Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F56D1_7
(444 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|21264518|sp|Q10129|RT16_CAEEL Probable mitochondrial 28S ribo... 265 1e-70
gi|7504408|pir||T30112 hypothetical protein F56D1.3 - Caenorhabd... 259 8e-69
gi|39596885|emb|CAE59112.1| Hypothetical protein CBG02407 [Caeno... 246 7e-65
gi|17647683|ref|NP_523737.1| CG8338-PA [Drosophila melanogaster]... 108 2e-23
gi|31228067|ref|XP_317991.1| ENSANGP00000010687 [Anopheles gambi... 102 1e-21
gi|48098065|ref|XP_393967.1| similar to ENSANGP00000010687 [Apis... 99 2e-20
gi|13384844|ref|NP_079716.1| mitochondrial ribosomal protein S16... 96 1e-19
gi|7705626|ref|NP_057149.1| mitochondrial ribosomal protein S16;... 95 3e-19
gi|47207041|emb|CAF96018.1| unnamed protein product [Tetraodon n... 94 4e-19
gi|27673455|ref|XP_214132.1| similar to mitochondrial ribosomal ... 93 1e-18
gi|38077904|ref|XP_109386.2| similar to mitochondrial ribosomal ... 77 7e-14
gi|21554119|gb|AAM63199.1| 30S ribosomal protein S16 [Arabidopsi... 63 1e-09
gi|15241991|ref|NP_200504.1| ribosomal protein S16 family protei... 63 1e-09
gi|34905148|ref|NP_913921.1| 30S ribosomal protein S16-like [Ory... 60 7e-09
gi|15236166|ref|NP_195188.1| ribosomal protein S16 family protei... 57 6e-08
gi|48765006|ref|ZP_00269557.1| COG0228: Ribosomal protein S16 [R... 55 4e-07
gi|34499130|ref|NP_903345.1| 30S ribosomal protein S16 [Chromoba... 52 2e-06
gi|15676497|ref|NP_273636.1| 30S ribosomal protein S16 [Neisseri... 51 4e-06
gi|15893282|ref|NP_360996.1| 30S ribosomal protein S16 [Ricketts... 48 5e-05
gi|42520636|ref|NP_966551.1| ribosomal protein S16 [Wolbachia en... 47 6e-05
gi|50552670|ref|XP_503745.1| hypothetical protein [Yarrowia lipo... 47 8e-05
gi|32416598|ref|XP_328777.1| MITOCHONDRIAL RIBOSOMAL PROTEIN S24... 46 2e-04
gi|46308936|ref|ZP_00211128.1| COG0228: Ribosomal protein S16 [E... 45 2e-04
gi|49476254|ref|YP_034295.1| 30S ribosomal protein s16 [Bartonel... 45 4e-04
gi|19112022|ref|NP_595230.1| mitochondrial ribosomal protein S16... 45 4e-04
gi|48849818|ref|ZP_00304061.1| COG0228: Ribosomal protein S16 [N... 45 4e-04
gi|21672655|ref|NP_660722.1| ribosomal protein S16 [Buchnera aph... 44 5e-04
gi|15604706|ref|NP_221224.1| 30S RIBOSOMAL PROTEIN S16 (rpsP) [R... 44 5e-04
gi|49474774|ref|YP_032816.1| 30s ribosomal protein s16 [Bartonel... 44 9e-04
gi|45916818|ref|ZP_00195856.2| COG0228: Ribosomal protein S16 [M... 43 0.001
gi|26248972|ref|NP_755012.1| 30S ribosomal protein S16 [Escheric... 43 0.001
gi|39933321|ref|NP_945597.1| ribosomal protein S16 [Rhodopseudom... 43 0.001
gi|16761529|ref|NP_457146.1| 30S ribosomal subunit protein S16 [... 43 0.001
gi|15803131|ref|NP_289162.1| 30S ribosomal subunit protein S16 [... 43 0.001
gi|1800014|dbj|BAA16494.1| 30S RIBOSOMAL PROTEIN S16. [Escherich... 43 0.001
gi|32477732|ref|NP_870726.1| probable 30S ribosomal protein S16 ... 43 0.002
gi|37525224|ref|NP_928568.1| ribosomal protein S16 [Photorhabdus... 42 0.002
gi|48861320|ref|ZP_00315223.1| COG0228: Ribosomal protein S16 [M... 42 0.002
gi|50293487|ref|XP_449155.1| unnamed protein product [Candida gl... 42 0.002
gi|46135845|ref|XP_389614.1| hypothetical protein FG09438.1 [Gib... 42 0.003
gi|50312513|ref|XP_456292.1| unnamed protein product [Kluyveromy... 42 0.003
gi|46914590|emb|CAG21369.1| putative ribosomal protein S16 [Phot... 41 0.004
gi|46188389|ref|ZP_00125780.2| COG0228: Ribosomal protein S16 [P... 41 0.004
gi|16123448|ref|NP_406761.1| 30S ribosomal protein S16 [Yersinia... 41 0.004
gi|50425429|ref|XP_461308.1| unnamed protein product [Debaryomyc... 41 0.004
gi|28868680|ref|NP_791299.1| ribosomal protein S16 [Pseudomonas ... 41 0.006
gi|46192411|ref|ZP_00006761.2| COG0228: Ribosomal protein S16 [R... 41 0.006
gi|32029439|ref|ZP_00132462.1| COG0228: Ribosomal protein S16 [H... 41 0.006
gi|31196095|ref|XP_306995.1| ENSANGP00000016416 [Anopheles gambi... 41 0.006
gi|27375593|ref|NP_767122.1| 30S ribosomal protein S16 [Bradyrhi... 40 0.010
gi|23105147|ref|ZP_00091605.1| COG0228: Ribosomal protein S16 [A... 40 0.010
gi|50122281|ref|YP_051448.1| 30S ribosomal protein S16 [Erwinia ... 40 0.010
gi|26988195|ref|NP_743620.1| ribosomal protein S16 [Pseudomonas ... 40 0.013
gi|28899307|ref|NP_798912.1| ribosomal protein S16 [Vibrio parah... 40 0.013
gi|31076913|sp|Q88MV6|RS16_PSEPK 30S ribosomal protein S16 40 0.013
gi|24372935|ref|NP_716977.1| ribosomal protein S16 [Shewanella o... 40 0.013
gi|17986511|ref|NP_539145.1| SSU ribosomal protein S16P [Brucell... 39 0.017
gi|27364979|ref|NP_760507.1| Ribosomal protein S16 [Vibrio vulni... 39 0.017
gi|23014874|ref|ZP_00054670.1| COG0228: Ribosomal protein S16 [M... 39 0.017
gi|48844430|ref|ZP_00298742.1| COG0228: Ribosomal protein S16 [G... 39 0.017
gi|33519644|ref|NP_878476.1| 30S ribosomal subunit protein S16 [... 39 0.017
gi|15616998|ref|NP_240211.1| 30S ribosomal protein S16 [Buchnera... 39 0.022
gi|47572562|ref|ZP_00242605.1| COG0228: Ribosomal protein S16 [R... 39 0.029
gi|16272167|ref|NP_438373.1| ribosomal protein S16 [Haemophilus ... 39 0.029
gi|13473696|ref|NP_105264.1| ribosomal protein S16 [Mesorhizobiu... 39 0.029
gi|15603880|ref|NP_246232.1| ribosomal protein S16 [Pasteurella ... 38 0.049
gi|41690524|ref|ZP_00147056.1| COG0228: Ribosomal protein S16 [P... 38 0.049
gi|15598940|ref|NP_252434.1| 30S ribosomal protein S16 [Pseudomo... 38 0.049
gi|42630507|ref|ZP_00156046.1| COG0228: Ribosomal protein S16 [H... 38 0.049
gi|21230656|ref|NP_636573.1| 30S ribosomal protein S16 [Xanthomo... 37 0.064
gi|15640583|ref|NP_230212.1| ribosomal protein S16 [Vibrio chole... 37 0.064
gi|39995749|ref|NP_951700.1| ribosomal protein S16 [Geobacter su... 37 0.083
gi|41723945|ref|ZP_00150835.1| COG0228: Ribosomal protein S16 [D... 37 0.11
gi|50086298|ref|YP_047808.1| 30S ribosomal protein S16 [Acinetob... 37 0.11
gi|24379319|ref|NP_721274.1| 30S ribosomal protein S16 [Streptoc... 37 0.11
gi|21242045|ref|NP_641627.1| 30S ribosomal protein S16 [Xanthomo... 36 0.14
gi|27904845|ref|NP_777971.1| 30S ribosomal protein S16 [Buchnera... 36 0.14
gi|46164433|ref|ZP_00137139.2| COG0228: Ribosomal protein S16 [P... 35 0.24
gi|23508366|ref|NP_701035.1| heat shock protein 101, putative [P... 35 0.24
gi|16127882|ref|NP_422446.1| ribosomal protein S16 [Caulobacter ... 35 0.24
gi|48865301|ref|ZP_00319163.1| COG0228: Ribosomal protein S16 [O... 35 0.32
gi|15673551|ref|NP_267725.1| 30S ribosomal protein S16 [Lactococ... 35 0.32
gi|15792059|ref|NP_281882.1| 30S ribosomal protein S16 [Campylob... 35 0.32
gi|29653790|ref|NP_819482.1| ribosomal protein S16 [Coxiella bur... 35 0.32
gi|50255464|gb|EAL18199.1| hypothetical protein CNBK2170 [Crypto... 35 0.32
gi|50877689|emb|CAG37529.1| probable 30S ribosomal protein S16 [... 35 0.41
gi|34541696|ref|NP_906175.1| ribosomal protein S16 [Porphyromona... 34 0.54
gi|42523590|ref|NP_968970.1| 30S ribosomal protein S16 [Bdellovi... 34 0.71
gi|32034692|ref|ZP_00134830.1| COG0228: Ribosomal protein S16 [A... 34 0.71
gi|49068780|ref|XP_398679.1| hypothetical protein UM01064.1 [Ust... 33 0.92
gi|42519387|ref|NP_965317.1| 30S ribosomal protein S16 [Lactobac... 33 0.92
gi|33152927|ref|NP_874280.1| 30S ribosomal protein S16 [Haemophi... 33 0.92
gi|22537505|ref|NP_688356.1| ribosomal protein S16 [Streptococcu... 33 0.92
gi|14195200|sp|Q9L9C8|RS16_THIFE 30S ribosomal protein S16 >gnl|... 33 0.92
gi|38100189|gb|EAA47355.1| hypothetical protein MG02598.4 [Magna... 33 0.92
gi|39588370|emb|CAE72721.1| Hypothetical protein CBG19958 [Caeno... 33 1.2
gi|15674875|ref|NP_269049.1| 30S ribosomal protein S16 [Streptoc... 33 1.6
gi|23480959|gb|EAA17380.1| clpB protein [Plasmodium yoelii yoelii] 32 2.7
gi|14028365|dbj|BAB54941.1| mitochondrial ribosomal protein S16 ... 31 4.6
gi|15900669|ref|NP_345273.1| ribosomal protein S16 [Streptococcu... 31 4.6
gi|15892189|ref|NP_359903.1| excinuclease ABC subunit B [Rickett... 31 6.0
gi|15924228|ref|NP_371762.1| 30S ribosomal protein S16 [Staphylo... 31 6.0
gi|23098987|ref|NP_692453.1| 30S ribosomal protein S16 [Oceanoba... 31 6.0
gi|26553554|ref|NP_757488.1| ribosomal protein S16 [Mycoplasma p... 31 6.0
gi|15426034|gb|AAK97659.1| steroidogenic factor 1 [Taeniopygia g... 30 7.8
gi|49904647|gb|AAH76615.1| Zfml protein [Mus musculus] 30 7.8
gi|24583848|ref|NP_609552.1| CG17211-PA [Drosophila melanogaster... 30 7.8
gi|50365359|ref|YP_053784.1| 30S ribosomal protein S16 [Mesoplas... 30 7.8
gi|29376248|ref|NP_815402.1| ribosomal protein S16 [Enterococcus... 30 7.8
gi|15925347|ref|NP_372881.1| TcaR transcription regulator [Staph... 30 7.8
gi|6679098|ref|NP_032743.1| zinc finger, matrin-like; nuclear pr... 30 7.8
gi|48853584|ref|ZP_00307752.1| COG1220: ATP-dependent protease H... 30 7.8
>gi|21264518|sp|Q10129|RT16_CAEEL Probable mitochondrial 28S
ribosomal protein S16 (MRP-S16)
gi|15718598|gb|AAA81099.2| Hypothetical protein F56D1.3
[Caenorhabditis elegans]
Length = 147
Score = 265 bits (678), Expect = 1e-70
Identities = 130/147 (88%), Positives = 130/147 (88%)
Frame = +1
Query: 1 MRKLVIPKYYGRPSIGLALFGCTNRPFYHVCVFPDRALGRRYEGNILEQVGTFDPLPNQK 180
MRKLVIPKYYGRPSIGLALFGCTNRPFYHVCVFPDRALGRRYEGNILEQVGTFDPLPNQK
Sbjct: 1 MRKLVIPKYYGRPSIGLALFGCTNRPFYHVCVFPDRALGRRYEGNILEQVGTFDPLPNQK 60
Query: 181 NEKLVALNFGRLKYWIGERNAHISVPVLELLGLSGLFPIHPKSFIRAKDNRALIADQQLX 360
NEKLVALNFGRLKYWIGERNAHISVPVLELLGLSGLFPIHPKSFIRAKDNRALIADQQL
Sbjct: 61 NEKLVALNFGRLKYWIGERNAHISVPVLELLGLSGLFPIHPKSFIRAKDNRALIADQQLK 120
Query: 361 XXXXXXXXXXXXXXXXSTGAAATSHPQ 441
STGAAATSHPQ
Sbjct: 121 VAAEAAEAEKVAQEQASTGAAATSHPQ 147