Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F56E10_3
(252 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17563244|ref|NP_503134.1| ribosomal Protein, Small subunit (9... 143 8e-34
gi|39592748|emb|CAE62362.1| Hypothetical protein CBG06446 [Caeno... 139 2e-32
gi|2500500|sp|P55833|RS27_HOMAM 40S ribosomal protein S27 >gnl|B... 118 3e-26
gi|15213840|gb|AAK92195.1| ribosomal protein S27 [Spodoptera fru... 116 1e-25
gi|24649976|ref|NP_651359.1| CG10423-PA [Drosophila melanogaster... 114 5e-25
gi|47219459|emb|CAG10823.1| unnamed protein product [Tetraodon n... 114 7e-25
gi|4506711|ref|NP_001021.1| ribosomal protein S27; metallopansti... 114 7e-25
gi|41152144|ref|NP_957059.1| hypothetical protein MGC73262 [Dani... 113 9e-25
gi|1350972|sp|P47904|RS27_XENLA 40S ribosomal protein S27 >gnl|B... 113 9e-25
gi|15294069|gb|AAK95211.1| 40S ribosomal protein S27-2 [Ictaluru... 113 9e-25
gi|13559175|emb|CAC36086.1| dJ423B22.4 (ribosomal protein S27 (m... 112 2e-24
gi|27362936|gb|AAN86980.1| ribosomal protein S27 [Branchiostoma ... 112 2e-24
gi|31199327|ref|XP_308611.1| ENSANGP00000019453 [Anopheles gambi... 112 3e-24
gi|41193234|ref|XP_371630.1| similar to ribosomal protein S27 [H... 111 5e-24
gi|20530722|gb|AAM27204.1| 40s ribosomal protein S27 [Epinephelu... 110 6e-24
gi|47225371|emb|CAG11854.1| unnamed protein product [Tetraodon n... 110 8e-24
gi|15294067|gb|AAK95210.1| 40S ribosomal protein S27-1 [Ictaluru... 110 8e-24
gi|50752813|ref|XP_413758.1| PREDICTED: similar to 40S ribosomal... 109 1e-23
gi|2340032|emb|CAA04549.1| Sr-mps-1 protein [Strongyloides ratti] 109 1e-23
gi|22203724|gb|AAM94274.1| ribosomal protein S27E [Chlamys farreri] 108 3e-23
gi|7705706|ref|NP_057004.1| ribosomal protein S27-like protein; ... 108 3e-23
gi|22758878|gb|AAN05598.1| ribosomal protein S27-1 [Argopecten i... 108 3e-23
gi|40643018|emb|CAD91436.1| ribosomal protein S27-1 [Crassostrea... 108 4e-23
gi|13277528|gb|AAH03667.1| Ribosomal protein S27-like protein [H... 108 4e-23
gi|49069922|ref|XP_399250.1| hypothetical protein UM01635.1 [Ust... 107 9e-23
gi|47225842|emb|CAF98322.1| unnamed protein product [Tetraodon n... 104 6e-22
gi|49094906|ref|XP_408914.1| RS27_XENLA 40S ribosomal protein S2... 103 1e-21
gi|6066480|emb|CAB58439.1| 40S ribosomal protein S27 [Lumbricus ... 102 2e-21
gi|15238845|ref|NP_199604.1| 40S ribosomal protein S27 (RPS27D) ... 102 2e-21
gi|41148004|ref|XP_374490.1| similar to ribosomal protein S27 [H... 102 2e-21
gi|14787421|emb|CAC44218.1| putative ribosomal protein S27 prote... 102 2e-21
gi|50422183|ref|XP_459654.1| unnamed protein product [Debaryomyc... 100 6e-21
gi|21617904|gb|AAM66954.1| ribosomal protein S27 [Arabidopsis th... 100 1e-20
gi|32408635|ref|XP_324798.1| 40S RIBOSOMAL PROTEIN S27 [Neurospo... 100 1e-20
gi|19112006|ref|NP_595214.1| 40s ribosomal protein s27 [Schizosa... 100 1e-20
gi|15233044|ref|NP_191670.1| 40S ribosomal protein S27 (ARS27A) ... 99 2e-20
gi|11276659|pir||T47903 ribosomal protein S27 - Arabidopsis thal... 99 2e-20
gi|38100513|gb|EAA47629.1| hypothetical protein MG02872.4 [Magna... 99 3e-20
gi|15225550|ref|NP_182095.1| 40S ribosomal protein S27 (RPS27A) ... 98 4e-20
gi|23619020|ref|NP_704982.1| 40S ribosomal protein S27, putative... 98 5e-20
gi|11276661|pir||T43625 ribosomal protein S27 - fission yeast (S... 97 9e-20
gi|50256856|gb|EAL19574.1| hypothetical protein CNBG2030 [Crypto... 96 2e-19
gi|23491064|gb|EAA22693.1| ribosomal protein S27 [Plasmodium yoe... 94 6e-19
gi|50421851|ref|XP_459483.1| unnamed protein product [Debaryomyc... 94 6e-19
gi|46229781|gb|EAK90599.1| ribosomal protein S27, transcript ide... 94 1e-18
gi|11276660|pir||T43368 ribosomal protein S27 - fission yeast (S... 93 1e-18
gi|6440824|dbj|BAA78586.1| ribosomal protein S27 [Chlamydomonas ... 93 1e-18
gi|45185751|ref|NP_983467.1| ACR065Cp [Eremothecium gossypii] >g... 93 2e-18
gi|4038471|gb|AAC97381.1| 40S ribosomal protein S27 homolog [Zea... 93 2e-18
gi|21741910|emb|CAD40354.1| OSJNBa0020I02.1 [Oryza sativa (japon... 93 2e-18
gi|45645202|sp|Q96564|RS27_HORVU 40S ribosomal protein S27 (Mang... 93 2e-18
gi|47848235|dbj|BAD22060.1| 40S ribosomal protein S27 [Oryza sat... 93 2e-18
gi|50290623|ref|XP_447744.1| unnamed protein product [Candida gl... 91 8e-18
gi|6321809|ref|NP_011885.1| Protein component of the small (40S)... 91 8e-18
gi|6322693|ref|NP_012766.1| Protein component of the small (40S)... 91 8e-18
gi|2131116|emb|CAA81997.1| RPS27A [Saccharomyces cerevisiae] 89 2e-17
gi|4432748|dbj|BAA25825.1| ribosomal protein S27 [Homo sapiens] 89 2e-17
gi|50308943|ref|XP_454477.1| unnamed protein product [Kluyveromy... 89 2e-17
gi|46124059|ref|XP_386583.1| hypothetical protein FG06407.1 [Gib... 88 4e-17
gi|1350971|sp|P47903|RS27_CHLRE 40S ribosomal protein S27 >gnl|B... 85 5e-16
gi|28828276|gb|AAL93579.2| similar to ribosomal protein S27; pro... 83 1e-15
gi|1076733|pir||S53124 probable ribosomal protein S27 - barley 81 7e-15
gi|34857546|ref|XP_344909.1| similar to 40S ribosomal protein S2... 78 4e-14
gi|730649|sp|P38654|RS27_ENTHI 40S ribosomal protein S27 (EHZC3 ... 76 2e-13
gi|45478166|gb|AAS66254.1| LRRGT00163 [Rattus norvegicus] 76 2e-13
gi|537899|gb|AAB67324.1| ribosomal protein S27 [Entamoeba histol... 72 4e-12
gi|29249267|gb|EAA40782.1| GLP_29_6521_6276 [Giardia lamblia ATC... 71 7e-12
gi|3098456|gb|AAC15654.1| ribosomal protein S27E [Mytilus gallop... 67 7e-11
gi|19171496|emb|CAC81410.1| metallopanstimulin 1 [Meleagris gall... 67 7e-11
gi|40287472|gb|AAR83850.1| hyom protein [Capsicum annuum] 62 4e-09
gi|38605801|emb|CAE05268.3| OSJNBb0014D23.2 [Oryza sativa (japon... 55 5e-07
gi|13812344|ref|NP_113462.1| 40S ribosomal protein S27 [Guillard... 54 7e-07
gi|45478164|gb|AAS66253.1| LRRGT00162 [Rattus norvegicus] 53 2e-06
gi|45478180|gb|AAS66261.1| LRRGT00170 [Rattus norvegicus] 51 7e-06
gi|45478176|gb|AAS66259.1| LRRGT00168 [Rattus norvegicus] 41 0.006
gi|19074179|ref|NP_584785.1| 40S RIBOSOMAL PROTEIN S27 [Encephal... 41 0.006
gi|15921176|ref|NP_376845.1| 66aa long hypothetical 30S ribosoma... 39 0.037
gi|15897918|ref|NP_342523.1| SSU ribosomal protein S27E (rps27E)... 36 0.19
gi|14600707|ref|NP_147228.1| 30S ribosomal protein S27 [Aeropyru... 33 2.0
gi|48840378|ref|ZP_00297305.1| COG2051: Ribosomal protein S27E [... 33 2.0
gi|23098479|ref|NP_691945.1| inner spore coat protein D [Oceanob... 32 2.7
gi|20093856|ref|NP_613703.1| Ribosomal protein S27E [Methanopyru... 32 4.6
gi|20089532|ref|NP_615607.1| ribosomal protein S27e [Methanosarc... 32 4.6
gi|18976590|ref|NP_577947.1| SSU ribosomal protein S27E [Pyrococ... 31 6.0
gi|33356824|ref|NP_127390.2| SSU ribosomal protein S27E [Pyrococ... 31 7.8
>gi|17563244|ref|NP_503134.1| ribosomal Protein, Small subunit (9.3
kD) (rps-27) [Caenorhabditis elegans]
gi|25294908|pir||G88921 ribosomal protein S27 F56E10.4 [similarity]
- Caenorhabditis elegans
gi|3806153|gb|AAC69219.1| Ribosomal protein, small subunit protein
27 [Caenorhabditis elegans]
Length = 83
Score = 143 bits (361), Expect = 8e-34
Identities = 70/83 (84%), Positives = 70/83 (84%)
Frame = -1
Query: 252 MPLAVDLLHPEPQREIRCHKLKRLVQHPNSYFMDVKCSGCFKISTVFSHAXXXXXXXXXX 73
MPLAVDLLHPEPQREIRCHKLKRLVQHPNSYFMDVKCSGCFKISTVFSHA
Sbjct: 1 MPLAVDLLHPEPQREIRCHKLKRLVQHPNSYFMDVKCSGCFKISTVFSHATTVVVCVGCN 60
Query: 72 XXXCQPTRGKAKLTEGCSFRKKQ 4
CQPTRGKAKLTEGCSFRKKQ
Sbjct: 61 TVLCQPTRGKAKLTEGCSFRKKQ 83