecular chaperone DnaJ [Onion yel... 91 5e-17
gi|29466787|dbj|BAC66861.1| heat shock protein DnaJ [Lactobacill... 91 5e-17
gi|16273157|ref|NP_439394.1| heat shock protein [Haemophilus inf... 91 5e-17
gi|45531751|ref|ZP_00182781.1| COG0484: DnaJ-class molecular cha... 91 5e-17
gi|46226966|gb|EAK87932.1| DNAj domain protein having a signal p... 91 5e-17
gi|39584440|emb|CAE72578.1| Hypothetical protein CBG19766 [Caeno... 91 5e-17
gi|1169371|sp|P43735|DNAJ_HAEIN Chaperone protein dnaJ 91 5e-17
gi|2462052|emb|CAA72798.1| SIS1 protein [Cryptococcus curvatus] 91 5e-17
gi|21357547|ref|NP_650283.1| CG8863-PA [Drosophila melanogaster]... 91 5e-17
gi|44889076|sp|Q9NXW2|DJBC_HUMAN DnaJ homolog subfamily B member 12 90 7e-17
gi|7019854|dbj|BAA90896.1| unnamed protein product [Homo sapiens] 90 7e-17
gi|41054844|ref|NP_060096.2| DnaJ (Hsp40) homolog, subfamily B, ... 90 7e-17
gi|32401322|gb|AAP80833.1| DnaJ-like protein [Griffithsia japonica] 90 7e-17
gi|24668492|ref|NP_649380.1| CG7130-PA [Drosophila melanogaster]... 90 7e-17
gi|50752789|ref|XP_413746.1| PREDICTED: similar to pDJA1 chapero... 90 7e-17
gi|28211652|ref|NP_782596.1| chaperone protein dnaJ [Clostridium... 90 7e-17
gi|7441921|pir||T06594 heat shock protein dnaJ - garden pea >gnl... 90 7e-17
gi|45526679|ref|ZP_00177882.1| COG2214: DnaJ-class molecular cha... 90 9e-17
gi|23002899|ref|ZP_00046571.1| COG0484: DnaJ-class molecular cha... 90 9e-17
gi|42519350|ref|NP_965280.1| chaperone protein DnaJ [Lactobacill... 90 9e-17
gi|33944935|ref|XP_340615.1| DnaJ protein, putative [Trypanosoma... 90 9e-17
gi|46316148|ref|ZP_00216728.1| COG0484: DnaJ-class molecular cha... 90 9e-17
gi|39995145|ref|NP_951096.1| chaperone protein dnaJ [Geobacter s... 90 9e-17
gi|11132092|sp|O52065|DNAJ_PASHA Chaperone protein dnaJ >gnl|BL_... 90 9e-17
gi|48867977|ref|ZP_00321382.1| COG0484: DnaJ-class molecular cha... 89 1e-16
gi|29654430|ref|NP_820122.1| curved DNA-binding protein [Coxiell... 89 1e-16
gi|33151439|ref|NP_872792.1| chaperone protein DnaJ [Haemophilus... 89 1e-16
gi|10798648|emb|CAC12824.1| putative DNAJ protein [Nicotiana tab... 89 1e-16
gi|15277200|dbj|BAB63291.1| DnaJ [Tetragenococcus halophilus] 89 1e-16
gi|16326131|dbj|BAB70509.1| DNAJ homologue [Oryza sativa] 89 1e-16
gi|46320203|ref|ZP_00220595.1| COG0484: DnaJ-class molecular cha... 89 1e-16
gi|24216406|ref|NP_713887.1| Chaperone protein dnaJ [Leptospira ... 89 1e-16
gi|46133570|ref|ZP_00157396.2| COG0484: DnaJ-class molecular cha... 89 1e-16
gi|22536283|ref|NP_687134.1| dnaJ protein [Streptococcus agalact... 89 1e-16
gi|25010172|ref|NP_734567.1| Chaperone protein DnaJ [Streptococc... 89 1e-16
gi|2735762|gb|AAC35417.1| heat shock protein DnaJ [Leptospira in... 89 1e-16
gi|45513518|ref|ZP_00165084.1| COG0484: DnaJ-class molecular cha... 89 1e-16
gi|50425347|ref|XP_461267.1| unnamed protein product [Debaryomyc... 89 1e-16
gi|16082112|ref|NP_394547.1| heat shock protein DnaJ related pro... 89 1e-16
gi|18203395|sp|Q9QYI4|DJBC_MOUSE DnaJ homolog subfamily B member... 89 2e-16
gi|31982701|ref|NP_064349.2| DnaJ (Hsp40) homolog, subfamily B, ... 89 2e-16
gi|34852494|ref|XP_215417.2| similar to DnaJ (Hsp40) homolog, su... 89 2e-16
gi|50732259|ref|XP_418551.1| PREDICTED: similar to DnaJ (Hsp40) ... 89 2e-16
gi|7507879|pir||T24938 hypothetical protein T15H9.1 - Caenorhabd... 89 2e-16
gi|25296044|pir||G96831 hypothetical protein F18B13.12 [imported... 89 2e-16
gi|14326568|gb|AAK60328.1| At1g80030/F18B13_37 [Arabidopsis thal... 89 2e-16
gi|18412605|ref|NP_565227.1| DNAJ heat shock protein, putative [... 89 2e-16
gi|47223452|emb|CAG04313.1| unnamed protein product [Tetraodon n... 89 2e-16
gi|26349771|dbj|BAC38525.1| unnamed protein product [Mus musculus] 89 2e-16
gi|49093736|ref|XP_408329.1| hypothetical protein AN4192.2 [Aspe... 89 2e-16
gi|32414441|ref|XP_327700.1| hypothetical protein [Neurospora cr... 89 2e-16
gi|4885495|ref|NP_005485.1| DnaJ (Hsp40) homolog, subfamily B, m... 89 2e-16
gi|17388799|ref|NP_490647.1| DnaJ (Hsp40) homolog, subfamily B, ... 89 2e-16
gi|41471290|gb|AAS07393.1| unknown [Homo sapiens] 89 2e-16
gi|29833781|ref|NP_828415.1| putative heat shock protein DnaJ [S... 89 2e-16
gi|29840088|ref|NP_829194.1| dnaJ protein [Chlamydophila caviae ... 89 2e-16
gi|41053503|ref|NP_956599.1| hypothetical protein MGC56709 [Dani... 89 2e-16
gi|11132612|sp|Q9ZFC5|DNAJ_METSS Chaperone protein dnaJ >gnl|BL_... 89 2e-16
gi|48786661|ref|ZP_00282795.1| COG0484: DnaJ-class molecular cha... 89 2e-16
gi|46309065|ref|ZP_00211257.1| COG0484: DnaJ-class molecular cha... 89 2e-16
gi|37524584|ref|NP_927928.1| heat shock protein dnaJ (HSP40) (ch... 89 2e-16
gi|50590903|ref|ZP_00332243.1| COG0484: DnaJ-class molecular cha... 89 2e-16
gi|4322315|gb|AAD16010.1| DnaJ-like 2 protein [Homo sapiens] 89 2e-16
gi|17507263|ref|NP_493570.1| DNaJ domain (prokaryotic heat shock... 89 2e-16
gi|34902472|ref|NP_912582.1| Putative DNAJ protein [Oryza sativa... 89 2e-16
gi|32267141|ref|NP_861173.1| curved DNA-binding protein CbpA [He... 89 2e-16
gi|27806965|ref|NP_776957.1| DnaJ (Hsp40) homolog, subfamily B, ... 88 3e-16
gi|41149466|ref|XP_370665.1| similar to DnaJ (Hsp40) homolog, su... 88 3e-16
gi|144000|gb|AAA22948.1| dnaJ homologue 88 3e-16
gi|15594862|ref|NP_212651.1| heat shock protein (dnaJ-1) [Borrel... 88 3e-16
gi|48865946|ref|ZP_00319804.1| COG0484: DnaJ-class molecular cha... 88 3e-16
gi|47226293|emb|CAG09261.1| unnamed protein product [Tetraodon n... 88 3e-16
gi|45531653|ref|ZP_00182689.1| COG2214: DnaJ-class molecular cha... 88 3e-16
gi|47497379|dbj|BAD19417.1| putative heat shock protein dnaJ [Or... 88 3e-16
gi|22298332|ref|NP_681579.1| heat shock protein [Thermosynechoco... 88 3e-16
gi|15806441|ref|NP_295147.1| dnaJ protein [Deinococcus radiodura... 88 3e-16
gi|11132455|sp|Q9RUG2|DNAJ_DEIRA Chaperone protein dnaJ 88 3e-16
gi|143978|gb|AAA22925.1| putative 88 3e-16
gi|12838381|dbj|BAB24183.1| unnamed protein product [Mus musculus] 88 3e-16
gi|19855061|sp|O54946|DJB6_MOUSE DnaJ homolog subfamily B member... 88 3e-16
gi|34853488|ref|XP_342608.1| similar to mDj4 [Rattus norvegicus] 88 3e-16
gi|6754736|ref|NP_035977.1| DnaJ (Hsp40) homolog, subfamily B, m... 88 3e-16
gi|13277586|gb|AAH03702.1| DnaJ (Hsp40) homolog, subfamily B, me... 88 3e-16
gi|33598001|ref|NP_885644.1| molecular chaperone [Bordetella par... 88 3e-16
gi|15595000|ref|NP_212789.1| heat shock protein (dnaJ-2) [Borrel... 88 3e-16
gi|48096650|ref|XP_392495.1| similar to CG8448-PA [Apis mellifera] 88 3e-16
gi|48095627|ref|XP_392331.1| similar to pDJA1 chaperone [Apis me... 88 3e-16
gi|28378659|ref|NP_785551.1| chaperone protein DnaJ [Lactobacill... 88 3e-16
gi|46201302|ref|ZP_00055306.2| COG0484: DnaJ-class molecular cha... 88 3e-16
gi|33602907|ref|NP_890467.1| molecular chaperone [Bordetella bro... 88 3e-16
gi|33593481|ref|NP_881125.1| molecular chaperone [Bordetella per... 88 3e-16
gi|15835234|ref|NP_296993.1| dnaJ protein [Chlamydia muridarum] ... 88 3e-16
gi|15605064|ref|NP_219848.1| Heat Shock Protein J [Chlamydia tra... 88 3e-16
gi|50749322|ref|XP_421586.1| PREDICTED: similar to DnaJ homolog ... 87 5e-16
gi|23103066|ref|ZP_00089557.1| COG2214: DnaJ-class molecular cha... 87 5e-16
gi|3121987|sp|O34136|DNAJ_DEIPR Chaperone protein dnaJ (40 kDa h... 87 5e-16
gi|38104083|gb|EAA50703.1| hypothetical protein MG04462.4 [Magna... 87 5e-16
gi|46124601|ref|XP_386854.1| hypothetical protein FG06678.1 [Gib... 87 5e-16
gi|19703466|ref|NP_603028.1| Chaperone protein dnaJ [Fusobacteri... 87 5e-16
gi|13541318|ref|NP_111006.1| Molecular chaperone (DnaJ-related) ... 87 5e-16
gi|48860314|ref|ZP_00314239.1| COG0484: DnaJ-class molecular cha... 87 5e-16
gi|40643395|emb|CAD55138.1| heat shock protein DnaJ [Fusobacteri... 87 5e-16
gi|37361854|gb|AAQ91040.1| LRRGT00084 [Rattus norvegicus] 87 5e-16
gi|20892117|ref|XP_148071.1| RIKEN cDNA 1810031F23 [Mus musculus... 87 5e-16
gi|27754067|ref|NP_080676.2| DnaJ (Hsp40) homolog, subfamily B, ... 87 5e-16
gi|21672435|ref|NP_660502.1| DnaJ protein [Buchnera aphidicola s... 87 5e-16
gi|47523738|ref|NP_999504.1| pDJA1 chaperone [Sus scrofa] >gnl|B... 87 5e-16
gi|32450126|gb|AAH54199.1| MGC64353 protein [Xenopus laevis] 87 5e-16
gi|38488745|ref|NP_942116.1| DnaJ (Hsp40) homolog, subfamily B, ... 87 5e-16
gi|39997501|ref|NP_953452.1| dnaJ domain protein [Geobacter sulf... 87 5e-16
gi|16332061|ref|NP_442789.1| DnaJ protein [Synechocystis sp. PCC... 87 5e-16
gi|21410573|gb|AAH31044.1| DNAJA4 protein [Homo sapiens] 87 6e-16
gi|21749145|dbj|BAC03540.1| unnamed protein product [Homo sapiens] 87 6e-16
gi|34861860|ref|XP_344988.1| similar to mDj4 [Rattus norvegicus] 87 6e-16
gi|477566|pir||A49210 heat shock protein dnaJ - Lyme disease spi... 87 6e-16
gi|46199427|ref|YP_005094.1| chaperone protein dnaJ [Thermus the... 87 6e-16
gi|3123215|sp|Q56237|DNAJ_THETH Chaperone protein dnaJ >gnl|BL_O... 87 6e-16
gi|1449142|gb|AAB04678.1| heat shock protein 87 6e-16
gi|12044869|ref|NP_072679.1| heat shock protein (dnaJ) [Mycoplas... 87 6e-16
gi|21758015|dbj|BAC05229.1| unnamed protein product [Homo sapiens] 87 6e-16
gi|23612369|ref|NP_703949.1| DNAJ domain protein, putative [Plas... 87 6e-16
gi|48893092|ref|ZP_00326385.1| COG0484: DnaJ-class molecular cha... 87 6e-16
gi|49257345|gb|AAH73579.1| Unknown (protein for MGC:82876) [Xeno... 87 6e-16
gi|15675997|ref|NP_273124.1| dnaJ protein [Neisseria meningitidi... 87 6e-16
gi|46156765|ref|ZP_00132203.2| COG0484: DnaJ-class molecular cha... 87 6e-16
gi|23466915|ref|ZP_00122501.1| COG0484: DnaJ-class molecular cha... 87 6e-16
gi|23023574|ref|ZP_00062808.1| COG0484: DnaJ-class molecular cha... 87 6e-16
gi|33354249|ref|NP_061072.2| DnaJ (Hsp40) homolog, subfamily A, ... 87 6e-16
gi|27805462|sp|Q8WW22|DJA4_HUMAN DnaJ homolog subfamily A member... 87 6e-16
gi|29831029|ref|NP_825663.1| putative DnaJ protein [Streptomyces... 87 6e-16
gi|50539774|ref|NP_001002353.1| zgc:92148 [Danio rerio] >gnl|BL_... 87 8e-16
gi|46580285|ref|YP_011093.1| dnaJ protein, putative [Desulfovibr... 87 8e-16
gi|50290913|ref|XP_447889.1| unnamed protein product [Candida gl... 87 8e-16
gi|15807619|ref|NP_293852.1| dnaJ protein [Deinococcus radiodura... 87 8e-16
gi|46581645|ref|YP_012453.1| dnaJ protein [Desulfovibrio vulgari... 87 8e-16
gi|42542970|gb|AAH66411.1| Dnajb11 protein [Danio rerio] 87 8e-16
gi|8249464|emb|CAB93148.1| HDJ2 protein [Homo sapiens] 86 1e-15
gi|6572224|emb|CAB63052.1| dJ408N23.4 (novel DnaJ domain protein... 86 1e-15
gi|45360863|ref|NP_989107.1| DnaJ homolog subfamily B member 6 [... 86 1e-15
gi|17352354|gb|AAL17676.1| apobec-1 binding protein 2 [Mus muscu... 86 1e-15
gi|21553335|ref|NP_660157.1| DnaJ (Hsp40) homolog, subfamily B, ... 86 1e-15
gi|48861837|ref|ZP_00315736.1| COG0484: DnaJ-class molecular cha... 86 1e-15
gi|6680297|ref|NP_032324.1| DnaJ (Hsp40) homolog, subfamily A, m... 86 1e-15
gi|4504511|ref|NP_001530.1| DnaJ (Hsp40) homolog, subfamily A, m... 86 1e-15
gi|32880141|gb|AAP88901.1| DnaJ (Hsp40) homolog, subfamily A, me... 86 1e-15
gi|21230930|ref|NP_636847.1| DnaJ protein [Xanthomonas campestri... 86 1e-15
gi|17229939|ref|NP_486487.1| DnaJ protein [Nostoc sp. PCC 7120] ... 86 1e-15
gi|12484032|gb|AAG53937.1| DnaJ [Xanthomonas campestris pv. camp... 86 1e-15
gi|47086921|ref|NP_998455.1| zgc:85806 [Danio rerio] >gnl|BL_ORD... 86 1e-15
gi|18605792|gb|AAH22948.1| Dnaja4 protein [Mus musculus] 86 1e-15
gi|23126440|ref|ZP_00108336.1| COG2214: DnaJ-class molecular cha... 86 1e-15
gi|23104784|ref|ZP_00091244.1| COG0484: DnaJ-class molecular cha... 86 1e-15
gi|48477913|ref|YP_023619.1| chaperone protein DnaJ [Picrophilus... 86 1e-15
gi|1706465|sp|P50025|DNAJ_LEGPN Chaperone protein dnaJ >gnl|BL_O... 86 1e-15
gi|219588|dbj|BAA02656.1| DnaJ protein homolog [Homo sapiens] 86 1e-15
gi|15028450|gb|AAK81721.1| DnaJ-like protein [Cercopithecus aeth... 86 1e-15
gi|26382271|dbj|BAB30367.2| unnamed protein product [Mus musculus] 86 1e-15
gi|9294487|dbj|BAB02706.1| DnaJ homolog [Arabidopsis thaliana] 86 1e-15
gi|42564975|ref|NP_188410.2| DNAJ heat shock family protein [Ara... 86 1e-15
gi|15679295|ref|NP_276412.1| DnaJ protein [Methanothermobacter t... 86 1e-15
gi|15616772|ref|NP_239984.1| DnaJ protein [Buchnera aphidicola s... 86 1e-15
gi|7441914|pir||JC5609 heat shock protein dnaJ - Buchnera sp >gn... 86 1e-15
gi|21241906|ref|NP_641488.1| curved DNA binding protein [Xanthom... 86 2e-15
gi|48853832|ref|ZP_00307998.1| COG0484: DnaJ-class molecular cha... 86 2e-15
gi|46118341|ref|ZP_00201248.1| COG0484: DnaJ-class molecular cha... 86 2e-15
gi|15799695|ref|NP_285707.1| chaperone with DnaK; heat shock pro... 86 2e-15
gi|23130152|ref|ZP_00111971.1| COG0484: DnaJ-class molecular cha... 86 2e-15
gi|23474234|ref|ZP_00129528.1| COG0484: DnaJ-class molecular cha... 86 2e-15
gi|29346654|ref|NP_810157.1| chaperone protein dnaJ [Bacteroides... 85 2e-15
gi|46849521|dbj|BAD17849.1| putative chaperone DnaJ [Hydrogenoba... 85 2e-15
gi|37362683|ref|NP_013941.2| dnaJ homolog; Scj1p [Saccharomyces ... 85 2e-15
gi|21914368|gb|AAM81355.1| heat shock protein 40 [Steinernema fe... 85 2e-15
gi|34762775|ref|ZP_00143763.1| Chaperone protein dnaJ [Fusobacte... 85 2e-15
gi|886414|gb|AAC18895.1| TCJ2 [Trypanosoma cruzi] 85 2e-15
gi|37523836|ref|NP_927213.1| chaperone protein [Gloeobacter viol... 85 2e-15
gi|1352281|sp|P48207|DNAJ_FRATU Chaperone protein dnaJ >gnl|BL_O... 85 2e-15
gi|32395918|gb|AAP41819.1| P58IPK [Nicotiana benthamiana] 85 2e-15
gi|134297|sp|P25303|SCJ1_YEAST DnaJ-related protein SCJ1 >gnl|BL... 85 2e-15
gi|10732861|ref|NP_036831.2| dnaJ homolog, subfamily b, member 9... 85 2e-15
gi|30249142|ref|NP_841212.1| DnaJ N-terminal domain:DnaJ C termi... 85 2e-15
gi|28872012|ref|NP_794631.1| curved-DNA-binding protein [Pseudom... 85 2e-15
gi|16759006|ref|NP_454623.1| DnaJ protein [Salmonella enterica s... 85 2e-15
gi|48787239|ref|ZP_00283321.1| COG2214: DnaJ-class molecular cha... 85 2e-15
gi|15606104|ref|NP_213481.1| chaperone DnaJ [Aquifex aeolicus VF... 85 2e-15
gi|46200114|ref|YP_005781.1| chaperone protein dnaJ [Thermus the... 85 2e-15
gi|48895741|ref|ZP_00328725.1| COG2214: DnaJ-class molecular cha... 85 3e-15
gi|47223266|emb|CAF98650.1| unnamed protein product [Tetraodon n... 85 3e-15
gi|9558755|ref|NP_036460.1| DnaJ (Hsp40) homolog, subfamily B, m... 85 3e-15
gi|32034805|ref|ZP_00134923.1| COG0484: DnaJ-class molecular cha... 85 3e-15
gi|48845784|ref|ZP_00300056.1| COG0484: DnaJ-class molecular cha... 85 3e-15
gi|15228802|ref|NP_191819.1| DNAJ heat shock family protein [Ara... 85 3e-15
gi|11277163|pir||T43929 DnaJ protein homolog [imported] - Salix ... 85 3e-15
gi|15640872|ref|NP_230503.1| dnaJ protein [Vibrio cholerae O1 bi... 85 3e-15
gi|15231993|ref|NP_187509.1| DNAJ heat shock N-terminal domain-c... 85 3e-15
gi|23470716|ref|ZP_00126048.1| COG2214: DnaJ-class molecular cha... 85 3e-15
gi|22994777|ref|ZP_00039268.1| COG0484: DnaJ-class molecular cha... 84 4e-15
gi|15838930|ref|NP_299618.1| DnaJ protein [Xylella fastidiosa 9a... 84 4e-15
gi|2352904|gb|AAB69313.1| Dnj3/Cpr3 [Homo sapiens] 84 4e-15
gi|28199253|ref|NP_779567.1| DnaJ protein [Xylella fastidiosa Te... 84 4e-15
gi|26344614|dbj|BAC35956.1| unnamed protein product [Mus musculus] 84 4e-15
gi|24111464|ref|NP_705974.1| chaperone with DnaK; heat shock pro... 84 4e-15
gi|22997388|ref|ZP_00041620.1| COG0484: DnaJ-class molecular cha... 84 4e-15
gi|42742432|gb|AAS45274.1| microvascular endothelial differentia... 84 4e-15
gi|5542127|pdb|1BQZ| J-Domain (Residues 1-77) Of The Escherichi... 84 4e-15
gi|5542126|pdb|1BQ0| J-Domain (Residues 1-77) Of The Escherichi... 84 4e-15
gi|1942570|pdb|1XBL| Nmr Structure Of The J-Domain (Residues 2-... 84 4e-15
gi|15602605|ref|NP_245677.1| DnaJ [Pasteurella multocida Pm70] >... 84 4e-15
gi|48763848|ref|ZP_00268401.1| COG0484: DnaJ-class molecular cha... 84 4e-15
gi|19553988|ref|NP_601990.1| molecular chaperone [Corynebacteriu... 84 4e-15
gi|47210998|emb|CAF95830.1| unnamed protein product [Tetraodon n... 84 4e-15
gi|34536036|dbj|BAC87515.1| unnamed protein product [Homo sapiens] 84 4e-15
gi|34897648|ref|NP_910170.1| hypothetical protein [Oryza sativa]... 84 4e-15
gi|30249896|ref|NP_841966.1| DnaJ molecular chaperone [Nitrosomo... 84 4e-15
gi|16128009|ref|NP_414556.1| chaperone with DnaK; heat shock pro... 84 4e-15
gi|30061585|ref|NP_835756.1| chaperone with DnaK; heat shock pro... 84 4e-15
gi|21242274|ref|NP_641856.1| DnaJ protein [Xanthomonas axonopodi... 84 4e-15
gi|33519590|ref|NP_878422.1| DnaJ protein [Candidatus Blochmanni... 84 5e-15
gi|11496245|ref|NP_067292.1| DnaJ (Hsp40) homolog, subfamily B, ... 84 5e-15
gi|18203397|sp|Q9QYI6|DJB9_MOUSE DnaJ homolog subfamily B member... 84 5e-15
gi|31560495|ref|NP_038788.2| DnaJ (Hsp40) homolog, subfamily B, ... 84 5e-15
gi|15611468|ref|NP_223119.1| putative co-chaperone with DnaK [He... 84 5e-15
gi|15645638|ref|NP_207814.1| co-chaperone-curved DNA binding pro... 84 5e-15
gi|27503357|gb|AAH42291.1| Dnaja1-prov protein [Xenopus laevis] 84 5e-15
gi|47225843|emb|CAF98323.1| unnamed protein product [Tetraodon n... 84 5e-15
gi|33239469|ref|NP_874411.1| DnaJ-class molecular chaperone [Pro... 84 5e-15
gi|33862295|ref|NP_893855.1| DnaJ protein [Prochlorococcus marin... 84 5e-15
gi|46093414|dbj|BAD14920.1| DnaJ [Acetobacter aceti] 84 5e-15
gi|38086711|ref|XP_125441.3| similar to DnaJ-like protein 2 [Mus... 84 5e-15
gi|23478094|gb|EAA15273.1| DnaJ homolog, putative [Plasmodium yo... 84 5e-15
gi|44889077|sp|Q9QYI8|DJB7_MOUSE DnaJ homolog subfamily B member... 84 5e-15
gi|13357969|ref|NP_078243.1| heat shock protein [Ureaplasma parv... 84 5e-15
gi|28200377|gb|AAO31694.1| DnaJA2 [Homo sapiens] 84 5e-15
gi|422811|pir||S34632 dnaJ protein homolog - human 84 5e-15
gi|34873728|ref|XP_220976.2| similar to DnaJ (Hsp40) homolog, su... 84 7e-15
gi|4507713|ref|NP_003306.1| DnaJ (Hsp40) homolog, subfamily C, m... 84 7e-15
gi|12848273|dbj|BAB27893.1| unnamed protein product [Mus musculus] 84 7e-15
gi|31416724|gb|AAH03601.1| DNAJC7 protein [Homo sapiens] 84 7e-15
gi|21222083|ref|NP_627862.1| molecular chaperone [Streptomyces c... 84 7e-15
>gi|17534355|ref|NP_496468.1| DNaJ domain (prokaryotic heat shock
protein) (36.3 kD) (dnj-13C) [Caenorhabditis elegans]
gi|7504196|pir||T22648 hypothetical protein F54D5.8 -
Caenorhabditis elegans
gi|3877513|emb|CAA91334.1| Hypothetical protein F54D5.8
[Caenorhabditis elegans]
Length = 331
Score = 498 bits (1281), Expect = e-139
Identities = 259/331 (78%), Positives = 259/331 (78%)
Frame = +1
Query: 1 MGKDYYKVLGISKGATDDEIKKAYRKMALKYHPDKNKEAGAENKFKEIAEAYDVLSDDKK 180
MGKDYYKVLGISKGATDDEIKKAYRKMALKYHPDKNKEAGAENKFKEIAEAYDVLSDDKK
Sbjct: 1 MGKDYYKVLGISKGATDDEIKKAYRKMALKYHPDKNKEAGAENKFKEIAEAYDVLSDDKK 60
Query: 181 KKIYDQFXXXXXXXXXXXXXXXXXXXXXXXXXXDPMNIXXXXXXXXXXXXXXXXXMFDLG 360
KKIYDQF DPMNI MFDLG
Sbjct: 61 KKIYDQFGEEGLKEGGPGAGGGGGGGMHYEFRGDPMNIFSSFFGGSDPFGAGGPGMFDLG 120
Query: 361 GGAGGPNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPAVLHDLSVSLEDVLKGTTKKMKI 540
GGAGGPN PAVLHDLSVSLEDVLKGTTKKMKI
Sbjct: 121 GGAGGPNMFFMNQGGMDDGMFGGMHQGGRRGHARQDPAVLHDLSVSLEDVLKGTTKKMKI 180
Query: 541 TRKVMTDNAQRLEDKVLTVTIKPGWKSGTKITFPKEGDQHPNRTPADIVFVIKDKPHPKF 720
TRKVMTDNAQRLEDKVLTVTIKPGWKSGTKITFPKEGDQHPNRTPADIVFVIKDKPHPKF
Sbjct: 181 TRKVMTDNAQRLEDKVLTVTIKPGWKSGTKITFPKEGDQHPNRTPADIVFVIKDKPHPKF 240
Query: 721 KREGSDIKRVEKISLKSALTGLDIMIPTLDGADYRLQLNDVIKPGTTRRLTGKGLPNPKS 900
KREGSDIKRVEKISLKSALTGLDIMIPTLDGADYRLQLNDVIKPGTTRRLTGKGLPNPKS
Sbjct: 241 KREGSDIKRVEKISLKSALTGLDIMIPTLDGADYRLQLNDVIKPGTTRRLTGKGLPNPKS 300
Query: 901 PSHRGDLIIEFDVEFPSQLNPTQREVILRNF 993
PSHRGDLIIEFDVEFPSQLNPTQREVILRNF
Sbjct: 301 PSHRGDLIIEFDVEFPSQLNPTQREVILRNF 331