Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F57F5_2
(1203 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17561570|ref|NP_506011.1| cathepsin B family member (5M483) [... 737 0.0
gi|39592147|emb|CAE75367.1| Hypothetical protein CBG23351 [Caeno... 606 e-172
gi|1777779|gb|AAB40605.1| cathepsin B-like cysteine proteinase 337 4e-91
gi|39586718|emb|CAE65760.1| Hypothetical protein CBG10849 [Caeno... 327 3e-88
gi|21392648|gb|AAM51519.1| Cysteine protease related protein 6, ... 324 2e-87
gi|25146613|ref|NP_741818.1| cysteine PRotease related (42.4 kD)... 324 2e-87
gi|17565164|ref|NP_503383.1| cysteine PRotease related, cathepsi... 323 4e-87
gi|39588506|emb|CAE58029.1| Hypothetical protein CBG01103 [Caeno... 316 8e-85
gi|39594338|emb|CAE71916.1| Hypothetical protein CBG18978 [Caeno... 311 3e-83
gi|34979797|gb|AAQ83887.1| cathepsin B [Branchiostoma belcheri t... 305 1e-81
gi|508264|gb|AAA96833.1| cysteine protease 305 2e-81
gi|17559068|ref|NP_504682.1| cysteine PRotease related (36.5 kD)... 302 9e-81
gi|50745158|ref|XP_429301.1| PREDICTED: hypothetical protein XP_... 300 6e-80
gi|28302291|gb|AAH46667.1| Cg10992-prov protein [Xenopus laevis] 298 2e-79
gi|1181143|emb|CAA93278.1| cysteine proteinase [Haemonchus conto... 297 4e-79
gi|28277314|gb|AAH44689.1| MGC53360 protein [Xenopus laevis] 295 1e-78
gi|45361295|ref|NP_989225.1| hypothetical protein MGC75969 [Xeno... 294 2e-78
gi|2982114|pdb|1PBH| Crystal Structure Of Human Recombinant Pro... 294 2e-78
gi|115711|sp|P07858|CATB_HUMAN Cathepsin B precursor (Cathepsin ... 294 2e-78
gi|4503139|ref|NP_001899.1| cathepsin B preproprotein; APP secre... 294 2e-78
gi|984958|gb|AAC46877.1| cathepsin B-like proteinase 293 5e-78
gi|30583753|gb|AAP36125.1| Homo sapiens cathepsin B [synthetic c... 293 5e-78
gi|16307393|gb|AAH10240.1| Cathepsin B, preproprotein [Homo sapi... 293 5e-78
gi|17565162|ref|NP_503382.1| cathepsin B precursor family member... 291 2e-77
gi|27806671|ref|NP_776456.1| cathepsin B [Bos taurus] >gnl|BL_OR... 290 4e-77
gi|1168789|sp|P07688|CATB_BOVIN Cathepsin B precursor 290 4e-77
gi|46195455|ref|NP_990702.1| cathepsin B [Gallus gallus] >gnl|BL... 290 5e-77
gi|2134308|pir||S58770 cathepsin B (EC 3.4.22.1) precursor - chi... 290 5e-77
gi|31209737|ref|XP_313835.1| ENSANGP00000003981 [Anopheles gambi... 289 1e-76
gi|50657025|emb|CAH04630.1| cathepsin B [Suberites domuncula] 285 1e-75
gi|22531387|emb|CAD44624.1| cathepsin B1 isotype 1 [Schistosoma ... 284 3e-75
gi|25988674|gb|AAN76202.1| lysosomal cysteine proteinase catheps... 283 4e-75
gi|34874087|ref|XP_346478.1| hypothetical protein XP_346477 [Rat... 283 4e-75
gi|6681079|ref|NP_031824.1| cathepsin B preproprotein [Mus muscu... 283 4e-75
gi|12018262|ref|NP_072119.1| cathepsin B preproprotein [Rattus n... 283 6e-75
gi|22531389|emb|CAD44625.1| cathepsin B1 isotype 2 [Schistosoma ... 282 1e-74
gi|14582897|gb|AAK69705.1| procathepsin B [Oncorhynchus mykiss] 282 1e-74
gi|37788265|gb|AAO64472.1| cathepsin B precursor [Fundulus heter... 281 2e-74
gi|47217183|emb|CAG11019.1| unnamed protein product [Tetraodon n... 281 2e-74
gi|41055001|ref|NP_957349.1| similar to cathepsin B [Danio rerio... 281 2e-74
gi|24158605|pdb|1GMY|A Chain A, Cathepsin B Complexed With Dipep... 281 2e-74
gi|984960|gb|AAC46878.1| cathepsin B proteinase 280 5e-74
gi|309202|gb|AAA37494.1| mouse preprocathepsin B 280 5e-74
gi|1942645|pdb|1MIR|A Chain A, Rat Procathepsin B >gnl|BL_ORD_ID... 280 6e-74
gi|118153|sp|P25792|CYSP_SCHMA Cathepsin B-like cysteine protein... 279 8e-74
gi|50540542|ref|NP_998501.1| cathepsin B [Danio rerio] >gnl|BL_O... 279 8e-74
gi|28373366|pdb|1ITO|A Chain A, Crystal Structure Analysis Of Bo... 279 1e-73
gi|9955277|pdb|1QDQ|A Chain A, X-Ray Crystal Structure Of Bovine... 278 1e-73
gi|39588507|emb|CAE58030.1| Hypothetical protein CBG01104 [Caeno... 278 1e-73
gi|7497829|pir||T20148 probable cysteine proteinase (EC 3.4.22.-... 276 5e-73
gi|32566081|ref|NP_506002.2| cysteine PRotease related (35.4 kD)... 276 5e-73
gi|203648|gb|AAA40993.1| cathepsin (EC 3.4.22.1) 276 5e-73
gi|1311050|pdb|1CPJ|A Chain A, Thiol Protease Mol_id: 1; Molecul... 276 5e-73
gi|14141821|gb|AAK07477.2| probable cathepsin B-like cysteine pr... 276 7e-73
gi|3087801|emb|CAA93277.1| cysteine proteinase [Haemonchus conto... 276 7e-73
gi|481614|pir||S38939 probable cathepsin B-like cysteine protein... 276 9e-73
gi|1169189|sp|P43157|CYSP_SCHJA Cathepsin B-like cysteine protei... 276 9e-73
gi|4325188|gb|AAD17297.1| cysteine proteinase [Ancylostoma ceyla... 275 2e-72
gi|227293|prf||1701299A cathepsin B 274 3e-72
gi|1127275|pdb|1CTE|A Chain A, Molecule: Cathepsin B; Ec: 3.4.22... 273 4e-72
gi|45822203|emb|CAE47498.1| cathepsin B-like proteinase [Diabrot... 273 6e-72
gi|39592139|emb|CAE75359.1| Hypothetical protein CBG23343 [Caeno... 273 6e-72
gi|118118|sp|P19092|CYS1_HAECO Cathepsin B-like cysteine protein... 273 6e-72
gi|478099|pir||D48435 cysteine proteinase AC-3 - nematode (Haemo... 273 8e-72
gi|31872149|gb|AAP59456.1| cathepsin B precursor [Araneus ventri... 272 1e-71
gi|118122|sp|P25793|CYS2_HAECO Cathepsin B-like cysteine protein... 272 1e-71
gi|21930117|gb|AAM82155.1| cysteine proteinase [Ancylostoma ceyl... 270 5e-71
gi|29374025|gb|AAO73003.1| cathepsin B [Fasciola gigantica] 270 5e-71
gi|29374027|gb|AAO73004.1| cathepsin B [Fasciola gigantica] 269 8e-71
gi|2944340|gb|AAC05262.1| cathepsin B-like cysteine protease GCP... 266 9e-70
gi|477253|pir||A48454 cathepsin B-like cysteine proteinase (EC 3... 265 2e-69
gi|345308|pir||S31909 cathepsin B-like cysteine proteinase (EC 3... 264 3e-69
gi|18921171|ref|NP_572920.1| CG10992-PA [Drosophila melanogaster... 264 3e-69
gi|39581137|emb|CAE70994.1| Hypothetical protein CBG17826 [Caeno... 262 1e-68
gi|39579201|emb|CAE56994.1| Hypothetical protein CBG24861 [Caeno... 262 1e-68
gi|5764077|emb|CAB53367.1| necpain [Necator americanus] 262 1e-68
gi|30995341|gb|AAO59414.2| cathepsin B endopeptidase [Schistosom... 261 2e-68
gi|3912916|gb|AAC78691.1| thiol protease [Trichuris suis] 261 2e-68
gi|7537454|gb|AAF35867.2| cathepsin B-like cysteine proteinase [... 259 7e-68
gi|1345924|sp|P25802|CYS1_OSTOS Cathepsin B-like cysteine protei... 258 2e-67
gi|29374023|gb|AAO73002.1| cathepsin B [Fasciola gigantica] 257 4e-67
gi|18181863|emb|CAC85211.2| cathepsin B endopeptidase [Schistoso... 256 6e-67
gi|38373697|gb|AAR19103.1| cathepsin B [Uronema marinum] 256 7e-67
gi|27526823|emb|CAD32937.1| pro-cathepsin B2 [Fasciola hepatica] 255 1e-66
gi|477808|pir||B48435 cysteine proteinase AC-5 - nematode (Haemo... 253 5e-66
gi|478007|pir||C48435 cysteine proteinase AC-4 - nematode (Haemo... 252 1e-65
gi|4204370|gb|AAD11445.1| cathepsin B protease [Fasciola hepatica] 251 2e-65
gi|3087803|emb|CAA93279.1| cysteine protease [Haemonchus contortus] 251 2e-65
gi|39584563|emb|CAE74641.1| Hypothetical protein CBG22436 [Caeno... 251 3e-65
gi|25153428|ref|NP_507186.2| predicted CDS, cathepsin B family m... 250 4e-65
gi|13548667|dbj|BAB40804.1| cathepsin B [Bombyx mori] 250 4e-65
gi|7500618|pir||T21856 probable cysteine proteinase (EC 3.4.22.-... 246 1e-63
gi|45822211|emb|CAE47502.1| cathepsin B-like proteinase [Diabrot... 244 4e-63
gi|39592833|emb|CAE62447.1| Hypothetical protein CBG06539 [Caeno... 240 4e-62
gi|44965401|gb|AAS49537.1| cathepsin B [Latimeria chalumnae] 238 3e-61
gi|17560488|ref|NP_506310.1| cathepsin precursor family member (... 238 3e-61
gi|3087797|emb|CAA93275.1| cysteine proteinase [Haemonchus conto... 237 5e-61
gi|17559066|ref|NP_506790.1| cysteine PRotease related, cathepsi... 234 2e-60
gi|3087799|emb|CAA93276.1| cysteine proteinase [Haemonchus conto... 234 3e-60
gi|10803443|emb|CAC13134.1| putative cathepsin B.8 [Ostertagia o... 232 1e-59
gi|44965462|gb|AAS49538.1| cathepsin B [Protopterus dolloi] 232 1e-59
gi|28971815|dbj|BAC65419.1| cathepsin B [Pandalus borealis] 232 1e-59
gi|39594884|emb|CAE70752.1| Hypothetical protein CBG17499 [Caeno... 232 1e-59
gi|39582887|emb|CAE71663.1| Hypothetical protein CBG18635 [Caeno... 232 1e-59
gi|10803437|emb|CAC13131.1| putative cathepsin B.5 [Ostertagia o... 232 1e-59
gi|39582904|emb|CAE71680.1| Hypothetical protein CBG18654 [Caeno... 229 1e-58
gi|31209739|ref|XP_313836.1| ENSANGP00000012227 [Anopheles gambi... 227 4e-58
gi|38639325|gb|AAR25800.1| cathepsin B-like cysteine proteinase ... 226 6e-58
gi|1644295|emb|CAB03627.1| cysteine proteinase [Haemonchus conto... 223 7e-57
gi|39582397|emb|CAE74781.1| Hypothetical protein CBG22612 [Caeno... 223 7e-57
gi|609175|emb|CAA57522.1| cathepsin B-like cysteine proteinase [... 221 3e-56
gi|22535408|emb|CAC87118.1| cathepsin B-like protease [Nilaparva... 220 5e-56
gi|2129942|pir||S60479 cathepsin B-like cysteine proteinase (EC ... 220 6e-56
gi|14582576|gb|AAK69541.1| cathepsin B-like cysteine proteinase ... 219 1e-55
gi|3929733|emb|CAA77178.1| cathepsin B [Homo sapiens] 218 2e-55
gi|39592835|emb|CAE62449.1| Hypothetical protein CBG06541 [Caeno... 218 3e-55
gi|18378947|ref|NP_563648.1| cathepsin B-like cysteine protease,... 218 3e-55
gi|6165885|gb|AAF04727.1| cathepsin B-like cysteine proteinase [... 218 3e-55
gi|7507648|pir||T24819 hypothetical protein T10H4.12 - Caenorhab... 216 7e-55
gi|39582907|emb|CAE71683.1| Hypothetical protein CBG18657 [Caeno... 216 1e-54
gi|17565158|ref|NP_503384.1| cathepsin precursor family member (... 215 2e-54
gi|1008858|gb|AAA79004.1| cathepsin B-like thiol protease 213 6e-54
gi|44968648|gb|AAS49594.1| cathepsin B [Scyliorhinus canicula] 213 7e-54
gi|5031250|gb|AAD38132.1| vitellogenic cathepsin-B like protease... 212 1e-53
gi|40643250|emb|CAC83720.1| cathepsin B [Hordeum vulgare subsp. ... 212 1e-53
gi|181178|gb|AAA52125.1| lysosomal proteinase cathepsin B 211 4e-53
gi|999909|pdb|1HUC|B Chain B, Cathepsin B (E.C.3.4.22.1) >gnl|BL... 211 4e-53
gi|3929817|emb|CAA77181.1| cathepsin B [Mus musculus] 210 5e-53
gi|7435783|pir||T06413 cathepsin B-like cysteine proteinase (EC ... 209 1e-52
gi|18411686|ref|NP_567215.1| cathepsin B-like cysteine protease,... 207 3e-52
gi|48762493|dbj|BAD23816.1| cathepsin B-N [Tuberaphis coreana] 206 1e-51
gi|48762485|dbj|BAD23812.1| cathepsin B-N [Tuberaphis styraci] 206 1e-51
gi|19526442|gb|AAL89717.1| cathepsin B [Apriona germari] 204 3e-51
gi|28932700|gb|AAO60044.1| midgut cysteine proteinase 1 [Rhipice... 204 3e-51
gi|3088522|gb|AAD03404.1| cathepsin B-like protease precursor [T... 204 3e-51
gi|48425700|pdb|1SP4|B Chain B, Crystal Structure Of Ns-134 In C... 204 3e-51
gi|30678927|ref|NP_849281.1| cathepsin B-like cysteine protease,... 202 1e-50
gi|7435782|pir||T06466 cathepsin B-like cysteine proteinase (EC ... 202 2e-50
gi|728602|emb|CAA88490.1| cathepsin B-like enzyme [Leishmania me... 201 2e-50
gi|10803454|emb|CAB97366.2| putative cathepsin B.3 [Ostertagia o... 201 2e-50
gi|12005276|gb|AAG44365.1| cathepsin B-like cysteine protease [L... 200 5e-50
gi|17384033|emb|CAD12394.1| cysteine proteinase [Leishmania infa... 200 5e-50
gi|29840882|gb|AAP05883.1| similar to GenBank Accession Number X... 199 8e-50
gi|1848229|gb|AAB48119.1| cathepsin B-like protease [Leishmania ... 199 8e-50
gi|31209729|ref|XP_313831.1| ENSANGP00000012222 [Anopheles gambi... 199 1e-49
gi|12004577|gb|AAG44098.1| cathepsin B cysteine protease [Leishm... 197 3e-49
gi|21700775|gb|AAL60053.1| cysteine proteinase [Toxoplasma gondii] 196 7e-49
gi|15150360|gb|AAK85411.1| cathepsin B-like protease [Trypanosom... 196 7e-49
gi|10803452|emb|CAB97365.2| putative cathepsin B.2 [Ostertagia o... 195 2e-48
gi|2317912|gb|AAC24376.1| cathepsin B-like cysteine proteinase [... 194 3e-48
gi|48762476|dbj|BAD23809.1| cathepsin B-S [Tuberaphis styraci] 194 5e-48
gi|40557577|gb|AAR88085.1| cathepsin B-like cysteine protease [T... 193 6e-48
gi|729283|sp|Q06544|CYS3_OSTOS Cathepsin B-like cysteine protein... 193 8e-48
gi|39588505|emb|CAE58028.1| Hypothetical protein CBG01102 [Caeno... 189 9e-47
gi|21695|emb|CAA46812.1| cathepsin B [Triticum aestivum] 187 3e-46
gi|48762491|dbj|BAD23815.1| cathepsin B-S [Tuberaphis coreana] 187 4e-46
gi|15723276|gb|AAL06326.1| cathepsin B-like protease [Trypanosom... 186 9e-46
gi|15723280|gb|AAL06328.1| cathepsin B-like protease [Trypanosom... 186 1e-45
gi|18378945|ref|NP_563647.1| cathepsin B-like cysteine protease,... 185 2e-45
gi|15723274|gb|AAL06325.1| cathepsin B-like protease [Trypanosom... 184 3e-45
gi|10803439|emb|CAC13132.1| putative cathepsin B.6 [Ostertagia o... 182 1e-44
gi|10803441|emb|CAC13133.1| putative cathepsin B.7 [Ostertagia o... 181 2e-44
gi|38074689|ref|XP_140905.2| similar to Cathepsin B precursor (C... 181 3e-44
gi|15723272|gb|AAL06324.1| cathepsin B-like protease [Trypanosom... 180 7e-44
gi|10803450|emb|CAB97364.2| putative cathepsin B.1 [Ostertagia o... 174 3e-42
gi|603044|gb|AAA96832.1| cysteine protease homolog 168 3e-40
gi|496968|gb|AAA96831.1| cysteine protease homologue 166 1e-39
gi|741376|prf||2007265A cathepsin B 166 1e-39
gi|10803435|emb|CAC13130.1| putative cathepsin B.4 [Ostertagia o... 164 5e-39
gi|312266|emb|CAA51531.1| cathepsin B-like enzyme [Gallus gallus] 158 3e-37
gi|13469701|gb|AAK27318.1| cysteine proteinase [Clonorchis sinen... 157 5e-37
gi|4099305|gb|AAD00577.1| cysteine proteinase [Clonorchis sinensis] 157 5e-37
gi|28974200|gb|AAO61484.1| cathepsin B [Sterkiella histriomuscorum] 156 8e-37
gi|12330244|gb|AAG52659.1| cysteine proteinase [Metagonimus yoko... 156 8e-37
gi|12658201|gb|AAK01061.1| cysteine proteinase [Metagonimus yoko... 153 7e-36
gi|552159|gb|AAA29434.1| cathepsin B-like cysteine protease 147 4e-34
gi|552158|gb|AAA29433.1| cathepsin B-like cysteine protease 147 4e-34
gi|12330246|gb|AAG52660.1| cysteine proteinase [Metagonimus yoko... 147 5e-34
gi|17510377|ref|NP_490763.1| cathepsin B family member (48.2 kD)... 143 7e-33
gi|6562772|emb|CAB62590.1| putative cathepsin B-like protease [P... 141 3e-32
gi|39585894|emb|CAE61308.1| Hypothetical protein CBG05143 [Caeno... 140 8e-32
gi|162813|gb|AAA30434.1| cathepsin B 139 1e-31
gi|32129435|sp|P92133|CAL3_GIALA Cathepsin B-like CP3 precursor ... 137 5e-31
gi|7494569|pir||T37284 cysteine proteinase (EC 3.4.22.-) - Caeno... 136 9e-31
gi|39581138|emb|CAE70995.1| Hypothetical protein CBG17827 [Caeno... 135 2e-30
gi|39595196|emb|CAE60233.1| Hypothetical protein CBG03805 [Caeno... 134 3e-30
gi|17506871|ref|NP_492593.1| tubulointerstitial nephritis antige... 134 6e-30
gi|29245813|gb|EAA37433.1| GLP_442_4888_3992 [Giardia lamblia AT... 132 1e-29
gi|29249541|gb|EAA41050.1| GLP_447_16146_15244 [Giardia lamblia ... 132 1e-29
gi|32129434|sp|P92132|CAL2_GIALA Cathepsin B-like CP2 precursor ... 130 5e-29
gi|39581140|emb|CAE70997.1| Hypothetical protein CBG17829 [Caeno... 123 1e-26
gi|24657813|ref|NP_726176.1| CG3074-PA [Drosophila melanogaster]... 123 1e-26
gi|16768502|gb|AAL28470.1| GM06507p [Drosophila melanogaster] 123 1e-26
gi|32129433|sp|P92131|CAL1_GIALA Cathepsin B-like CP1 precursor ... 120 5e-26
gi|50744850|ref|XP_419905.1| PREDICTED: similar to tubulointerst... 120 5e-26
gi|159950|gb|AAA29435.1| cathepsin B-like cysteine protease 119 1e-25
gi|29248531|gb|EAA40062.1| GLP_162_1114_2025 [Giardia lamblia AT... 119 1e-25
gi|11691656|emb|CAC18646.1| cathepsin B-like protease 1 [Giardia... 119 1e-25
gi|1763659|gb|AAB58258.1| cysteine protease [Giardia intestinalis] 119 1e-25
gi|2330009|gb|AAB66719.1| cysteine protease [Giardia muris] 118 2e-25
gi|48762481|dbj|BAD23810.1| cathepsin B-S [Tuberaphis taiwana] 118 2e-25
gi|29245436|gb|EAA37074.1| GLP_113_4299_5381 [Giardia lamblia AT... 117 4e-25
gi|29248841|gb|EAA40365.1| GLP_567_6496_7413 [Giardia lamblia AT... 117 5e-25
gi|39592834|emb|CAE62448.1| Hypothetical protein CBG06540 [Caeno... 115 2e-24
gi|47271446|ref|NP_055279.2| tubulointerstitial nephritis antige... 115 2e-24
gi|11360328|pir||JC7189 tubulointerstitial nephritis antigen - h... 115 2e-24
gi|34098755|sp|Q9UJW2|TNAG_HUMAN Tubulointerstitial nephritis an... 114 3e-24
gi|48762483|dbj|BAD23811.1| cathepsin B-S [Tuberaphis takenouchii] 113 8e-24
gi|38639319|gb|AAR25797.1| cathepsin B-like cysteine proteinase ... 113 1e-23
gi|47212965|emb|CAF93376.1| unnamed protein product [Tetraodon n... 112 2e-23
gi|4929827|gb|AAD34171.1| tubulo-interstitial nephritis antigen ... 111 4e-23
gi|31981314|ref|NP_036163.2| tubulointerstitial nephritis antige... 111 4e-23
gi|1363085|pir||A57480 tubulointerstitial nephritis antigen prec... 110 5e-23
gi|29248113|gb|EAA39655.1| GLP_217_11853_10927 [Giardia lamblia ... 107 4e-22
gi|48762489|dbj|BAD23814.1| cathepsin B-N [Tuberaphis takenouchii] 107 6e-22
gi|1763661|gb|AAB58259.1| cysteine protease [Giardia intestinalis] 107 7e-22
gi|34864376|ref|XP_236424.2| similar to tubulo-interstitial neph... 106 1e-21
gi|11545918|ref|NP_071447.1| P3ECSL; glucocorticoid-inducible pr... 105 2e-21
gi|12958837|gb|AAK09441.1| cathepsin b-like precursor protein [A... 104 5e-21
gi|2599293|gb|AAC32040.1| preprocathepsin C [Schistosoma japonicum] 104 5e-21
gi|22653678|sp|O97578|CATC_CANFA Dipeptidyl-peptidase I precurso... 103 8e-21
gi|48762487|dbj|BAD23813.1| cathepsin B-N [Tuberaphis taiwana] 101 3e-20
gi|23344736|gb|AAN28681.1| cathepsin B [Theromyzon tessulatum] 100 5e-20
gi|29246290|gb|EAA37893.1| GLP_449_32565_31567 [Giardia lamblia ... 100 7e-20
gi|17933077|gb|AAL48195.1| cathepsin C [Homo sapiens] 100 1e-19
gi|7271889|gb|AAF44675.1| cathepsin L [Fasciola gigantica] 100 1e-19
gi|1582221|prf||2118248A prepro-cathepsin C 99 2e-19
gi|17933069|gb|AAL48191.1| cathepsin C [Homo sapiens] 99 2e-19
gi|33327024|gb|AAQ08887.1| cathepsin C [Homo sapiens] 99 2e-19
gi|4503141|ref|NP_001805.1| cathepsin C isoform a preproprotein;... 99 2e-19
gi|4574304|gb|AAD23996.1| cathepsin [Fasciola gigantica] 99 2e-19
gi|21263041|gb|AAM44832.1| cathepsin L2 [Fasciola gigantica] 99 2e-19
gi|12963691|ref|NP_075965.1| lipocalin 7; androgen-regulated gen... 99 2e-19
gi|13543125|gb|AAH05738.1| Lcn7 protein [Mus musculus] >gnl|BL_O... 99 2e-19
gi|17933071|gb|AAL48192.1| cathepsin C [Homo sapiens] 99 3e-19
gi|16758354|ref|NP_446034.1| lipocalin 7; glucocorticoid-inducib... 97 6e-19
gi|31560607|ref|NP_034112.2| cathepsin C preproprotein; dipeptid... 97 6e-19
gi|29246183|gb|EAA37790.1| GLP_549_24108_24914 [Giardia lamblia ... 97 6e-19
gi|7271895|gb|AAF44678.1| cathepsin L [Fasciola gigantica] 97 8e-19
gi|3023454|sp|P97821|CATC_MOUSE Dipeptidyl-peptidase I precursor... 96 1e-18
gi|1584943|prf||2123443A cathepsin C 96 1e-18
gi|2499875|sp|Q26563|CATC_SCHMA Cathepsin C precursor >gnl|BL_OR... 96 1e-18
gi|33417162|gb|AAH56109.1| Ctsc-prov protein [Xenopus laevis] 96 1e-18
gi|31198479|ref|XP_308187.1| ENSANGP00000020785 [Anopheles gambi... 96 2e-18
gi|8393218|ref|NP_058793.1| cathepsin C; Cathepsin C (dipeptidyl... 96 2e-18
gi|115716|sp|P80067|CATC_RAT Dipeptidyl-peptidase I precursor (D... 96 2e-18
gi|24987409|pdb|1JQP|A Chain A, Dipeptidyl Peptidase I (Cathepsi... 96 2e-18
gi|12832450|dbj|BAB22112.1| unnamed protein product [Mus musculus] 95 4e-18
gi|30038325|dbj|BAC75711.1| cathepsin C [Bos taurus] 94 8e-18
gi|45708820|gb|AAH67941.1| LOC407938 protein [Xenopus tropicalis] 93 1e-17
gi|6449324|gb|AAF08932.1| tubulointerstitial nephritis antigen i... 93 1e-17
gi|6562770|emb|CAB62589.1| putative cathepsin B-like protease [P... 93 1e-17
gi|19909509|dbj|BAB86959.1| cathepsin L [Fasciola gigantica] 93 1e-17
gi|50758927|ref|XP_417483.1| PREDICTED: similar to cathepsin Y [... 92 2e-17
gi|41152538|gb|AAR99518.1| cathepsin L protein [Fasciola hepatica] 92 2e-17
gi|7271893|gb|AAF44677.1| cathepsin L [Fasciola gigantica] 92 3e-17
gi|545734|gb|AAB30089.1| cysteine protease [Fasciola sp.] >gnl|B... 91 4e-17
gi|452268|emb|CAA80451.1| cathepsin B-like protease [Fasciola he... 91 4e-17
gi|46948158|gb|AAT07061.1| cathepsin Z-like cysteine proteinase ... 91 7e-17
gi|38045864|gb|AAR08900.1| cathepsin L [Fasciola gigantica] 90 9e-17
gi|20136379|gb|AAM11647.1| cathepsin L [Fasciola hepatica] 90 9e-17
gi|8547325|gb|AAF76330.1| cathepsin L [Fasciola hepatica] 89 2e-16
gi|7489849|pir||T10518 fruit bromelain (EC 3.4.22.33) FB1035 pre... 89 2e-16
gi|38048307|gb|AAR10056.1| similar to Drosophila melanogaster CG... 89 2e-16
gi|129233|sp|P25778|ORYC_ORYSA Oryzain gamma chain precursor >gn... 89 2e-16
gi|29150712|gb|AAO64444.1| cathepsin Z-like cysteine proteinase ... 89 3e-16
gi|7271891|gb|AAF44676.1| cathepsin L [Fasciola gigantica] 89 3e-16
gi|29247428|gb|EAA38990.1| GLP_542_3431_1206 [Giardia lamblia AT... 88 3e-16
gi|10798511|emb|CAC12806.1| cathepsin L1 [Fasciola hepatica] 88 5e-16
gi|50731191|ref|XP_417207.1| PREDICTED: similar to Dipeptidyl-pe... 88 5e-16
gi|47550737|ref|NP_999887.1| cathepsin C; ik:tdsubc_1h2 [Danio r... 87 6e-16
gi|31558997|gb|AAP49831.1| cathepsin L [Fasciola hepatica] 87 6e-16
gi|7435779|pir||S71923 cysteine proteinase (EC 3.4.22.-) - garde... 87 6e-16
gi|14422331|emb|CAC41636.1| early leaf senescence abundant cyste... 87 6e-16
gi|6851030|emb|CAB71032.1| cysteine protease [Lolium multiflorum] 87 6e-16
gi|7435828|pir||T10503 fruit bromelain (EC 3.4.22.33) FB18 precu... 87 6e-16
gi|28804799|dbj|BAC57943.1| cathepsin C [Marsupenaeus japonicus] 87 8e-16
gi|13774082|gb|AAK38169.1| cathepsin L-like [Fasciola hepatica] 87 8e-16
gi|41152540|gb|AAR99519.1| cathepsin L protein [Fasciola hepatica] 87 8e-16
gi|1809286|gb|AAB41670.1| secreted cathepsin L 1 [Fasciola hepat... 87 8e-16
gi|535600|gb|AAA29137.1| cathepsin [Fasciola hepatica] 87 1e-15
gi|45738078|gb|AAS75836.1| fastuosain precursor [Bromelia fastuosa] 87 1e-15
gi|630489|pir||S43991 cathepsin L-like proteinases (EC 3.4.22.-)... 86 1e-15
gi|67656|pir||KHBH aleurain (EC 3.4.22.-) precursor - barley 86 1e-15
gi|6562768|emb|CAB62588.1| putative cathepsin B-like protease [P... 86 2e-15
gi|37905530|gb|AAO64478.1| cathepsin C precursor [Fundulus heter... 86 2e-15
gi|14290553|gb|AAH09048.1| LCN7 protein [Homo sapiens] 86 2e-15
gi|14042811|dbj|BAB55403.1| unnamed protein product [Homo sapiens] 86 2e-15
gi|113603|sp|P05167|ALEU_HORVU Thiol protease aleurain precursor... 86 2e-15
gi|1809288|gb|AAC47721.1| secreted cathepsin L 2 [Fasciola hepat... 86 2e-15
gi|48762499|dbj|BAD23819.1| cathepsin B-N [Tuberaphis styraci] >... 85 3e-15
gi|39595452|emb|CAE60490.1| Hypothetical protein CBG04105 [Caeno... 84 5e-15
gi|47270758|gb|AAB54210.2| Cathepsin z protein 1 [Caenorhabditis... 84 5e-15
gi|17507081|ref|NP_491023.1| cathepsin Z (1D256) [Caenorhabditis... 84 5e-15
gi|30023547|gb|AAO48766.2| cathepsin L-like cysteine proteinase ... 83 1e-14
gi|1680720|gb|AAC47348.1| cysteine protease precursor [Onchocerc... 83 1e-14
gi|33112583|gb|AAP94047.1| cathepsin-L-like cysteine peptidase 0... 83 1e-14
gi|452264|emb|CAA80449.1| cathepsin B-like protease [Fasciola he... 83 1e-14
gi|15617524|ref|NP_258322.1| cathepsin-like cysteine proteinase ... 83 1e-14
gi|46561115|gb|AAT00789.1| cathepsin Z precursor [Onchocerca vol... 82 2e-14
gi|19909511|dbj|BAB86960.1| cathepsin L [Fasciola gigantica] 82 2e-14
gi|7435780|pir||T09259 cathepsin L-like proteinase (EC 3.4.22.-)... 82 2e-14
gi|48762495|dbj|BAD23817.1| cathepsin B-S [Tuberaphis styraci] 82 2e-14
gi|45822205|emb|CAE47499.1| cathepsin L-like proteinase [Diabrot... 82 2e-14
gi|22538442|ref|NP_001327.2| cathepsin Z preproprotein; cathepsi... 82 3e-14
gi|3294548|gb|AAC39839.1| cathepsin Z precursor; CTSZ [Homo sapi... 82 3e-14
gi|3719219|gb|AAC63141.1| preprocathepsin P [Homo sapiens] 82 3e-14
gi|7245728|pdb|1DEU|A Chain A, Crystal Structure Of Human Procat... 82 3e-14
gi|34809309|gb|AAQ82649.1| cysteine protease [Tritrichomonas foe... 82 3e-14
gi|81542|pir||S02728 actinidain (EC 3.4.22.14) precursor (clone ... 82 3e-14
gi|3650498|gb|AAC61477.1| cathepsin X precursor [Homo sapiens] 82 3e-14
gi|33112581|gb|AAP94046.1| cathepsin-L-like cysteine peptidase 0... 81 4e-14
gi|47939805|gb|AAH72275.1| MGC82409 protein [Xenopus laevis] 81 4e-14
gi|8347420|dbj|BAA96501.1| cysteine protease [Nicotiana tabacum] 81 4e-14
gi|19698255|dbj|BAB86770.1| cathepsin L-like [Engraulis japonicus] 81 4e-14
gi|18396939|ref|NP_564320.1| peptidase C1A papain family protein... 81 6e-14
gi|15824516|gb|AAL09381.1| cysteine proteinase [Haemonchus conto... 81 6e-14
gi|50657031|emb|CAH04633.1| cathepsin X/O [Suberites domuncula] 81 6e-14
gi|2499879|sp|Q40143|CYS3_LYCES Cysteine proteinase 3 precursor ... 81 6e-14
gi|34328540|ref|NP_899159.1| cathepsin Y [Rattus norvegicus] >gn... 80 7e-14
gi|1141743|gb|AAB04162.1| putative cysteine proteinase 80 7e-14
gi|945081|gb|AAC49361.1| P21 80 7e-14
gi|47227517|emb|CAG04665.1| unnamed protein product [Tetraodon n... 80 7e-14
gi|42744610|gb|AAH66625.1| Zgc:66267 protein [Danio rerio] 80 7e-14
gi|23397070|gb|AAN31820.1| putative cysteine proteinase AALP [Ar... 80 1e-13
gi|18424347|ref|NP_568921.1| cysteine proteinase, putative / AAL... 80 1e-13
gi|19880041|gb|AAM00234.1| cathepsin B-like cysteine proteinase ... 80 1e-13
gi|14517542|gb|AAK62661.1| F2G19.31/F2G19.31 [Arabidopsis thalia... 80 1e-13
gi|18401614|ref|NP_564497.1| cysteine proteinase (RD21A) / thiol... 80 1e-13
gi|7381610|gb|AAF61565.1| cathepsin L-like proteinase precursor ... 80 1e-13
gi|28192371|gb|AAK07729.1| NTCP23-like cysteine proteinase [Nico... 80 1e-13
gi|7489850|pir||T10516 fruit bromelain (EC 3.4.22.33) FB22 precu... 80 1e-13
gi|48425699|pdb|1SP4|A Chain A, Crystal Structure Of Ns-134 In C... 80 1e-13
gi|19698257|dbj|BAB86771.1| cathepsin L-like [Engraulis japonicus] 80 1e-13
gi|1749812|emb|CAA90237.1| cysteine proteinase LmCPB1 [Leishmani... 80 1e-13
gi|7435820|pir||T10514 probable stem bromelain (EC 3.4.22.32) pr... 80 1e-13
gi|11863537|emb|CAC18798.1| cathepsin Z [Cricetulus griseus] 79 2e-13
gi|4139678|pdb|8PCH|A Chain A, Crystal Structure Of Porcine Cath... 79 2e-13
gi|5081735|gb|AAD39513.1| cathepsin L-like protease precursor [A... 79 2e-13
gi|7435827|pir||T10501 fruit bromelain (EC 3.4.22.33) FB13 precu... 79 2e-13
gi|2351107|dbj|BAA21929.1| bromelain [Ananas comosus] 79 2e-13
gi|41055337|ref|NP_956720.1| hypothetical protein MGC66267 [Dani... 79 2e-13
gi|28974202|gb|AAO61485.1| cathepsin H [Sterkiella histriomuscorum] 79 2e-13
gi|478768|pir||S29245 cysteine proteinase (EC 3.4.22.-) precurso... 79 2e-13
gi|17062058|gb|AAL34984.1| cathepsine L-like cysteine protease [... 79 2e-13
gi|7546545|pdb|1EF7|A Chain A, Crystal Structure Of Human Cathep... 79 2e-13
gi|14348750|emb|CAC41275.1| CPB2 protein [Leishmania mexicana] 79 2e-13
gi|47522632|ref|NP_999094.1| cathepsin H [Sus scrofa] >gnl|BL_OR... 79 2e-13
gi|9635308|ref|NP_059206.1| ORF58 [Xestia c-nigrum granulovirus]... 79 2e-13
gi|7435824|pir||T07851 ananain (EC 3.4.22.31) precursor AN11 - p... 79 2e-13
gi|50355619|dbj|BAD29958.1| cysteine protease [Daucus carota] 79 2e-13
gi|10798509|emb|CAC12805.1| procathepsin L3 [Fasciola hepatica] 79 2e-13
gi|4210800|emb|CAA76927.1| thiol protease [Phaedon cochleariae] 79 2e-13
gi|113285|sp|P00785|ACTN_ACTCH Actinidain precursor (Actinidin) ... 79 2e-13
gi|47224192|emb|CAG13112.1| unnamed protein product [Tetraodon n... 79 2e-13
gi|4557501|ref|NP_001325.1| cathepsin O preproprotein [Homo sapi... 79 3e-13
gi|4809232|gb|AAD30154.1| cathepsin Z1 preproprotein [Toxocara c... 79 3e-13
gi|47213723|emb|CAF95154.1| unnamed protein product [Tetraodon n... 78 4e-13
gi|2780176|emb|CAA71085.1| cystein proteinase [Leishmania mexicana] 78 4e-13
gi|255032|gb|AAB23155.1| COT44=cysteine proteinase homolog [Bras... 78 5e-13
gi|129232|sp|P25777|ORYB_ORYSA Oryzain beta chain precursor >gnl... 78 5e-13
gi|16506723|gb|AAL23917.1| cathepsin L [Fasciola gigantica] 78 5e-13
gi|7435801|pir||T06416 cysteine proteinase (EC 3.4.22.-) precurs... 78 5e-13
gi|33348834|gb|AAQ16117.1| cathepsin L-like cysteine proteinase ... 77 6e-13
gi|18422289|ref|NP_568620.1| cysteine proteinase, putative / thi... 77 6e-13
gi|29708|emb|CAA30428.1| cathepsin H [Homo sapiens] 77 6e-13
gi|39579200|emb|CAE56993.1| Hypothetical protein CBG24860 [Caeno... 77 6e-13
gi|23110957|ref|NP_683880.1| cathepsin H isoform b precursor; al... 77 6e-13
gi|16506815|gb|AAL23962.1| truncated cathepsin H [Homo sapiens] 77 6e-13
gi|48145879|emb|CAG33162.1| CTSH [Homo sapiens] 77 6e-13
gi|21264388|sp|P09668|CATH_HUMAN Cathepsin H precursor >gnl|BL_O... 77 6e-13
gi|67653|pir||KHHUH cathepsin H (EC 3.4.22.16) precursor [valida... 77 6e-13
gi|23110955|ref|NP_004381.2| cathepsin H isoform a preproprotein... 77 6e-13
gi|16506813|gb|AAL23961.1| cathepsin H [Homo sapiens] 77 6e-13
gi|47222865|emb|CAF96532.1| unnamed protein product [Tetraodon n... 77 8e-13
gi|442619|pdb|1AEC| Actinidin (E.C.3.4.22.14) Complex With The ... 77 8e-13
gi|32488398|emb|CAE02823.1| OSJNBa0043A12.28 [Oryza sativa (japo... 77 8e-13
gi|38346003|emb|CAD40112.2| OSJNBa0035O13.5 [Oryza sativa (japon... 77 1e-12
gi|2677828|gb|AAB97142.1| cysteine protease [Prunus armeniaca] 77 1e-12
gi|12744965|gb|AAK06862.1| actinidin protease [Actinidia chinensis] 77 1e-12
gi|2144501|pir||TAGB actinidain (EC 3.4.22.14) precursor - kiwi ... 77 1e-12
gi|7271897|gb|AAF44679.1| cathepsin L [Fasciola gigantica] 77 1e-12
gi|46309423|ref|YP_006313.1| cathepsin [Agrotis segetum granulov... 77 1e-12
gi|11968166|ref|NP_071720.1| cathepsin Z preproprotein; cathepsi... 76 1e-12
gi|18408616|ref|NP_566901.1| cysteine proteinase, putative [Arab... 76 1e-12
gi|18408828|ref|NP_566920.1| cysteine proteinase, putative [Arab... 76 2e-12
gi|24653516|ref|NP_725347.1| CG6692-PA [Drosophila melanogaster]... 76 2e-12
gi|37788267|gb|AAO64473.1| cathepsin H precursor [Fundulus heter... 76 2e-12
gi|37655265|gb|AAQ96835.1| cysteine proteinase [Glycine max] 76 2e-12
gi|40806498|gb|AAR92154.1| putative cysteine protease 1 [Iris ho... 76 2e-12
gi|7435811|pir||T06708 cysteine proteinase (EC 3.4.22.-) T29H11.... 76 2e-12
gi|37963625|gb|AAP94048.2| cathepsin-L-like midgut cysteine prot... 76 2e-12
gi|630486|pir||S44151 cathepsin L (EC 3.4.22.15) - fluke (Schist... 76 2e-12
gi|24653514|ref|NP_523735.2| CG6692-PC [Drosophila melanogaster]... 76 2e-12
gi|13897890|gb|AAK48495.1| putative cysteine protease [Ipomoea b... 76 2e-12
gi|34329348|gb|AAQ63885.1| putative cysteine proteinase [Medicag... 75 2e-12
gi|50355615|dbj|BAD29956.1| cysteine protease [Daucus carota] 75 2e-12
gi|39584558|emb|CAE74636.1| Hypothetical protein CBG22431 [Caeno... 75 3e-12
gi|1361974|pir||S57776 cysteine proteinase (EC 3.4.22.-) - clove... 75 3e-12
gi|11066226|gb|AAG28507.1| cathepsin Z [Mus musculus] 75 3e-12
gi|37780051|gb|AAP32198.1| cysteine protease 12 [Trifolium repens] 75 3e-12
gi|37780045|gb|AAP32195.1| cysteine protease 5 [Trifolium repens] 75 3e-12
gi|13905172|gb|AAH06878.1| Cathepsin H [Mus musculus] 75 4e-12
gi|999908|pdb|1HUC|A Chain A, Cathepsin B (E.C.3.4.22.1) >gnl|BL... 75 4e-12
gi|50418223|gb|AAH77285.1| Unknown (protein for MGC:80097) [Xeno... 75 4e-12
gi|46948154|gb|AAT07059.1| cathepsin F-like cysteine proteinase ... 74 5e-12
gi|7106279|ref|NP_031827.1| cathepsin H; Cat H [Mus musculus] >g... 74 5e-12
gi|49522293|gb|AAH75261.1| Unknown (protein for MGC:88875) [Xeno... 74 5e-12
gi|118127|sp|P25251|CYS4_BRANA Cysteine proteinase COT44 precurs... 74 5e-12
gi|17566486|ref|NP_507904.1| cathepsin H family member (5U698) [... 74 5e-12
gi|37780043|gb|AAP32194.1| cysteine protease 1 [Trifolium repens] 74 5e-12
gi|1841466|emb|CAA71892.1| putative pre-pro-cysteine proteinase ... 74 5e-12
gi|14349351|gb|AAC38832.2| cysteine protease [Leishmania donovan... 74 5e-12
gi|945054|gb|AAA74445.1| cathepsin B-like protease 74 5e-12
gi|50355623|dbj|BAD29960.1| cysteine protease [Daucus carota] 74 5e-12
gi|38345008|emb|CAD40026.2| OSJNBa0052O21.11 [Oryza sativa (japo... 74 9e-12
gi|48762497|dbj|BAD23818.1| cathepsin B-S [Tuberaphis coreana] 74 9e-12
gi|27497536|gb|AAO13008.1| cathepsin S preproprotein [Saimiri bo... 74 9e-12
gi|18141289|gb|AAL60582.1| senescence-associated cysteine protea... 74 9e-12
gi|10336513|dbj|BAB13759.1| cysteine proteinase [Astragalus sini... 74 9e-12
gi|40556818|gb|AAR87763.1| fibroinase precursor [Bombyx mori] 73 1e-11
gi|1706261|sp|Q10717|CYS2_MAIZE Cysteine proteinase 2 precursor ... 73 1e-11
gi|47086663|ref|NP_997853.1| Unknown (protein for MGC:85774); wu... 73 1e-11
gi|38346007|emb|CAD40110.2| OSJNBa0035O13.9 [Oryza sativa (japon... 73 1e-11
gi|29567137|ref|NP_818699.1| cathepsin [Adoxophyes honmai nucleo... 73 2e-11
gi|230417|pdb|2ACT| Actinidin (Sulfhydryl Proteinase) (E.C. Num... 73 2e-11
gi|1085124|pir||JX0366 cysteine endopeptidase (EC 3.4.22.-) prec... 73 2e-11
gi|37907340|gb|AAO64476.1| cathepsin Z precursor [Fundulus heter... 73 2e-11
gi|29249287|gb|EAA40802.1| GLP_29_33036_32140 [Giardia lamblia A... 73 2e-11
gi|37780049|gb|AAP32197.1| cysteine protease 10 [Trifolium repens] 73 2e-11
gi|11265612|pir||T47471 cysteine proteinase (EC 3.4.22.-) F18N11... 72 2e-11
gi|34559455|gb|AAQ75437.1| cathepsin L-like protease [Helicoverp... 72 2e-11
gi|18407961|ref|NP_566880.1| cysteine proteinase, putative [Arab... 72 2e-11
gi|7435809|pir||T06529 cysteine proteinase (EC 3.4.22.-) - garde... 72 2e-11
gi|1491774|emb|CAA68192.1| cysteine protease [Zea mays] 72 3e-11
gi|18308182|gb|AAL67857.1| cysteine proteinase [Acanthamoeba hea... 72 3e-11
gi|18402225|ref|NP_566633.1| cysteine proteinase, putative / thi... 72 3e-11
gi|6978721|ref|NP_037071.1| cathepsin H [Rattus norvegicus] >gnl... 72 3e-11
gi|22653679|sp|Q26636|CATL_SARPE Cathepsin L precursor >gnl|BL_O... 72 3e-11
gi|5731354|gb|AAB70820.2| cysteine protease Mir1 [Zea mays] 72 3e-11
gi|15824691|gb|AAL09443.1| cysteine protease [Leishmania donovani] 72 3e-11
gi|44844204|emb|CAF32698.1| cysteine proteinase [Leishmania infa... 72 3e-11
gi|203341|gb|AAA63484.1| cathepsin H 72 3e-11
gi|37780047|gb|AAP32196.1| cysteine protease 8 [Trifolium repens] 72 3e-11
gi|1093503|prf||2104214A Cys protease 71 4e-11
gi|23482498|gb|EAA18465.1| berghepain-2 [Plasmodium yoelii yoelii] 71 4e-11
gi|7435791|pir||T12041 cysteine proteinase (EC 3.4.22.-) 3 precu... 71 4e-11
gi|535454|gb|AAA50755.1| cysteine proteinase 71 4e-11
gi|29165304|gb|AAO65603.1| cathepsin L precursor [Hydra vulgaris] 71 4e-11
gi|37732137|gb|AAR02406.1| cysteine proteinase [Anthonomus grandis] 71 4e-11
gi|1498185|dbj|BAA06738.1| cysteine proteinase-1 precursor [Dros... 71 6e-11
gi|2146900|pir||S67481 cathepsin L-like cysteine proteinase (EC ... 71 6e-11
gi|30141019|dbj|BAC75923.1| cysteine protease-1 [Helianthus annuus] 70 8e-11
gi|37747900|gb|AAH59142.1| Ctss protein [Rattus norvegicus] 70 8e-11
gi|42407937|dbj|BAD09076.1| putative cysteine proteinase [Oryza ... 70 8e-11
gi|15320768|ref|NP_203280.1| V-CATH [Epiphyas postvittana nucleo... 70 8e-11
gi|13124026|sp|Q9WGE0|CATV_NPVHC Viral cathepsin (V-cath) (Cyste... 70 8e-11
gi|81543|pir||S02729 actinidain (EC 3.4.22.14) precursor (clone ... 70 8e-11
gi|12597541|ref|NP_075125.1| cathepsin [Heliocoverpa armigera nu... 70 8e-11
gi|33873837|gb|AAH25419.1| Unknown (protein for IMAGE:3929674) [... 70 1e-10
gi|30387350|ref|NP_848429.1| cathepsin [Choristoneura fumiferana... 70 1e-10
gi|18141285|gb|AAL60580.1| senescence-associated cysteine protea... 70 1e-10
gi|17562680|ref|NP_506318.1| cathepsin Z precursor (53.2 kD) (5N... 70 1e-10
gi|118145|sp|P20721|CYSL_LYCES Low-temperature-induced cysteine ... 70 1e-10
gi|118154|sp|P25781|CYSP_THEAN Cysteine proteinase precursor >gn... 70 1e-10
gi|39583812|emb|CAE74885.1| Hypothetical protein CBG22748 [Caeno... 70 1e-10
gi|18401420|ref|NP_565649.1| cysteine proteinase, putative [Arab... 70 1e-10
gi|629792|pir||S47434 cysteine proteinase (EC 3.4.22.-) - rice >... 69 2e-10
gi|18403438|ref|NP_565780.1| cysteine proteinase, putative [Arab... 69 2e-10
gi|38683695|gb|AAR26872.1| FirrV-1-A48 precursor [Feldmannia irr... 69 2e-10
gi|37651368|ref|NP_932731.1| cathepsin [Choristoneura fumiferana... 69 2e-10
gi|6682829|dbj|BAA88898.1| cysteine protease component of protea... 69 2e-10
gi|50355611|dbj|BAD29954.1| cysteine protease [Daucus carota] 69 2e-10
gi|39592995|emb|CAE62609.1| Hypothetical protein CBG06727 [Caeno... 69 2e-10
gi|33242872|gb|AAQ01140.1| cathepsin [Branchiostoma lanceolatum] 69 2e-10
gi|18138384|ref|NP_542680.1| cathepsin [Helicoverpa zea single n... 69 2e-10
gi|13491750|gb|AAK27968.1| cysteine protease [Ipomoea batatas] 69 3e-10
gi|1834307|dbj|BAA09820.1| cysteine proteinase [Spirometra erina... 69 3e-10
gi|18423124|ref|NP_568722.1| cysteine proteinase, putative [Arab... 69 3e-10
gi|2351557|gb|AAB68595.1| cathepsin [Choristoneura fumiferana MNPV] 69 3e-10
gi|24285904|gb|AAL14199.1| cysteine proteinase precursor [Ipomoe... 68 4e-10
gi|25289998|pir||JC7787 carrot seed cysteine proteinase (EC 3.4.... 68 5e-10
gi|33242874|gb|AAQ01141.1| cathepsin [Branchiostoma lanceolatum] 68 5e-10
gi|18396952|ref|NP_564322.1| cysteine proteinase, putative [Arab... 68 5e-10
gi|33242876|gb|AAQ01142.1| cathepsin [Branchiostoma lanceolatum] 68 5e-10
gi|33242878|gb|AAQ01143.1| cathepsin [Branchiostoma lanceolatum] 68 5e-10
gi|15128493|dbj|BAB62718.1| plerocercoid growth factor/cysteine ... 68 5e-10
gi|25289992|pir||F86413 probable cysteine proteinase [imported] ... 68 5e-10
gi|33242884|gb|AAQ01146.1| cathepsin [Petromyzon marinus] 67 6e-10
gi|38014481|gb|AAH60424.1| MGC68723 protein [Xenopus laevis] 67 6e-10
gi|20334377|gb|AAM19209.1| cysteine protease [Lycopersicon escul... 67 6e-10
gi|1071886|pir||S49451 cysteine proteinase (EC 3.4.22.-) - chick... 67 6e-10
gi|5917765|gb|AAD56028.1| cysteine protease CYP1 [Solanum chacoe... 67 6e-10
gi|8917575|gb|AAF81274.1| EPCS24 [Mus musculus] 67 8e-10
gi|37077647|sp|Q91CL9|CATV_NPVAP Viral cathepsin (V-cath) (Cyste... 67 8e-10
gi|7435799|pir||T06207 cysteine proteinase (EC 3.4.22.-) - barle... 67 8e-10
gi|23956098|ref|NP_062412.1| cathepsin 7; ectoplacental cone, in... 67 8e-10
gi|28932706|gb|AAO60047.1| midgut cysteine proteinase 4 [Rhipice... 67 1e-09
gi|49387634|dbj|BAD25828.1| putative cysteine proteinase [Oryza ... 67 1e-09
gi|9631045|ref|NP_047715.1| cathepsin-like proteinase [Lymantria... 67 1e-09
>gi|17561570|ref|NP_506011.1| cathepsin B family member (5M483)
[Caenorhabditis elegans]
gi|7504541|pir||T22853 probable cathepsin B (EC 3.4.22.1) F57F5.1
[similarity] - Caenorhabditis elegans
gi|3877743|emb|CAB00098.1| Hypothetical protein F57F5.1
[Caenorhabditis elegans]
Length = 400
Score = 737 bits (1903), Expect = 0.0
Identities = 353/382 (92%), Positives = 353/382 (92%)
Frame = +1
Query: 1 MPNSYQQYSRKRQTSKVISRLKRKNYKTPGKRLINWSTVEFPNSPANRKMKTXXXXXXXX 180
MPNSYQQYSRKRQTSKVISRLKRKNYKTPGKRLINWSTVEFPNSPANRKMKT
Sbjct: 1 MPNSYQQYSRKRQTSKVISRLKRKNYKTPGKRLINWSTVEFPNSPANRKMKTAIAALLVG 60
Query: 181 XXXXXXYNVEVKHGDAIPVEAQMLRGQELVDYVNKVQTSFKAELGSYFSSYPDTIKKQLM 360
YNVEVKHGDAIPVEAQMLRGQELVDYVNKVQTSFKAELGSYFSSYPDTIKKQLM
Sbjct: 61 LVAVNAYNVEVKHGDAIPVEAQMLRGQELVDYVNKVQTSFKAELGSYFSSYPDTIKKQLM 120
Query: 361 GAKMVEIPEEYRVFEMTHPEVEDAAVPDSFDSRTAWPNCPSISKIRDQSSCGSCWAVSAA 540
GAKMVEIPEEYRVFEMTHPEVEDAAVPDSFDSRTAWPNCPSISKIRDQSSCGSCWAVSAA
Sbjct: 121 GAKMVEIPEEYRVFEMTHPEVEDAAVPDSFDSRTAWPNCPSISKIRDQSSCGSCWAVSAA 180
Query: 541 ETISDRICIASNAKTILSISADDIXXXXXXXXXXXXXXXYPIEAWRHYVKKGYVTGGSYQ 720
ETISDRICIASNAKTILSISADDI YPIEAWRHYVKKGYVTGGSYQ
Sbjct: 181 ETISDRICIASNAKTILSISADDINACCGMVCGNGCNGGYPIEAWRHYVKKGYVTGGSYQ 240
Query: 721 DKTGCKPYPYPPCEHHVNGTHYKPCPSNMYPTDKCERSCQAGYALTYQQDLHFGQSAYAV 900
DKTGCKPYPYPPCEHHVNGTHYKPCPSNMYPTDKCERSCQAGYALTYQQDLHFGQSAYAV
Sbjct: 241 DKTGCKPYPYPPCEHHVNGTHYKPCPSNMYPTDKCERSCQAGYALTYQQDLHFGQSAYAV 300
Query: 901 SKKAAEIQKEIMTHGPVEVAFTVYEDFEHYSGGVYVHTAGASLGGHAVKMLGWGVDNGTP 1080
SKKAAEIQKEIMTHGPVEVAFTVYEDFEHYSGGVYVHTAGASLGGHAVKMLGWGVDNGTP
Sbjct: 301 SKKAAEIQKEIMTHGPVEVAFTVYEDFEHYSGGVYVHTAGASLGGHAVKMLGWGVDNGTP 360
Query: 1081 YWLCANSWNEDWGENGYFRIIR 1146
YWLCANSWNEDWGENGYFRIIR
Sbjct: 361 YWLCANSWNEDWGENGYFRIIR 382