Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= F56D1_7
         (444 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|21264518|sp|Q10129|RT16_CAEEL Probable mitochondrial 28S ribo...   265   1e-70
gi|7504408|pir||T30112 hypothetical protein F56D1.3 - Caenorhabd...   259   8e-69
gi|39596885|emb|CAE59112.1| Hypothetical protein CBG02407 [Caeno...   246   7e-65
gi|17647683|ref|NP_523737.1| CG8338-PA [Drosophila melanogaster]...   108   2e-23
gi|31228067|ref|XP_317991.1| ENSANGP00000010687 [Anopheles gambi...   102   1e-21
gi|48098065|ref|XP_393967.1| similar to ENSANGP00000010687 [Apis...    99   2e-20
gi|13384844|ref|NP_079716.1| mitochondrial ribosomal protein S16...    96   1e-19
gi|7705626|ref|NP_057149.1| mitochondrial ribosomal protein S16;...    95   3e-19
gi|47207041|emb|CAF96018.1| unnamed protein product [Tetraodon n...    94   4e-19
gi|27673455|ref|XP_214132.1| similar to mitochondrial ribosomal ...    93   1e-18
gi|38077904|ref|XP_109386.2| similar to mitochondrial ribosomal ...    77   7e-14
gi|21554119|gb|AAM63199.1| 30S ribosomal protein S16 [Arabidopsi...    63   1e-09
gi|15241991|ref|NP_200504.1| ribosomal protein S16 family protei...    63   1e-09
gi|34905148|ref|NP_913921.1| 30S ribosomal protein S16-like [Ory...    60   7e-09
gi|15236166|ref|NP_195188.1| ribosomal protein S16 family protei...    57   6e-08
gi|48765006|ref|ZP_00269557.1| COG0228: Ribosomal protein S16 [R...    55   4e-07
gi|34499130|ref|NP_903345.1| 30S ribosomal protein S16 [Chromoba...    52   2e-06
gi|15676497|ref|NP_273636.1| 30S ribosomal protein S16 [Neisseri...    51   4e-06
gi|15893282|ref|NP_360996.1| 30S ribosomal protein S16 [Ricketts...    48   5e-05
gi|42520636|ref|NP_966551.1| ribosomal protein S16 [Wolbachia en...    47   6e-05
gi|50552670|ref|XP_503745.1| hypothetical protein [Yarrowia lipo...    47   8e-05
gi|32416598|ref|XP_328777.1| MITOCHONDRIAL RIBOSOMAL PROTEIN S24...    46   2e-04
gi|46308936|ref|ZP_00211128.1| COG0228: Ribosomal protein S16 [E...    45   2e-04
gi|49476254|ref|YP_034295.1| 30S ribosomal protein s16 [Bartonel...    45   4e-04
gi|19112022|ref|NP_595230.1| mitochondrial ribosomal protein S16...    45   4e-04
gi|48849818|ref|ZP_00304061.1| COG0228: Ribosomal protein S16 [N...    45   4e-04
gi|21672655|ref|NP_660722.1| ribosomal protein S16 [Buchnera aph...    44   5e-04
gi|15604706|ref|NP_221224.1| 30S RIBOSOMAL PROTEIN S16 (rpsP) [R...    44   5e-04
gi|49474774|ref|YP_032816.1| 30s ribosomal protein s16 [Bartonel...    44   9e-04
gi|45916818|ref|ZP_00195856.2| COG0228: Ribosomal protein S16 [M...    43   0.001
gi|26248972|ref|NP_755012.1| 30S ribosomal protein S16 [Escheric...    43   0.001
gi|39933321|ref|NP_945597.1| ribosomal protein S16 [Rhodopseudom...    43   0.001
gi|16761529|ref|NP_457146.1| 30S ribosomal subunit protein S16 [...    43   0.001
gi|15803131|ref|NP_289162.1| 30S ribosomal subunit protein S16 [...    43   0.001
gi|1800014|dbj|BAA16494.1| 30S RIBOSOMAL PROTEIN S16. [Escherich...    43   0.001
gi|32477732|ref|NP_870726.1| probable 30S ribosomal protein S16 ...    43   0.002
gi|37525224|ref|NP_928568.1| ribosomal protein S16 [Photorhabdus...    42   0.002
gi|48861320|ref|ZP_00315223.1| COG0228: Ribosomal protein S16 [M...    42   0.002
gi|50293487|ref|XP_449155.1| unnamed protein product [Candida gl...    42   0.002
gi|46135845|ref|XP_389614.1| hypothetical protein FG09438.1 [Gib...    42   0.003
gi|50312513|ref|XP_456292.1| unnamed protein product [Kluyveromy...    42   0.003
gi|46914590|emb|CAG21369.1| putative ribosomal protein S16 [Phot...    41   0.004
gi|46188389|ref|ZP_00125780.2| COG0228: Ribosomal protein S16 [P...    41   0.004
gi|16123448|ref|NP_406761.1| 30S ribosomal protein S16 [Yersinia...    41   0.004
gi|50425429|ref|XP_461308.1| unnamed protein product [Debaryomyc...    41   0.004
gi|28868680|ref|NP_791299.1| ribosomal protein S16 [Pseudomonas ...    41   0.006
gi|46192411|ref|ZP_00006761.2| COG0228: Ribosomal protein S16 [R...    41   0.006
gi|32029439|ref|ZP_00132462.1| COG0228: Ribosomal protein S16 [H...    41   0.006
gi|31196095|ref|XP_306995.1| ENSANGP00000016416 [Anopheles gambi...    41   0.006
gi|27375593|ref|NP_767122.1| 30S ribosomal protein S16 [Bradyrhi...    40   0.010
gi|23105147|ref|ZP_00091605.1| COG0228: Ribosomal protein S16 [A...    40   0.010
gi|50122281|ref|YP_051448.1| 30S ribosomal protein S16 [Erwinia ...    40   0.010
gi|26988195|ref|NP_743620.1| ribosomal protein S16 [Pseudomonas ...    40   0.013
gi|28899307|ref|NP_798912.1| ribosomal protein S16 [Vibrio parah...    40   0.013
gi|31076913|sp|Q88MV6|RS16_PSEPK 30S ribosomal protein S16             40   0.013
gi|24372935|ref|NP_716977.1| ribosomal protein S16 [Shewanella o...    40   0.013
gi|17986511|ref|NP_539145.1| SSU ribosomal protein S16P [Brucell...    39   0.017
gi|27364979|ref|NP_760507.1| Ribosomal protein S16 [Vibrio vulni...    39   0.017
gi|23014874|ref|ZP_00054670.1| COG0228: Ribosomal protein S16 [M...    39   0.017
gi|48844430|ref|ZP_00298742.1| COG0228: Ribosomal protein S16 [G...    39   0.017
gi|33519644|ref|NP_878476.1| 30S ribosomal subunit protein S16 [...    39   0.017
gi|15616998|ref|NP_240211.1| 30S ribosomal protein S16 [Buchnera...    39   0.022
gi|47572562|ref|ZP_00242605.1| COG0228: Ribosomal protein S16 [R...    39   0.029
gi|16272167|ref|NP_438373.1| ribosomal protein S16 [Haemophilus ...    39   0.029
gi|13473696|ref|NP_105264.1| ribosomal protein S16 [Mesorhizobiu...    39   0.029
gi|15603880|ref|NP_246232.1| ribosomal protein S16 [Pasteurella ...    38   0.049
gi|41690524|ref|ZP_00147056.1| COG0228: Ribosomal protein S16 [P...    38   0.049
gi|15598940|ref|NP_252434.1| 30S ribosomal protein S16 [Pseudomo...    38   0.049
gi|42630507|ref|ZP_00156046.1| COG0228: Ribosomal protein S16 [H...    38   0.049
gi|21230656|ref|NP_636573.1| 30S ribosomal protein S16 [Xanthomo...    37   0.064
gi|15640583|ref|NP_230212.1| ribosomal protein S16 [Vibrio chole...    37   0.064
gi|39995749|ref|NP_951700.1| ribosomal protein S16 [Geobacter su...    37   0.083
gi|41723945|ref|ZP_00150835.1| COG0228: Ribosomal protein S16 [D...    37   0.11
gi|50086298|ref|YP_047808.1| 30S ribosomal protein S16 [Acinetob...    37   0.11
gi|24379319|ref|NP_721274.1| 30S ribosomal protein S16 [Streptoc...    37   0.11
gi|21242045|ref|NP_641627.1| 30S ribosomal protein S16 [Xanthomo...    36   0.14
gi|27904845|ref|NP_777971.1| 30S ribosomal protein S16 [Buchnera...    36   0.14
gi|46164433|ref|ZP_00137139.2| COG0228: Ribosomal protein S16 [P...    35   0.24
gi|23508366|ref|NP_701035.1| heat shock protein 101, putative [P...    35   0.24
gi|16127882|ref|NP_422446.1| ribosomal protein S16 [Caulobacter ...    35   0.24
gi|48865301|ref|ZP_00319163.1| COG0228: Ribosomal protein S16 [O...    35   0.32
gi|15673551|ref|NP_267725.1| 30S ribosomal protein S16 [Lactococ...    35   0.32
gi|15792059|ref|NP_281882.1| 30S ribosomal protein S16 [Campylob...    35   0.32
gi|29653790|ref|NP_819482.1| ribosomal protein S16 [Coxiella bur...    35   0.32
gi|50255464|gb|EAL18199.1| hypothetical protein CNBK2170 [Crypto...    35   0.32
gi|50877689|emb|CAG37529.1| probable 30S ribosomal protein S16 [...    35   0.41
gi|34541696|ref|NP_906175.1| ribosomal protein S16 [Porphyromona...    34   0.54
gi|42523590|ref|NP_968970.1| 30S ribosomal protein S16 [Bdellovi...    34   0.71
gi|32034692|ref|ZP_00134830.1| COG0228: Ribosomal protein S16 [A...    34   0.71
gi|49068780|ref|XP_398679.1| hypothetical protein UM01064.1 [Ust...    33   0.92
gi|42519387|ref|NP_965317.1| 30S ribosomal protein S16 [Lactobac...    33   0.92
gi|33152927|ref|NP_874280.1| 30S ribosomal protein S16 [Haemophi...    33   0.92
gi|22537505|ref|NP_688356.1| ribosomal protein S16 [Streptococcu...    33   0.92
gi|14195200|sp|Q9L9C8|RS16_THIFE 30S ribosomal protein S16 >gnl|...    33   0.92
gi|38100189|gb|EAA47355.1| hypothetical protein MG02598.4 [Magna...    33   0.92
gi|39588370|emb|CAE72721.1| Hypothetical protein CBG19958 [Caeno...    33   1.2
gi|15674875|ref|NP_269049.1| 30S ribosomal protein S16 [Streptoc...    33   1.6
gi|23480959|gb|EAA17380.1| clpB protein [Plasmodium yoelii yoelii]     32   2.7
gi|14028365|dbj|BAB54941.1| mitochondrial ribosomal protein S16 ...    31   4.6
gi|15900669|ref|NP_345273.1| ribosomal protein S16 [Streptococcu...    31   4.6
gi|15892189|ref|NP_359903.1| excinuclease ABC subunit B [Rickett...    31   6.0
gi|15924228|ref|NP_371762.1| 30S ribosomal protein S16 [Staphylo...    31   6.0
gi|23098987|ref|NP_692453.1| 30S ribosomal protein S16 [Oceanoba...    31   6.0
gi|26553554|ref|NP_757488.1| ribosomal protein S16 [Mycoplasma p...    31   6.0
gi|15426034|gb|AAK97659.1| steroidogenic factor 1 [Taeniopygia g...    30   7.8
gi|49904647|gb|AAH76615.1| Zfml protein [Mus musculus]                 30   7.8
gi|24583848|ref|NP_609552.1| CG17211-PA [Drosophila melanogaster...    30   7.8
gi|50365359|ref|YP_053784.1| 30S ribosomal protein S16 [Mesoplas...    30   7.8
gi|29376248|ref|NP_815402.1| ribosomal protein S16 [Enterococcus...    30   7.8
gi|15925347|ref|NP_372881.1| TcaR transcription regulator [Staph...    30   7.8
gi|6679098|ref|NP_032743.1| zinc finger, matrin-like; nuclear pr...    30   7.8
gi|48853584|ref|ZP_00307752.1| COG1220: ATP-dependent protease H...    30   7.8


>gi|21264518|sp|Q10129|RT16_CAEEL Probable mitochondrial 28S
           ribosomal protein S16 (MRP-S16)
 gi|15718598|gb|AAA81099.2| Hypothetical protein F56D1.3
           [Caenorhabditis elegans]
          Length = 147

 Score =  265 bits (678), Expect = 1e-70
 Identities = 130/147 (88%), Positives = 130/147 (88%)
 Frame = +1

Query: 1   MRKLVIPKYYGRPSIGLALFGCTNRPFYHVCVFPDRALGRRYEGNILEQVGTFDPLPNQK 180
           MRKLVIPKYYGRPSIGLALFGCTNRPFYHVCVFPDRALGRRYEGNILEQVGTFDPLPNQK
Sbjct: 1   MRKLVIPKYYGRPSIGLALFGCTNRPFYHVCVFPDRALGRRYEGNILEQVGTFDPLPNQK 60

Query: 181 NEKLVALNFGRLKYWIGERNAHISVPVLELLGLSGLFPIHPKSFIRAKDNRALIADQQLX 360
           NEKLVALNFGRLKYWIGERNAHISVPVLELLGLSGLFPIHPKSFIRAKDNRALIADQQL
Sbjct: 61  NEKLVALNFGRLKYWIGERNAHISVPVLELLGLSGLFPIHPKSFIRAKDNRALIADQQLK 120

Query: 361 XXXXXXXXXXXXXXXXSTGAAATSHPQ 441
                           STGAAATSHPQ
Sbjct: 121 VAAEAAEAEKVAQEQASTGAAATSHPQ 147




[DB home][top]