Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F56B3_2
(1116 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17540706|ref|NP_499982.1| COLlagen structural gene (33.8 kD) ... 159 8e-38
gi|39583551|emb|CAE65655.1| Hypothetical protein CBG10720 [Caeno... 120 7e-26
gi|687634|gb|AAA62504.1| collagen 74 8e-12
gi|32563747|ref|NP_494878.2| COLlagen structural gene (col-17) [... 74 8e-12
gi|687636|gb|AAA62505.1| collagen [Caenorhabditis elegans] 71 5e-11
gi|5669894|gb|AAD46501.1| latent nuclear antigen [Human herpesvi... 64 8e-09
gi|9886896|gb|AAG01636.1| Orf73 [Human herpesvirus 8] 63 1e-08
gi|2246532|gb|AAB62657.1| ORF 73, contains large complex repeat ... 63 1e-08
gi|50424619|ref|XP_460899.1| unnamed protein product [Debaryomyc... 62 3e-08
gi|17532621|ref|NP_494879.1| COLlagen structural gene (col-20) [... 61 4e-08
gi|23482650|gb|EAA18573.1| hypothetical protein [Plasmodium yoel... 61 4e-08
gi|18846043|ref|NP_572129.1| ORF 73; extensive acidic domains, p... 61 5e-08
gi|39585657|emb|CAE59859.1| Hypothetical protein CBG03334 [Caeno... 60 7e-08
gi|11037008|gb|AAG27458.1| latent nuclear antigen [Human herpesv... 59 3e-07
gi|17539720|ref|NP_502372.1| COLlagen structural gene (28.8 kD) ... 58 3e-07
gi|39593182|emb|CAE64651.1| Hypothetical protein CBG09422 [Caeno... 58 5e-07
gi|39592028|emb|CAE75248.1| Hypothetical protein CBG23205 [Caeno... 57 6e-07
gi|13936996|gb|AAK50002.1| ORF73 [Human herpesvirus 8] 57 8e-07
gi|50405059|ref|YP_054151.1| hypothetical protein PTMB.222 [Para... 57 1e-06
gi|17543526|ref|NP_502966.1| predicted CDS, COLlagen structural ... 57 1e-06
gi|17561556|ref|NP_505902.1| COLlagen structural gene (col-156) ... 55 3e-06
gi|17565206|ref|NP_506334.1| COLlagen structural gene (col-162) ... 55 4e-06
gi|39593008|emb|CAE62622.1| Hypothetical protein CBG06744 [Caeno... 54 9e-06
gi|17564308|ref|NP_504736.1| COLlagen structural gene (col-142) ... 53 1e-05
gi|39594381|emb|CAE71959.1| Hypothetical protein CBG19029 [Caeno... 53 1e-05
gi|17558722|ref|NP_506300.1| COLlagen structural gene (col-161) ... 53 1e-05
gi|50257630|gb|EAL20335.1| hypothetical protein CNBF1460 [Crypto... 53 1e-05
gi|17564306|ref|NP_504738.1| COLlagen structural gene (col-143) ... 53 1e-05
gi|28828096|gb|AAO50779.1| similar to Mus musculus (Mouse). Sex-... 53 1e-05
gi|39594639|emb|CAE72217.1| Hypothetical protein CBG19328 [Caeno... 52 2e-05
gi|39594640|emb|CAE72218.1| Hypothetical protein CBG19329 [Caeno... 52 2e-05
gi|17564310|ref|NP_504735.1| COLlagen structural gene (col-141) ... 52 2e-05
gi|39594379|emb|CAE71957.1| Hypothetical protein CBG19026 [Caeno... 51 6e-05
gi|17563988|ref|NP_505486.1| COLlagen structural gene (27.2 kD) ... 50 7e-05
gi|17563992|ref|NP_505484.1| COLlagen structural gene (27.4 kD) ... 50 7e-05
gi|17508863|ref|NP_491786.1| predicted CDS, COLlagen structural ... 50 9e-05
gi|9837385|gb|AAG00554.1| retinitis pigmentosa GTPase regulator-... 50 9e-05
gi|45201034|ref|NP_986604.1| AGL062Cp [Eremothecium gossypii] >g... 50 1e-04
gi|39594380|emb|CAE71958.1| Hypothetical protein CBG19027 [Caeno... 50 1e-04
gi|47523948|ref|NP_999613.1| involucrin [Sus scrofa] >gnl|BL_ORD... 50 1e-04
gi|17385613|emb|CAD12626.1| involucrin [Sus scrofa] 50 1e-04
gi|39595633|emb|CAE67135.1| Hypothetical protein CBG12558 [Caeno... 49 2e-04
gi|50547379|ref|XP_501159.1| hypothetical protein [Yarrowia lipo... 49 2e-04
gi|39592976|emb|CAE62590.1| Hypothetical protein CBG06704 [Caeno... 49 2e-04
gi|17385615|emb|CAD12627.1| involucrin [Sus scrofa] 49 2e-04
gi|26554099|ref|NP_758033.1| DNA topoisomerase IV subunit A [Myc... 49 2e-04
gi|15611374|ref|NP_223025.1| putative [Helicobacter pylori J99] ... 48 4e-04
gi|23479635|gb|EAA16409.1| glutamic acid-rich protein precursor,... 48 4e-04
gi|42733613|gb|AAS38587.1| similar to Dictyostelium discoideum (... 48 4e-04
gi|50405040|ref|YP_054132.1| hypothetical protein PTMB.204c [Par... 48 4e-04
gi|46137137|ref|XP_390260.1| hypothetical protein FG10084.1 [Gib... 48 4e-04
gi|39587940|emb|CAE67959.1| Hypothetical protein CBG13563 [Caeno... 48 5e-04
gi|39580427|emb|CAE69309.1| Hypothetical protein CBG15367 [Caeno... 47 6e-04
gi|28829276|gb|AAO51818.1| similar to Kaposi's sarcoma-associate... 47 6e-04
gi|28850409|gb|AAO53177.1| similar to Dictyostelium discoideum (... 47 8e-04
gi|13929148|ref|NP_113997.1| cyclic nucleotide-gated channel bet... 47 8e-04
gi|23485922|gb|EAA20646.1| hypothetical protein [Plasmodium yoel... 47 8e-04
gi|38085863|ref|XP_133185.3| similar to hypothetical protein FLJ... 47 8e-04
gi|17539048|ref|NP_500094.1| COLlagen structural gene (col-107) ... 47 0.001
gi|39591680|emb|CAE71258.1| Hypothetical protein CBG18138 [Caeno... 47 0.001
gi|46442819|gb|EAL02105.1| hypothetical protein CaO19.801 [Candi... 47 0.001
gi|32566500|ref|NP_872105.1| COLlagen structural gene (27.6 kD) ... 47 0.001
gi|23613112|ref|NP_703434.1| hypothetical protein [Plasmodium fa... 47 0.001
gi|38488737|ref|NP_942112.1| starmaker [Danio rerio] >gnl|BL_ORD... 46 0.001
gi|19921116|ref|NP_609448.1| CG12299-PA [Drosophila melanogaster... 46 0.001
gi|17508163|ref|NP_492936.1| COLlagen structural gene (col-65) [... 46 0.001
gi|112674|sp|P13813|110K_PLAKN 110 kDa antigen (PK110) >gnl|BL_O... 46 0.002
gi|18766204|gb|AAL78899.1| merozoite surface protein-9 precursor... 45 0.002
gi|630447|pir||S47439 I2 protein - Trypanosoma brucei >gnl|BL_OR... 45 0.002
gi|11466451|ref|NP_046743.1| Rep-like [Dictyostelium discoideum]... 45 0.003
gi|27368080|gb|AAN86961.1| retinitis pigmentosa 1-like 1 protein... 45 0.003
gi|28828911|gb|AAO51497.1| similar to Mus musculus (Mouse). simi... 45 0.003
gi|27368084|gb|AAN86963.1| retinitis pigmentosa 1-like 1 protein... 45 0.003
gi|28301672|emb|CAD36957.1| retinitis pigmentosa 1-like protein ... 45 0.003
gi|27368082|gb|AAN86962.1| retinitis pigmentosa 1-like 1 protein... 45 0.003
gi|38603523|dbj|BAD02898.1| bacteriolytic enzyme [Bacillus clausii] 45 0.003
gi|27368076|gb|AAN86959.1| retinitis pigmentosa 1-like 1 protein... 45 0.003
gi|27368078|gb|AAN86960.1| retinitis pigmentosa 1-like 1 protein... 45 0.003
gi|42559826|sp|Q8IWN7|RPL1_HUMAN Retinitis pigmentosa 1-like 1 p... 45 0.003
gi|40255278|ref|NP_849188.3| retinitis pigmentosa 1-like 1 [Homo... 45 0.003
gi|30348579|emb|CAC84371.1| hypothetical protein [Saimiriine her... 45 0.004
gi|1245105|gb|AAC52934.1| glutamine repeat protein-1 45 0.004
gi|39594071|emb|CAE70181.1| Hypothetical protein CBG16654 [Caeno... 44 0.005
gi|50730125|ref|XP_416780.1| PREDICTED: similar to retinitis pig... 44 0.005
gi|39592197|emb|CAE75417.1| Hypothetical protein CBG23407 [Caeno... 44 0.005
gi|28374176|gb|AAH46263.1| LOC398566 protein [Xenopus laevis] 44 0.005
gi|48832889|ref|ZP_00289916.1| hypothetical protein Mmc102001633... 44 0.005
gi|23479255|gb|EAA16133.1| hypothetical protein [Plasmodium yoel... 44 0.005
gi|34851186|ref|XP_346518.1| hypothetical protein XP_346517 [Rat... 44 0.005
gi|17158629|ref|NP_478050.1| wsv528 [shrimp white spot syndrome ... 44 0.005
gi|50420779|ref|XP_458929.1| unnamed protein product [Debaryomyc... 44 0.005
gi|39580220|emb|CAE72976.1| Hypothetical protein CBG20316 [Caeno... 44 0.007
gi|9626029|ref|NP_040275.1| ORF 73~ECLF1 [Saimiriine herpesvirus... 44 0.007
gi|228477|prf||1804350B ECLF2 upstream ORF 44 0.007
gi|23487174|gb|EAA20984.1| MIF4G domain, putative [Plasmodium yo... 44 0.009
gi|11559966|ref|NP_071531.1| involucrin gene [Rattus norvegicus]... 44 0.009
gi|23613038|ref|NP_703360.1| interspersed repeat antigen, putati... 44 0.009
gi|39589826|emb|CAE67061.1| Hypothetical protein CBG12469 [Caeno... 44 0.009
gi|15600941|ref|NP_232571.1| conserved hypothetical protein [Vib... 44 0.009
gi|17552984|ref|NP_498814.1| COLlagen structural gene (col-91) [... 44 0.009
gi|30022804|ref|NP_834435.1| Spore germination protein IA [Bacil... 44 0.009
gi|30526291|gb|AAP32203.1| latency associated nuclear antigen [S... 43 0.012
gi|31207045|ref|XP_312489.1| ENSANGP00000021340 [Anopheles gambi... 43 0.012
gi|544374|sp|P36417|GBF_DICDI G-box binding factor (GBF) >gnl|BL... 43 0.012
gi|17557278|ref|NP_505375.1| COLlagen structural gene (28.8 kD) ... 43 0.012
gi|23482074|gb|EAA18164.1| hypothetical protein [Plasmodium yoel... 43 0.012
gi|46435796|gb|EAK95170.1| hypothetical protein CaO19.4072 [Cand... 43 0.012
gi|17533675|ref|NP_496739.1| mature parasite-infected erythrocyt... 43 0.012
gi|34854792|ref|XP_218287.2| similar to putative odorant recepto... 43 0.015
gi|17647175|ref|NP_523757.1| CG8421-PB [Drosophila melanogaster]... 43 0.015
gi|6322796|ref|NP_012869.1| RNAPII degradation factor, forms a c... 43 0.015
gi|17385617|emb|CAD12628.1| involucrin [Sus scrofa] 43 0.015
gi|24654024|ref|NP_725525.1| CG8421-PA [Drosophila melanogaster]... 43 0.015
gi|24654027|ref|NP_725526.1| CG8421-PD [Drosophila melanogaster]... 43 0.015
gi|39595564|emb|CAE67065.1| Hypothetical protein CBG12473 [Caeno... 43 0.015
gi|16305113|gb|AAL16979.1| 50kD gamma zein [Zea mays] 43 0.015
gi|39593222|emb|CAE64691.1| Hypothetical protein CBG09473 [Caeno... 42 0.020
gi|46136181|ref|XP_389782.1| hypothetical protein FG09606.1 [Gib... 42 0.020
gi|24650473|ref|NP_651520.1| CG6296-PA [Drosophila melanogaster]... 42 0.020
gi|28828729|gb|AAO51324.1| similar to Dictyostelium discoideum (... 42 0.020
gi|50258198|gb|EAL20892.1| hypothetical protein CNBE2530 [Crypto... 42 0.020
gi|17506917|ref|NP_491595.1| DumPY : shorter than wild-type DPY-... 42 0.020
gi|786136|gb|AAA99499.1| polymorphic immunodominant molecule 42 0.020
gi|20138902|sp|O97432|MRJ5_APIME Major royal jelly protein 5 pre... 42 0.020
gi|15242707|ref|NP_198861.1| expressed protein [Arabidopsis thal... 42 0.020
gi|39594827|emb|CAE70695.1| Hypothetical protein CBG17418 [Caeno... 42 0.026
gi|39586240|emb|CAE66651.1| Hypothetical protein CBG11988 [Caeno... 42 0.026
gi|17559056|ref|NP_505376.1| COLlagen structural gene (col-10) [... 42 0.026
gi|23491066|gb|EAA22695.1| hypothetical protein [Plasmodium yoel... 42 0.026
gi|2498165|sp|Q12797|ASPH_HUMAN Aspartyl/asparaginyl beta-hydrox... 42 0.033
gi|39594543|emb|CAE72121.1| Hypothetical protein CBG19217 [Caeno... 42 0.033
gi|14589864|ref|NP_115857.1| aspartate beta-hydroxylase isoform ... 42 0.033
gi|14589860|ref|NP_115855.1| aspartate beta-hydroxylase isoform ... 42 0.033
gi|548937|sp|Q06852|SLP1_CLOTM CELL SURFACE GLYCOPROTEIN 1 PRECU... 42 0.033
gi|39588149|emb|CAE68073.1| Hypothetical protein CBG13703 [Caeno... 42 0.033
gi|50420655|ref|XP_458864.1| unnamed protein product [Debaryomyc... 42 0.033
gi|17384366|emb|CAD13202.1| involucrin [Sus scrofa] 42 0.033
gi|2243140|emb|CAA67384.1| nuclear hormone receptor [Drosophila ... 42 0.033
gi|48858286|ref|ZP_00312245.1| hypothetical protein Chte02002468... 42 0.033
gi|31212403|ref|XP_315186.1| ENSANGP00000021581 [Anopheles gambi... 42 0.033
gi|28828396|gb|AAO51028.1| similar to Dictyostelium discoideum (... 42 0.033
gi|46442629|gb|EAL01917.1| hypothetical protein CaO19.11787 [Can... 42 0.033
gi|14589866|ref|NP_004309.2| aspartate beta-hydroxylase isoform ... 42 0.033
gi|1911652|gb|AAB50779.1| aspartyl(asparaginyl)beta-hydroxylase;... 42 0.033
gi|49069208|ref|XP_398893.1| hypothetical protein UM01278.1 [Ust... 42 0.033
gi|39581822|emb|CAE60715.1| Hypothetical protein CBG04386 [Caeno... 41 0.044
gi|2133786|pir||I51116 NF-180 - sea lamprey >gnl|BL_ORD_ID|32563... 41 0.044
gi|39586115|emb|CAE69191.1| Hypothetical protein CBG15226 [Caeno... 41 0.044
gi|124728|sp|P18174|INVO_CANFA Involucrin >gnl|BL_ORD_ID|458093 ... 41 0.044
gi|17555486|ref|NP_497131.1| COLlagen structural gene (29.1 kD) ... 41 0.044
gi|46442495|gb|EAL01784.1| hypothetical protein CaO19.4312 [Cand... 41 0.044
gi|16768468|gb|AAL28453.1| GM05229p [Drosophila melanogaster] 41 0.044
gi|40888884|gb|AAR97288.1| DIF insensitive mutant A [Dictyosteli... 41 0.044
gi|39593742|emb|CAE62035.1| Hypothetical protein CBG06051 [Caeno... 41 0.057
gi|28377133|ref|NP_784025.1| cell surface protein precursor [Lac... 41 0.057
gi|45198327|ref|NP_985356.1| AFL194Wp [Eremothecium gossypii] >g... 41 0.057
gi|17540622|ref|NP_502116.1| predicted CDS, COLlagen structural ... 41 0.057
gi|17540620|ref|NP_502115.1| COLlagen structural gene (col-126) ... 41 0.057
gi|29893526|gb|AAN16519.1| merozoite surface protein-9 [Plasmodi... 41 0.057
gi|39583246|emb|CAE60038.1| Hypothetical protein CBG03549 [Caeno... 41 0.057
gi|17542298|ref|NP_501532.1| COLlagen structural gene (col-118) ... 41 0.057
gi|514833|gb|AAA19975.1| nuclear hormone receptor superfamily pr... 40 0.075
gi|33303458|gb|AAQ02305.1| dentin matrix protein 1 [Oryzomys pal... 40 0.075
gi|15235717|ref|NP_195495.1| expressed protein [Arabidopsis thal... 40 0.075
gi|6325066|ref|NP_015134.1| May be required for packaging pre-mR... 40 0.075
gi|1235750|dbj|BAA07154.1| RNA binding protein [Saccharomyces ce... 40 0.075
gi|16198327|gb|AAL14009.1| SD07158p [Drosophila melanogaster] 40 0.075
gi|20129887|ref|NP_610708.1| CG13185-PA [Drosophila melanogaster... 40 0.075
gi|46435639|gb|EAK95016.1| hypothetical protein CaO19.11553 [Can... 40 0.075
gi|50555313|ref|XP_505065.1| hypothetical protein [Yarrowia lipo... 40 0.075
gi|34878291|ref|XP_346097.1| similar to opioid growth factor rec... 40 0.075
gi|7769648|gb|AAF69494.1| nuclear receptor E78A [Drosophila mela... 40 0.075
gi|34223729|sp|P45447|E78A_DROME Ecdysone-induced protein 78C (D... 40 0.075
gi|21309834|gb|AAM19759.1| glutamic acid-rich protein cNBL1500 [... 40 0.097
gi|46434301|gb|EAK93714.1| hypothetical protein CaO19.11964 [Can... 40 0.097
gi|46109528|ref|XP_381822.1| hypothetical protein FG01646.1 [Gib... 40 0.097
gi|46434336|gb|EAK93748.1| hypothetical protein CaO19.4488 [Cand... 40 0.097
gi|24641056|ref|NP_572641.1| CG15295-PA [Drosophila melanogaster... 40 0.097
gi|38103775|gb|EAA50436.1| hypothetical protein MG04195.4 [Magna... 40 0.097
gi|16805171|ref|NP_473199.1| hypothetical protein [Plasmodium fa... 40 0.097
gi|39592067|emb|CAE75287.1| Hypothetical protein CBG23255 [Caeno... 40 0.097
gi|17559154|ref|NP_505981.1| COLlagen structural gene (33.2 kD) ... 40 0.097
gi|21309836|gb|AAM19760.1| glutamic acid-rich protein cNBL1700 [... 40 0.097
gi|30794328|ref|NP_851362.1| cyclic nucleotide gated channel bet... 40 0.097
gi|39594542|emb|CAE72120.1| Hypothetical protein CBG19216 [Caeno... 40 0.097
gi|1223914|gb|AAB47214.1| endo16 [Strongylocentrotus purpuratus] 40 0.097
gi|23483767|gb|EAA19328.1| Arabidopsis thaliana At5g66540/K1F13_... 40 0.097
gi|25145616|ref|NP_500551.2| protein conserved (4F151) [Caenorha... 40 0.097
gi|91094|pir||A26892 Mopa box protein - mouse (fragment) >gnl|BL... 40 0.097
gi|539440|pir||A49070 ecdysone-inducible protein E78A - fruit fl... 40 0.13
gi|32412592|ref|XP_326776.1| hypothetical protein [Neurospora cr... 40 0.13
gi|12018306|ref|NP_072143.1| nucleolin-related protein [Rattus n... 40 0.13
gi|46107840|ref|XP_380979.1| hypothetical protein FG00803.1 [Gib... 40 0.13
gi|49078486|ref|XP_402991.1| hypothetical protein UM05376.1 [Ust... 40 0.13
gi|50545139|ref|XP_500107.1| hypothetical protein [Yarrowia lipo... 40 0.13
gi|39593890|emb|CAE62183.1| Hypothetical protein CBG06230 [Caeno... 40 0.13
gi|32416182|ref|XP_328569.1| hypothetical protein [Neurospora cr... 40 0.13
gi|627056|pir||A54641 interspersed repeat antigen precursor - ma... 40 0.13
gi|7512088|pir||T30282 calcium-binding protein - sea urchin (Str... 40 0.13
gi|28828998|gb|AAO51573.1| similar to Dictyostelium discoideum (... 39 0.17
gi|26000382|gb|AAN75473.1| dentin matrix protein 1 [Mormoops meg... 39 0.17
gi|15021902|dbj|BAB62226.1| tudor protein [Xenopus laevis] 39 0.17
gi|20270337|ref|NP_620147.1| senescence downregulated leo1-like ... 39 0.17
gi|39979199|emb|CAE85570.1| related to histone acetyltransferase... 39 0.17
gi|119322|sp|P13665|EN16_STRPU ENDO16 PROTEIN >gnl|BL_ORD_ID|139... 39 0.17
gi|32407080|ref|XP_324139.1| hypothetical protein [Neurospora cr... 39 0.17
gi|500836|gb|AAB68893.1| Nmd2p: Protein involved in decay of mRN... 39 0.17
gi|46440238|gb|EAK99546.1| hypothetical protein CaO19.2449 [Cand... 39 0.17
gi|14669814|dbj|BAB62017.1| DCAPL1 [Drosophila melanogaster] 39 0.17
gi|24652386|ref|NP_610571.2| CG18408-PA [Drosophila melanogaster... 39 0.17
gi|23613492|ref|NP_703336.1| P. falciparum RESA-like protein wit... 39 0.17
gi|39589511|emb|CAE74540.1| Hypothetical protein CBG22297 [Caeno... 39 0.17
gi|6579193|ref|NP_011944.2| Component of the nonsense-mediated m... 39 0.17
gi|16550571|dbj|BAB71006.1| unnamed protein product [Homo sapiens] 39 0.17
gi|46440327|gb|EAK99634.1| hypothetical protein CaO19.9985 [Cand... 39 0.17
gi|39584611|emb|CAE72364.1| Hypothetical protein CBG19514 [Caeno... 39 0.22
gi|50258309|gb|EAL21000.1| hypothetical protein CNBD6010 [Crypto... 39 0.22
gi|39593313|emb|CAE64783.1| Hypothetical protein CBG09576 [Caeno... 39 0.22
gi|34189305|gb|AAH15518.1| ASPH protein [Homo sapiens] 39 0.22
gi|46115698|ref|XP_383867.1| hypothetical protein FG03691.1 [Gib... 39 0.22
gi|39597390|emb|CAE59619.1| Hypothetical protein CBG03028 [Caeno... 39 0.22
gi|31220056|ref|XP_316870.1| ENSANGP00000017739 [Anopheles gambi... 39 0.22
gi|19921992|ref|NP_610608.1| CG12340-PA [Drosophila melanogaster... 39 0.22
gi|17986031|ref|NP_523441.1| CG3696-PA [Drosophila melanogaster]... 39 0.22
gi|46227721|gb|EAK88641.1| eIF4G eukaryotic initiation factor 4,... 39 0.22
gi|47221067|emb|CAG12761.1| unnamed protein product [Tetraodon n... 39 0.22
gi|22788715|ref|NP_690423.1| hypothetical protein HZV_4 [Helioth... 39 0.22
gi|16264658|ref|NP_437450.1| hypothetical exported glutamine-ric... 39 0.22
gi|46432388|gb|EAK91872.1| hypothetical protein CaO19.13686 [Can... 39 0.28
gi|39597389|emb|CAE59618.1| Hypothetical protein CBG03027 [Caeno... 39 0.28
gi|49072784|ref|XP_400677.1| hypothetical protein UM03062.1 [Ust... 39 0.28
gi|28829807|gb|AAO52309.1| similar to Oryza sativa (japonica cul... 39 0.28
gi|17532627|ref|NP_496309.1| COLlagen structural gene (31.6 kD) ... 39 0.28
gi|46109630|ref|XP_381873.1| hypothetical protein FG01697.1 [Gib... 39 0.28
gi|17551634|ref|NP_508124.1| kinase (40.9 kD) (XB213) [Caenorhab... 39 0.28
gi|42734053|gb|AAS38925.1| hypothetical protein [Dictyostelium d... 39 0.28
gi|32417560|ref|XP_329258.1| predicted protein [Neurospora crass... 39 0.28
gi|28872861|ref|NP_055987.1| HBxAg transactivated protein 2 [Hom... 39 0.28
gi|1498641|gb|AAB06444.1| extracellular matrix associated protei... 39 0.28
gi|46432370|gb|EAK91855.1| hypothetical protein CaO19.6309 [Cand... 39 0.28
gi|31212401|ref|XP_315185.1| ENSANGP00000022547 [Anopheles gambi... 39 0.28
gi|17511053|ref|NP_492245.1| COLlagen structural gene (37.4 kD) ... 39 0.28
gi|49071568|ref|XP_400073.1| hypothetical protein UM02458.1 [Ust... 38 0.37
gi|34881108|ref|XP_343803.1| similar to OPA-containing protein 1... 38 0.37
gi|26000368|gb|AAN75480.1| dentin matrix protein 1 [Centurio senex] 38 0.37
gi|7489910|pir||T14004 trfA protein - slime mold (Dictyostelium ... 38 0.37
gi|50260382|gb|EAL23041.1| hypothetical protein CNBA8080 [Crypto... 38 0.37
gi|50259342|gb|EAL22015.1| hypothetical protein CNBC1540 [Crypto... 38 0.37
gi|6755761|ref|NP_035694.1| sex determining region Y; testis det... 38 0.37
gi|20260804|gb|AAK54092.2| histidine kinase DhkL [Dictyostelium ... 38 0.37
gi|120184|sp|P06916|FIRA_PLAFF 300 KD ANTIGEN AG231 >gnl|BL_ORD_... 38 0.37
gi|17541560|ref|NP_502297.1| COLlagen structural gene (33.5 kD) ... 38 0.37
gi|23619284|ref|NP_705246.1| hypothetical protein [Plasmodium fa... 38 0.37
gi|48838606|ref|ZP_00295547.1| COG0457: FOG: TPR repeat [Methano... 38 0.37
gi|23396860|sp|P70663|SPL1_MOUSE SPARC-like protein 1 precursor ... 38 0.37
gi|50311883|ref|XP_455973.1| unnamed protein product [Kluyveromy... 38 0.37
gi|31982800|ref|NP_034227.2| SPARC-like 1 (mast9, hevin); extrac... 38 0.37
gi|15924471|ref|NP_372005.1| elastin binding protein [Staphyloco... 38 0.37
gi|16445033|ref|NP_443189.1| ACRC protein; putative nuclear prot... 38 0.37
gi|38089907|ref|XP_134917.5| similar to senescence downregulated... 38 0.48
gi|101951|pir||D37271 A-alpha Z 4 protein - bracket fungus (Schi... 38 0.48
gi|16804923|ref|NP_472952.1| hypothetical protein [Plasmodium fa... 38 0.48
gi|50306605|ref|XP_453276.1| unnamed protein product [Kluyveromy... 38 0.48
gi|9967361|dbj|BAA74452.2| alpha' subunit of beta-conglycinin [G... 38 0.48
gi|585460|sp|P37938|MAZ4_SCHCO Mating-type protein A-alpha Z4 >g... 38 0.48
gi|50424261|ref|XP_460717.1| unnamed protein product [Debaryomyc... 38 0.48
gi|25150119|ref|NP_505374.2| COLlagen structural gene (col-144) ... 38 0.48
gi|121286|sp|P11827|GLCX_SOYBN Beta-conglycinin, alpha' chain pr... 38 0.48
gi|15425633|dbj|BAB64304.1| beta-conglycinin alpha-subunit [Glyc... 38 0.48
gi|38197696|gb|AAH61755.1| Extracellular matrix protein 2 [Rattu... 38 0.48
gi|6978789|ref|NP_037078.1| extracellular matrix protein 2 [Ratt... 38 0.48
gi|22026908|ref|NP_611556.2| CG30389-PC [Drosophila melanogaster... 38 0.48
gi|34857875|ref|XP_346628.1| hypothetical protein XP_346627 [Rat... 38 0.48
gi|15291219|gb|AAK92878.1| GH12043p [Drosophila melanogaster] >g... 38 0.48
gi|39593302|emb|CAE64772.1| Hypothetical protein CBG09563 [Caeno... 38 0.48
gi|42733783|gb|AAS38704.1| similar to Dictyostelium discoideum (... 38 0.48
gi|46110333|ref|XP_382224.1| hypothetical protein FG02048.1 [Gib... 38 0.48
gi|29827234|ref|NP_821868.1| hypothetical protein SAV693 [Strept... 38 0.48
gi|50421413|ref|XP_459257.1| unnamed protein product [Debaryomyc... 38 0.48
gi|39585964|emb|CAE68253.1| Hypothetical protein CBG13930 [Caeno... 38 0.48
gi|15241453|ref|NP_199241.1| zinc finger (C3HC4-type RING finger... 38 0.48
gi|17531719|ref|NP_496310.1| COLlagen structural gene (31.3 kD) ... 38 0.48
gi|37680610|ref|NP_935219.1| conserved hypothetical protein [Vib... 37 0.63
gi|29290087|gb|AAO67559.1| Pol protein [Drosophila virilis] 37 0.63
gi|26347067|dbj|BAC37182.1| unnamed protein product [Mus musculus] 37 0.63
gi|192363|gb|AAA37364.1| calspermin 37 0.63
gi|92319|pir||A29573 Glx-rich protein - rat (fragment) >gnl|BL_O... 37 0.63
gi|11345240|gb|AAG34658.1| involucrin [Mus musculus] 37 0.63
gi|26000388|gb|AAN75484.1| dentin matrix protein 1 [Plecotus tow... 37 0.63
gi|24645448|ref|NP_524294.2| CG9434-PA [Drosophila melanogaster]... 37 0.63
gi|18088924|gb|AAH21128.1| MYST4 protein [Homo sapiens] 37 0.63
gi|50256705|gb|EAL19428.1| hypothetical protein CNBH1200 [Crypto... 37 0.63
gi|39593522|emb|CAE61814.1| Hypothetical protein CBG05782 [Caeno... 37 0.63
gi|39585963|emb|CAE68252.1| Hypothetical protein CBG13929 [Caeno... 37 0.63
gi|32328882|dbj|BAC78524.1| prepro beta-conglycinin alpha prime ... 37 0.63
gi|16766615|ref|NP_462230.1| sigma 54 [Salmonella typhimurium LT... 37 0.63
gi|6002686|gb|AAF00095.1| histone acetyltransferase MORF [Homo s... 37 0.63
gi|34849874|gb|AAH57119.1| Tnrc11 protein [Mus musculus] 37 0.63
gi|387512|gb|AAA39933.1| Ca2+/Calmodulin-dependent protein kinase 37 0.63
gi|50806838|ref|XP_428858.1| PREDICTED: similar to tumor-related... 37 0.63
gi|11345242|gb|AAG34659.1| involucrin [Mus musculus] 37 0.63
gi|6002694|gb|AAF00099.1| histone acetyltransferase MORF alpha [... 37 0.63
gi|28828660|gb|AAO51263.1| similar to Plasmodium falciparum (iso... 37 0.63
gi|21450183|ref|NP_659062.1| solute carrier family 24 (sodium/po... 37 0.63
gi|23613137|ref|NP_703459.1| hypothetical protein [Plasmodium fa... 37 0.63
gi|18032212|gb|AAL56647.1| histone acetyltransferase MOZ2 [Homo ... 37 0.63
gi|1076839|pir||S49313 protein kinase - slime mold (Dictyosteliu... 37 0.63
gi|26326213|dbj|BAC26850.1| unnamed protein product [Mus musculu... 37 0.63
gi|45185971|ref|NP_983687.1| ACR285Cp [Eremothecium gossypii] >g... 37 0.63
gi|6753252|ref|NP_033923.1| calcium/calmodulin-dependent protein... 37 0.63
gi|6912512|ref|NP_036462.1| MYST histone acetyltransferase (mono... 37 0.63
gi|79960|pir||JH0204 hypothetical 30.5K protein precursor - Ente... 37 0.63
gi|24640194|ref|NP_572344.1| CG14441-PA [Drosophila melanogaster... 37 0.63
gi|47214704|emb|CAG01057.1| unnamed protein product [Tetraodon n... 37 0.63
gi|33468967|ref|NP_067496.1| trinucleotide repeat containing 11 ... 37 0.63
gi|5052373|gb|AAD38522.1| chromogranin A [Rana ridibunda] 37 0.63
gi|23613117|ref|NP_703439.1| RNA polymerase I [Plasmodium falcip... 37 0.63
gi|34784300|gb|AAH57085.1| Unknown (protein for MGC:67526) [Mus ... 37 0.63
gi|46433489|gb|EAK92927.1| hypothetical protein CaO19.13986 [Can... 37 0.63
gi|49070826|ref|XP_399702.1| hypothetical protein UM02087.1 [Ust... 37 0.83
gi|26000384|gb|AAN75474.1| dentin matrix protein 1 [Pteronotus p... 37 0.83
gi|2852361|gb|AAC02081.1| calcium binding EF-hand protein precur... 37 0.83
gi|49117079|gb|AAH73018.1| Unknown (protein for IMAGE:5048167) [... 37 0.83
gi|4827042|ref|NP_005111.1| trinucleotide repeat containing 11 (... 37 0.83
gi|1663694|dbj|BAA12112.1| Product has a CAG repeat region simil... 37 0.83
gi|13242534|ref|NP_077547.1| EsV-1-62 [Ectocarpus siliculosus vi... 37 0.83
gi|39590412|emb|CAE66151.1| Hypothetical protein CBG11381 [Caeno... 37 0.83
gi|15236115|ref|NP_194341.1| nucleosome assembly protein (NAP), ... 37 0.83
gi|33354107|dbj|BAC81137.1| TNRC11 [Homo sapiens] 37 0.83
gi|33354109|dbj|BAC81138.1| TNRC11 [Pan troglodytes] 37 0.83
gi|7512229|pir||T34073 paranemin - chicken 37 0.83
gi|5524203|gb|AAD44162.1| OPA-containing protein [Homo sapiens] 37 0.83
gi|3426320|gb|AAC83163.1| OPA-containing protein [Homo sapiens] 37 0.83
gi|123736|sp|P13361|HUNB_DROVI Hunchback protein >gnl|BL_ORD_ID|... 37 0.83
gi|27806661|ref|NP_776463.1| dentin matrix acidic phosphoprotein... 37 0.83
gi|549975|gb|AAA50234.1| nucleosome assembly protein I-like prot... 37 0.83
gi|192367|gb|AAA37366.1| brain Ca++/calmodulin-dependent protein... 37 0.83
gi|46122317|ref|XP_385712.1| hypothetical protein FG05536.1 [Gib... 37 0.83
gi|17553572|ref|NP_498086.1| collagen alpha precursor, DumPY : s... 37 0.83
gi|50549421|ref|XP_502181.1| hypothetical protein [Yarrowia lipo... 37 0.83
gi|31077132|ref|NP_852034.1| histidine rich calcium binding prot... 37 0.83
gi|32419006|ref|XP_329981.1| hypothetical protein [Neurospora cr... 37 0.83
gi|25395729|pir||H88449 protein F54D8.1 [imported] - Caenorhabdi... 37 0.83
gi|49478172|ref|YP_037430.1| conserved hypothetical protein [Bac... 37 0.83
gi|2565059|gb|AAB91440.1| CAGH45 [Homo sapiens] 37 0.83
gi|39590065|emb|CAE61063.1| Hypothetical protein CBG04812 [Caeno... 37 0.83
gi|29245456|gb|EAA37093.1| GLP_227_3888_5990 [Giardia lamblia AT... 37 0.83
gi|42627815|tpe|CAE00399.1| TPA: putative ISG12(b2) protein [Mus... 37 0.83
gi|32406504|ref|XP_323865.1| hypothetical protein [Neurospora cr... 37 0.83
gi|32398688|emb|CAD98648.1| retinitis pigmentosa GTPase regulato... 37 1.1
gi|538245|dbj|BAA03980.1| secreted phosphoprotein-1 precursor [O... 37 1.1
gi|42733645|gb|AAS38609.1| hypothetical protein [Dictyostelium d... 37 1.1
gi|39593314|emb|CAE64784.1| Hypothetical protein CBG09577 [Caeno... 37 1.1
gi|22788858|ref|NP_690572.1| hypothetical protein HZV_153 [Helio... 37 1.1
gi|7508686|pir||T15143 hypothetical protein T28F2.8 - Caenorhabd... 37 1.1
gi|23612220|ref|NP_703800.1| myosin-like protein, putative [Plas... 37 1.1
gi|38344339|emb|CAD41755.2| OSJNBa0058K23.21 [Oryza sativa (japo... 37 1.1
gi|33354111|dbj|BAC81139.1| TNRC11 [Pongo pygmaeus] 37 1.1
gi|24661837|ref|NP_648347.1| CG16711-PA [Drosophila melanogaster... 37 1.1
gi|17506747|ref|NP_492013.1| COLlagen structural gene (col-60) [... 37 1.1
gi|46442648|gb|EAL01936.1| hypothetical protein CaO19.11806 [Can... 37 1.1
gi|32418136|ref|XP_329546.1| related to TOM1 protein [MIPS] [Neu... 37 1.1
gi|32404250|ref|XP_322738.1| predicted protein [Neurospora crass... 37 1.1
gi|42783878|ref|NP_981125.1| FtsK/SpoIIIE family protein [Bacill... 37 1.1
gi|6746588|gb|AAF27637.1| ecdysone-inducible gene E1 [Drosophila... 37 1.1
gi|24660872|ref|NP_524849.2| CG32356-PA [Drosophila melanogaster... 37 1.1
gi|8745181|emb|CAB95697.1| putative mc7 protein [Mus musculus] 37 1.1
gi|11359685|pir||T49799 related to TOM1 protein [imported] - Neu... 37 1.1
gi|459931|gb|AAA40971.1| contiguous repeat polypeptide [Rattus n... 37 1.1
gi|462434|sp|P34099|KAPC_DICDI cAMP-dependent protein kinase cat... 37 1.1
gi|241277|gb|AAB20716.1| serine/threonine protein kinase [Dictyo... 37 1.1
gi|47568496|ref|ZP_00239196.1| spermine/spermidine synthase fami... 37 1.1
gi|34856350|ref|XP_344903.1| similar to nucleosome binding prote... 37 1.1
gi|42660863|ref|XP_064152.5| sarcalumenin [Homo sapiens] 37 1.1
gi|28828696|gb|AAM33200.2| similar to Dictyostelium discoideum (... 37 1.1
gi|39586236|emb|CAE66647.1| Hypothetical protein CBG11984 [Caeno... 37 1.1
gi|48825058|ref|ZP_00286355.1| hypothetical protein Efae03001634... 37 1.1
gi|39595378|emb|CAE60416.1| Hypothetical protein CBG04022 [Caeno... 37 1.1
gi|34525758|gb|AAQ73925.1| erythrocyte membrane protein 1 [Plasm... 37 1.1
gi|50255862|gb|EAL18593.1| hypothetical protein CNBJ0190 [Crypto... 37 1.1
gi|21703896|ref|NP_663424.1| ISG12 [Mus musculus] >gnl|BL_ORD_ID... 37 1.1
gi|17738251|ref|NP_524534.1| CG12878-PA [Drosophila melanogaster... 36 1.4
gi|17556242|ref|NP_497198.1| chromo domain containing protein (7... 36 1.4
gi|24660458|ref|NP_729301.1| CG17888-PD [Drosophila melanogaster... 36 1.4
gi|25009677|gb|AAN71015.1| AT02321p [Drosophila melanogaster] 36 1.4
gi|6979936|gb|AAF34661.1| split ends long isoform [Drosophila me... 36 1.4
gi|39583307|emb|CAE60099.1| Hypothetical protein CBG03627 [Caeno... 36 1.4
gi|283629|pir||S27770 hypothetical protein 1 - African malaria m... 36 1.4
gi|50305507|ref|XP_452713.1| unnamed protein product [Kluyveromy... 36 1.4
gi|17136772|ref|NP_476896.1| CG10385-PA [Drosophila melanogaster... 36 1.4
gi|41408365|ref|NP_961201.1| Rne [Mycobacterium avium subsp. par... 36 1.4
gi|24667937|ref|NP_524195.2| CG18023-PA [Drosophila melanogaster... 36 1.4
gi|18203740|gb|AAH21623.1| Hrc protein [Mus musculus] 36 1.4
gi|50794060|ref|XP_423656.1| PREDICTED: transitin [Gallus gallus] 36 1.4
gi|48098463|ref|XP_392066.1| similar to mblk-1 [Apis mellifera] 36 1.4
gi|50255928|gb|EAL18658.1| hypothetical protein CNBI3580 [Crypto... 36 1.4
gi|46442513|gb|EAL01802.1| hypothetical protein CaO19.4330 [Cand... 36 1.4
gi|45190780|ref|NP_985034.1| AER177Wp [Eremothecium gossypii] >g... 36 1.4
gi|11359485|pir||T49830 hypothetical protein B24H17.160 [importe... 36 1.4
gi|6467825|gb|AAF13218.1| Spen RNP motif protein long isoform [D... 36 1.4
gi|24580581|ref|NP_524718.2| CG18497-PB [Drosophila melanogaster... 36 1.4
gi|24580579|ref|NP_722615.1| CG18497-PA [Drosophila melanogaster... 36 1.4
gi|5326838|gb|AAD42061.1| histidine-rich calcium-binding protein... 36 1.4
gi|23618950|ref|NP_704912.1| erythrocyte membrane protein 1 (PfE... 36 1.4
gi|24580583|ref|NP_722616.1| CG18497-PC [Drosophila melanogaster... 36 1.4
gi|13182946|gb|AAK14999.1| centromere binding protein 1 [Candida... 36 1.4
gi|19882261|gb|AAC00208.2| paranemin [Gallus gallus] 36 1.4
gi|17507323|ref|NP_492340.1| microfibrillar-associated protein 1... 36 1.4
gi|50552342|ref|XP_503581.1| hypothetical protein [Yarrowia lipo... 36 1.4
gi|12083381|gb|AAG46367.1| antigen 38 [Trypanosoma cruzi] 36 1.4
gi|7657138|ref|NP_055313.1| golgi phosphoprotein 4; type II Golg... 36 1.4
gi|28828976|gb|AAO51556.1| similar to Plasmodium falciparum. Pro... 36 1.4
gi|1170022|sp|P08568|GRPA_RAT Submandibular gland secretory Glx-... 36 1.4
gi|45551990|ref|NP_733229.2| CG12878-PB [Drosophila melanogaster... 36 1.4
gi|24213723|ref|NP_711204.1| conserved hypothetical protein [Lep... 36 1.4
gi|23484531|gb|EAA19833.1| hypothetical protein [Plasmodium yoel... 36 1.4
gi|23508159|ref|NP_700829.1| liver stage antigen, putative [Plas... 36 1.4
gi|50288897|ref|XP_446878.1| unnamed protein product [Candida gl... 36 1.4
gi|24654914|ref|NP_728554.1| CG32479-PA [Drosophila melanogaster... 36 1.4
gi|6754242|ref|NP_034603.1| histidine rich calcium binding prote... 36 1.4
gi|15292093|gb|AAK93315.1| LD37788p [Drosophila melanogaster] 36 1.4
gi|47937638|gb|AAH72219.1| MGC81377 protein [Xenopus laevis] 36 1.4
gi|2623379|gb|AAC53447.1| sex determining protein [Mus musculus ... 36 1.4
gi|13936308|gb|AAK40307.1| putative methyl-binding domain protei... 36 1.8
gi|38102578|gb|EAA49399.1| hypothetical protein MG01057.4 [Magna... 36 1.8
gi|47085799|ref|NP_998238.1| zgc:55839 [Danio rerio] >gnl|BL_ORD... 36 1.8
gi|32398987|emb|CAD98452.1| hypothetical predicted protein, unkn... 36 1.8
gi|17510441|ref|NP_493439.1| putative protein, with a coiled coi... 36 1.8
gi|29251308|gb|EAA42790.1| GLP_574_10064_7116 [Giardia lamblia A... 36 1.8
gi|28850359|gb|AAM08459.2| similar to Plasmodium falciparum. Hyp... 36 1.8
gi|18859251|ref|NP_571235.1| POU domain gene 47 [Danio rerio] >g... 36 1.8
gi|46437429|gb|EAK96776.1| hypothetical protein CaO19.2859 [Cand... 36 1.8
gi|26337653|dbj|BAC32512.1| unnamed protein product [Mus musculus] 36 1.8
gi|49078526|ref|XP_403007.1| conserved hypothetical protein [Ust... 36 1.8
gi|17550832|ref|NP_509555.1| COLlagen structural gene (28.5 kD) ... 36 1.8
gi|24654487|ref|NP_611239.1| CG10936-PA [Drosophila melanogaster... 36 1.8
gi|42519391|ref|NP_965321.1| signal recognition particle recepto... 36 1.8
gi|32408173|ref|XP_324568.1| hypothetical protein [Neurospora cr... 36 1.8
gi|400685|sp|P31097|OSTP_RABIT Osteopontin precursor (Bone sialo... 36 1.8
gi|34863312|ref|XP_233971.2| similar to hypothetical protein [Ra... 36 1.8
gi|17552372|ref|NP_498729.1| COLlagen structural gene (30.6 kD) ... 36 1.8
gi|15613259|ref|NP_241562.1| prepro-alkaline protease [Bacillus ... 36 1.8
gi|13235235|emb|CAC33514.1| STATc protein [Dictyostelium discoid... 36 1.8
gi|46444759|gb|EAL04032.1| hypothetical protein CaO19.4697 [Cand... 36 1.8
gi|46229165|gb|EAK90014.1| hypothetical protein cgd6_4110 [Crypt... 36 1.8
gi|124737|sp|P24712|INVO_SAGOE Involucrin >gnl|BL_ORD_ID|574947 ... 36 1.8
gi|124730|sp|P24710|INVO_GALCR Involucrin >gnl|BL_ORD_ID|1873056... 36 1.8
gi|46444158|gb|EAL03435.1| hypothetical protein CaO19.4998 [Cand... 36 1.8
gi|38105246|gb|EAA51693.1| hypothetical protein MG03288.4 [Magna... 36 1.8
gi|26000366|gb|AAN75481.1| dentin matrix protein 1 [Desmodus rot... 36 1.8
gi|47220715|emb|CAG11784.1| unnamed protein product [Tetraodon n... 36 1.8
gi|41203898|ref|XP_372522.1| similar to Plasmodium falciparum tr... 36 1.8
gi|46432300|gb|EAK91789.1| hypothetical protein CaO19.9401 [Cand... 36 1.8
gi|50305113|ref|XP_452515.1| unnamed protein product [Kluyveromy... 36 1.8
gi|46444915|gb|EAL04187.1| hypothetical protein CaO19.12167 [Can... 36 1.8
gi|38099407|gb|EAA46758.1| predicted protein [Magnaporthe grisea... 36 1.8
gi|38103658|gb|EAA50334.1| hypothetical protein MG04093.4 [Magna... 35 2.4
gi|34852027|ref|NP_038763.2| transformation related protein 53 b... 35 2.4
gi|26000360|gb|AAN75476.1| dentin matrix protein 1 [Natalus micr... 35 2.4
gi|26326767|dbj|BAC27127.1| unnamed protein product [Mus musculus] 35 2.4
gi|50550003|ref|XP_502474.1| hypothetical protein [Yarrowia lipo... 35 2.4
gi|29290093|gb|AAO67564.1| Pol protein [Drosophila virilis] 35 2.4
gi|9454386|gb|AAF87782.1| p76 membrane protein precursor [Mycopl... 35 2.4
gi|47223366|emb|CAG04227.1| unnamed protein product [Tetraodon n... 35 2.4
gi|47228176|emb|CAG07571.1| unnamed protein product [Tetraodon n... 35 2.4
gi|42733860|gb|AAS38778.1| similar to exonuclease ii [Schizosacc... 35 2.4
gi|24662559|ref|NP_729679.1| CG32082-PA [Drosophila melanogaster... 35 2.4
gi|46437481|gb|EAK96827.1| hypothetical protein CaO19.10377 [Can... 35 2.4
gi|18858669|ref|NP_571631.1| faciogenital dysplasia [Danio rerio... 35 2.4
gi|34534595|dbj|BAC87055.1| unnamed protein product [Homo sapiens] 35 2.4
gi|16762082|ref|NP_457699.1| RNA polymerase sigma-54 factor (sig... 35 2.4
gi|45185072|ref|NP_982789.1| ABL158Cp [Eremothecium gossypii] >g... 35 2.4
gi|47198791|emb|CAF89278.1| unnamed protein product [Tetraodon n... 35 2.4
gi|46431839|gb|EAK91363.1| hypothetical protein CaO19.187 [Candi... 35 2.4
gi|17535069|ref|NP_496535.1| COLlagen structural gene (col-84) [... 35 2.4
gi|39587623|emb|CAE58561.1| Hypothetical protein CBG01723 [Caeno... 35 2.4
gi|126169|sp|P14594|LEGB_PEA Legumin B [Contains: Legumin B alph... 35 2.4
gi|39580477|emb|CAE60709.1| Hypothetical protein CBG04377 [Caeno... 35 2.4
gi|33303450|gb|AAQ02301.1| dentin matrix protein 1 [Scotinomys t... 35 2.4
gi|7494885|pir||T15348 hypothetical protein B0350.1 - Caenorhabd... 35 2.4
gi|17025966|dbj|BAB72094.1| histone acetyltransferase MORF [Maca... 35 2.4
gi|39586197|emb|CAE66608.1| Hypothetical protein CBG11934 [Caeno... 35 2.4
gi|32565935|ref|NP_500902.2| UNCoordinated locomotion UNC-44, an... 35 2.4
gi|23820861|gb|AAA93447.2| Uncoordinated protein 44, isoform f [... 35 2.4
gi|23509035|ref|NP_701703.1| hypothetical protein [Plasmodium fa... 35 2.4
gi|29828894|ref|NP_823528.1| hypothetical protein SAV2352 [Strep... 35 2.4
gi|134874|sp|P16230|SRCH_RABIT Sarcoplasmic reticulum histidine-... 35 2.4
gi|33303456|gb|AAQ02304.1| dentin matrix protein 1 [Holochilus s... 35 2.4
gi|50288783|ref|XP_446821.1| unnamed protein product [Candida gl... 35 2.4
gi|50554551|ref|XP_504684.1| hypothetical protein [Yarrowia lipo... 35 2.4
gi|13432169|sp|O14164|IF38_SCHPO Probable eukaryotic translation... 35 3.1
gi|45356830|gb|AAS58454.1| DIPB protein [Rattus norvegicus] 35 3.1
gi|34853998|ref|XP_238336.2| similar to serine/arginine-rich pro... 35 3.1
gi|24308177|ref|NP_060439.1| hypothetical protein FLJ10006 [Homo... 35 3.1
gi|39589674|emb|CAE66909.1| Hypothetical protein CBG12293 [Caeno... 35 3.1
gi|50730849|ref|XP_417045.1| PREDICTED: similar to KIAA0853 prot... 35 3.1
gi|25148528|ref|NP_741130.1| putative protein, with 2 coiled coi... 35 3.1
gi|39590997|emb|CAE58777.1| Hypothetical protein CBG01972 [Caeno... 35 3.1
gi|17557220|ref|NP_505647.1| COLlagen structural gene (col-150) ... 35 3.1
gi|17557218|ref|NP_505646.1| COLlagen structural gene (30.6 kD) ... 35 3.1
>gi|17540706|ref|NP_499982.1| COLlagen structural gene (33.8 kD)
(col-103) [Caenorhabditis elegans]
gi|25385141|pir||E88633 protein F56B3.1 [imported] - Caenorhabditis
elegans
gi|13559616|gb|AAK29827.1| Collagen protein 103 [Caenorhabditis
elegans]
Length = 371
Score = 159 bits (403), Expect = 8e-38
Identities = 93/156 (59%), Positives = 93/156 (59%)
Frame = -1
Query: 1116 MSASIKFATGAAVLSGVTILACLFFAAQVFNDVNSLYDEVMVDMDAFKVKSNIAWEAIND 937
MSASIKFATGAAVLSGVTILACLFFAAQVFNDVNSLYDEVMVDMDAFKVKSNIAWEAIND
Sbjct: 1 MSASIKFATGAAVLSGVTILACLFFAAQVFNDVNSLYDEVMVDMDAFKVKSNIAWEAIND 60
Query: 936 VIAPNREKRGYAQYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 757
VIAPNREKRGYAQY
Sbjct: 61 VIAPNREKRGYAQYGGGGGYGGGHGGAAVGGGYGGAVGGGGGGGYGGGHGGGHGGAVGGG 120
Query: 756 XXXXXXXXXGCQCSPSSNTCXXXXXXXXGQAGLDGL 649
GCQCSPSSNTC GQAGLDGL
Sbjct: 121 YGGGGGGGGGCQCSPSSNTCPPGPRGPPGQAGLDGL 156