Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F59A7_4
(1557 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17561718|ref|NP_503548.1| SNF2 related domain and helicase, C... 1014 0.0
gi|25141376|ref|NP_491854.2| SNF2 related domain and helicase, C... 328 3e-88
gi|7508346|pir||T28968 hypothetical protein T23H2.3 - Caenorhabd... 328 3e-88
gi|32564642|ref|NP_871873.1| RNA polymerase II termination facto... 324 3e-87
gi|39584767|emb|CAE67662.1| Hypothetical protein CBG13225 [Caeno... 278 3e-73
gi|39595329|emb|CAE60366.1| Hypothetical protein CBG03965 [Caeno... 237 7e-61
gi|17540630|ref|NP_502137.1| SNF2 related domain and helicase, C... 220 6e-56
gi|40807471|ref|NP_003585.3| transcription termination factor, R... 146 8e-36
gi|3702846|gb|AAC64044.1| RNA polymerase II termination factor [... 146 8e-36
gi|47122916|gb|AAH70581.1| MGC81081 protein [Xenopus laevis] 143 4e-35
gi|50729638|ref|XP_416595.1| PREDICTED: similar to transcription... 144 5e-35
gi|5733122|gb|AAD49435.1| lodestar protein [Homo sapiens] 143 5e-35
gi|25020799|ref|XP_207781.1| similar to RNA polymerase II termin... 142 1e-34
gi|20875035|ref|XP_131118.1| transcription termination factor, R... 142 1e-34
gi|48097325|ref|XP_393754.1| similar to CG2684-PA [Apis mellifera] 147 2e-34
gi|34859664|ref|XP_215670.2| similar to RNA polymerase II termin... 140 7e-34
gi|47221989|emb|CAG08244.1| unnamed protein product [Tetraodon n... 138 9e-34
gi|24644932|ref|NP_524850.2| CG2684-PA [Drosophila melanogaster]... 137 1e-32
gi|21392184|gb|AAM48446.1| RE70645p [Drosophila melanogaster] 135 5e-32
gi|31240303|ref|XP_320565.1| ENSANGP00000008692 [Anopheles gambi... 122 2e-26
gi|15901369|ref|NP_345973.1| Snf2 family protein [Streptococcus ... 117 6e-25
gi|15903418|ref|NP_358968.1| SWF/SNF family ATP-dependent RNA he... 117 6e-25
gi|6912622|ref|NP_036547.1| RAD54 homolog B isoform 1; RAD54, S.... 112 2e-23
gi|11360069|pir||T43485 hypothetical protein DKFZp434J1672.1 - h... 112 2e-23
gi|45382655|ref|NP_990041.1| RAD54B protein [Gallus gallus] >gnl... 110 1e-22
gi|50590777|ref|ZP_00332127.1| COG0553: Superfamily II DNA/RNA h... 110 1e-22
gi|15674024|ref|NP_268199.1| SWI/SNF family helicase [Lactococcu... 109 2e-22
gi|19745454|ref|NP_606590.1| putative SNF helicase [Streptococcu... 108 3e-22
gi|21909786|ref|NP_664054.1| putative SNF helicase [Streptococcu... 108 3e-22
gi|15674499|ref|NP_268673.1| putative SNF helicase [Streptococcu... 108 3e-22
gi|24380105|ref|NP_722060.1| putative SNF helicase [Streptococcu... 108 4e-22
gi|49096320|ref|XP_409620.1| hypothetical protein AN5483.2 [Aspe... 107 8e-22
gi|25011706|ref|NP_736101.1| Unknown [Streptococcus agalactiae N... 106 2e-21
gi|22537758|ref|NP_688609.1| Snf2 family protein [Streptococcus ... 106 2e-21
gi|15806278|ref|NP_294983.1| DNA helicase, SNF2/RAD54 family [De... 105 2e-21
gi|34785459|gb|AAH57604.1| Unknown (protein for MGC:67261) [Mus ... 105 3e-21
gi|50260975|gb|EAL23625.1| hypothetical protein CNBA2720 [Crypto... 105 4e-21
gi|23105623|ref|ZP_00092079.1| COG0553: Superfamily II DNA/RNA h... 104 5e-21
gi|34867177|ref|XP_232785.2| similar to RAD54B homolog isoform 1... 104 5e-21
gi|29377168|ref|NP_816322.1| Snf2 family protein [Enterococcus f... 103 1e-20
gi|50259922|gb|EAL22590.1| hypothetical protein CNBB4670 [Crypto... 103 1e-20
gi|85049|pir||A40580 lodestar maternal-effect protein - fruit fl... 102 2e-20
gi|19115158|ref|NP_594246.1| helicase; putative DNA repair prote... 102 2e-20
gi|24644930|ref|NP_649751.1| CG10445-PA [Drosophila melanogaster... 102 2e-20
gi|23126141|ref|ZP_00108047.1| COG0553: Superfamily II DNA/RNA h... 102 2e-20
gi|30019888|ref|NP_831519.1| SWF/SNF family helicase [Bacillus c... 102 3e-20
gi|16800753|ref|NP_471021.1| similar to SNF2-type helicase [List... 102 3e-20
gi|23128497|ref|ZP_00110342.1| COG0553: Superfamily II DNA/RNA h... 102 3e-20
gi|47939775|gb|AAH72215.1| MGC81308 protein [Xenopus laevis] 102 3e-20
gi|47093680|ref|ZP_00231434.1| helicase, Snf2 family [Listeria m... 102 3e-20
gi|46907873|ref|YP_014262.1| helicase, Snf2 family [Listeria mon... 102 3e-20
gi|17136368|ref|NP_476661.1| CG3736-PA [Drosophila melanogaster]... 101 4e-20
gi|1765914|emb|CAA71278.1| RAD54 [Drosophila melanogaster] 101 4e-20
gi|3329473|gb|AAC26857.1| RAD54 DNA repair protein [Drosophila m... 101 4e-20
gi|49070818|ref|XP_399698.1| hypothetical protein UM02083.1 [Ust... 101 4e-20
gi|48824514|ref|ZP_00285879.1| COG0553: Superfamily II DNA/RNA h... 101 4e-20
gi|27819922|gb|AAL39744.2| LD35220p [Drosophila melanogaster] 101 4e-20
gi|47096999|ref|ZP_00234573.1| helicase, Snf2 family [Listeria m... 101 4e-20
gi|16803684|ref|NP_465169.1| similar to SNF2-type helicase [List... 101 4e-20
gi|50557268|ref|XP_506042.1| hypothetical protein [Yarrowia lipo... 101 4e-20
gi|45509693|ref|ZP_00162026.1| COG0553: Superfamily II DNA/RNA h... 101 6e-20
gi|50302399|ref|XP_451134.1| unnamed protein product [Kluyveromy... 101 6e-20
gi|17232392|ref|NP_488940.1| SWI/SNF family helicase [Nostoc sp.... 101 6e-20
gi|17231890|ref|NP_488438.1| SNF2 helicase homolog [Nostoc sp. P... 100 1e-19
gi|48855575|ref|ZP_00309734.1| COG0553: Superfamily II DNA/RNA h... 100 1e-19
gi|23100530|ref|NP_693997.1| helicase [Oceanobacillus iheyensis ... 100 1e-19
gi|50509490|dbj|BAD31171.1| putative DNA repair protein rhp16 [O... 100 1e-19
gi|9629985|ref|NP_046203.1| global transactivator [Orgyia pseudo... 100 1e-19
gi|50304963|ref|XP_452439.1| unnamed protein product [Kluyveromy... 100 2e-19
gi|28869303|ref|NP_791922.1| helicase/SNF2 family domain protein... 100 2e-19
gi|6321275|ref|NP_011352.1| DNA-dependent ATPase, stimulates str... 100 2e-19
gi|26988870|ref|NP_744295.1| helicase, SNF2/RAD54 family [Pseudo... 100 2e-19
gi|46119555|ref|ZP_00176801.2| COG0553: Superfamily II DNA/RNA h... 99 2e-19
gi|45184972|ref|NP_982690.1| AAR147Wp [Eremothecium gossypii] >g... 99 2e-19
gi|38101894|gb|EAA48795.1| hypothetical protein MG00453.4 [Magna... 99 2e-19
gi|49080748|ref|XP_403858.1| hypothetical protein UM06243.1 [Ust... 99 2e-19
gi|48730026|ref|ZP_00263775.1| COG0553: Superfamily II DNA/RNA h... 99 3e-19
gi|23099744|ref|NP_693210.1| helicase [Oceanobacillus iheyensis ... 99 3e-19
gi|19113394|ref|NP_596602.1| SNF2 family dna repair protein by s... 99 3e-19
gi|30023277|ref|NP_834908.1| SWF/SNF family helicase [Bacillus c... 99 3e-19
gi|50259517|gb|EAL22190.1| hypothetical protein CNBC3280 [Crypto... 96 3e-19
gi|23577840|ref|NP_703032.1| global transactivator [Rachiplusia ... 99 4e-19
gi|1769947|emb|CAA67095.1| SNF [Bacillus cereus] 99 4e-19
gi|42780946|ref|NP_978193.1| helicase, putative [Bacillus cereus... 99 4e-19
gi|30261851|ref|NP_844228.1| helicase, putative [Bacillus anthra... 99 4e-19
gi|49481102|ref|YP_035985.1| helicase, SWF/SNF family [Bacillus ... 99 4e-19
gi|50290001|ref|XP_447432.1| unnamed protein product [Candida gl... 99 4e-19
gi|50552109|ref|XP_503529.1| hypothetical protein [Yarrowia lipo... 99 4e-19
gi|46189143|ref|ZP_00124369.2| COG0553: Superfamily II DNA/RNA h... 99 4e-19
gi|27882409|gb|AAH44659.1| SMARCA3 protein [Homo sapiens] 98 5e-19
gi|531196|gb|AAA67436.1| ATPase 98 5e-19
gi|16943790|emb|CAD10805.1| SWI/SNF related, matrix associated, ... 98 5e-19
gi|21071052|ref|NP_003062.2| SWI/SNF-related matrix-associated a... 98 5e-19
gi|1082438|pir||S49618 helicase-like transcription factor - huma... 98 5e-19
gi|30387275|ref|NP_848354.1| global transactivator [Choristoneur... 98 5e-19
gi|49109447|ref|XP_411675.1| hypothetical protein AN7538.2 [Aspe... 98 5e-19
gi|49481223|ref|YP_039235.1| SNF2 family helicase [Bacillus thur... 98 5e-19
gi|42784409|ref|NP_981656.1| helicase, putative [Bacillus cereus... 98 5e-19
gi|29826907|ref|NP_821541.1| putative SNF2/RAD54 family helicase... 98 5e-19
gi|33239499|ref|NP_874441.1| Superfamily II DNA/RNA helicases, S... 98 5e-19
gi|1658307|emb|CAA86572.1| helicase-like transcription factor [H... 98 5e-19
gi|34785644|gb|AAH57116.1| SWI/SNF related, matrix associated, a... 98 6e-19
gi|39589798|emb|CAE67033.1| Hypothetical protein CBG12435 [Caeno... 98 6e-19
gi|28278071|gb|AAH39796.1| Smarca3 protein [Mus musculus] 98 6e-19
gi|50258606|gb|EAL21293.1| hypothetical protein CNBD3470 [Crypto... 98 6e-19
gi|21227581|ref|NP_633503.1| SWF/SNF family helicase [Methanosar... 98 6e-19
gi|50875884|emb|CAG35724.1| probable helicase [Desulfotalea psyc... 98 6e-19
gi|50424047|ref|XP_460608.1| unnamed protein product [Debaryomyc... 97 8e-19
gi|21397710|ref|NP_653695.1| SNF2_N, SNF2 and others N-terminal ... 97 8e-19
gi|47569742|ref|ZP_00240415.1| helicase, SNF2/RAD54 family [Baci... 97 8e-19
gi|32475836|ref|NP_868830.1| probable swi/snf family helicase 2 ... 97 1e-18
gi|39585145|emb|CAE57388.1| Hypothetical protein CBG00336 [Caeno... 97 1e-18
gi|48858203|ref|ZP_00312165.1| COG0553: Superfamily II DNA/RNA h... 97 1e-18
gi|46444164|gb|EAL03441.1| hypothetical protein CaO19.5004 [Cand... 97 1e-18
gi|47565536|ref|ZP_00236577.1| Snf2 family protein [Bacillus cer... 97 1e-18
gi|32421361|ref|XP_331124.1| hypothetical protein ( (AB032901) R... 97 1e-18
gi|50254799|gb|EAL17544.1| hypothetical protein CNBM1100 [Crypto... 97 1e-18
gi|34855513|ref|XP_215728.2| similar to transcription factor [Ra... 97 1e-18
gi|38105538|gb|EAA51954.1| hypothetical protein MG03549.4 [Magna... 97 1e-18
gi|48104593|ref|XP_392959.1| similar to RAD54-like protein; RAD5... 97 1e-18
gi|37651342|ref|NP_932651.1| global transactivator-like protein ... 97 1e-18
gi|15896248|ref|NP_349597.1| Superfamily II DNA/RNA helicase, SN... 97 1e-18
gi|22775414|dbj|BAC11858.1| recombinational repair protein [Magn... 97 1e-18
gi|29828520|ref|NP_823154.1| putative SNF2/RAD54 family helicase... 97 1e-18
gi|32407090|ref|XP_324143.1| hypothetical protein [Neurospora cr... 97 1e-18
gi|50257984|gb|EAL20678.1| hypothetical protein CNBE0430 [Crypto... 97 1e-18
gi|46805057|dbj|BAD17038.1| putative SNF2 domain-containing prot... 97 1e-18
gi|48894083|ref|ZP_00327281.1| COG0553: Superfamily II DNA/RNA h... 97 1e-18
gi|15231009|ref|NP_188635.1| SNF2 domain-containing protein / he... 96 2e-18
gi|50288685|ref|XP_446772.1| unnamed protein product [Candida gl... 96 2e-18
gi|48782007|ref|ZP_00278580.1| COG0553: Superfamily II DNA/RNA h... 96 2e-18
gi|1655930|gb|AAC18656.1| RUSH-1alpha [Oryctolagus cuniculus] 96 2e-18
gi|17566484|ref|NP_507903.1| SNF2 related domain containing prot... 96 2e-18
gi|32470671|ref|NP_863664.1| helicase [Pirellula sp. 1] >gnl|BL_... 96 2e-18
gi|50424285|ref|XP_460729.1| unnamed protein product [Debaryomyc... 96 2e-18
gi|46127169|ref|XP_388138.1| hypothetical protein FG07962.1 [Gib... 96 2e-18
gi|23111644|ref|ZP_00097250.1| COG0553: Superfamily II DNA/RNA h... 96 2e-18
gi|45190309|ref|NP_984563.1| AEL297Wp [Eremothecium gossypii] >g... 96 2e-18
gi|17508659|ref|NP_492438.1| RADiation sensitivity abnormal/yeas... 96 2e-18
gi|39546244|emb|CAE04253.3| OSJNBa0089N06.14 [Oryza sativa (japo... 96 3e-18
gi|15615476|ref|NP_243779.1| SNF2 helicase [Bacillus halodurans ... 96 3e-18
gi|20089087|ref|NP_615162.1| helicase (SNF2 family) [Methanosarc... 96 3e-18
gi|7384851|dbj|BAA93079.1| Rad54 homolog [Neurospora crassa] 96 3e-18
gi|32040815|ref|ZP_00138398.1| COG0553: Superfamily II DNA/RNA h... 96 3e-18
gi|27803083|emb|CAD60786.1| unnamed protein product [Podospora a... 96 3e-18
gi|15595996|ref|NP_249490.1| probable helicase [Pseudomonas aeru... 96 3e-18
gi|31544906|ref|NP_853484.1| HepA/SNF2 [Mycoplasma gallisepticum... 95 4e-18
gi|50420537|ref|XP_458805.1| unnamed protein product [Debaryomyc... 95 4e-18
gi|49096408|ref|XP_409664.1| hypothetical protein AN5527.2 [Aspe... 95 4e-18
gi|33864422|ref|NP_895982.1| SNF2 related domain:DEAD/DEAH box h... 95 4e-18
gi|41055574|ref|NP_957438.1| similar to RAD54-like [Danio rerio]... 95 4e-18
gi|29840673|ref|NP_829779.1| helicase, Snf2 family [Chlamydophil... 95 4e-18
gi|19111970|ref|NP_595178.1| rad16 nucleotide excision repair pr... 95 4e-18
gi|15217826|ref|NP_171767.1| DNA repair protein, putative [Arabi... 95 5e-18
gi|37521835|ref|NP_925212.1| probable helicase [Gloeobacter viol... 95 5e-18
gi|31043816|emb|CAA88960.2| Hypothetical protein M03C11.8 [Caeno... 95 5e-18
gi|15618744|ref|NP_225030.1| SWI/SNF family helicase_1 [Chlamydo... 95 5e-18
gi|17554270|ref|NP_499301.1| SNF2 related domain and helicase, C... 95 5e-18
gi|46128325|ref|XP_388716.1| hypothetical protein FG08540.1 [Gib... 95 5e-18
gi|34556097|emb|CAB55149.2| Hypothetical protein Y116A8C.13 [Cae... 94 7e-18
gi|17544426|ref|NP_503012.1| DNA repair protein (4R905) [Caenorh... 94 7e-18
gi|46129542|ref|ZP_00164017.2| COG0553: Superfamily II DNA/RNA h... 94 7e-18
gi|19115202|ref|NP_594290.1| DNA repair protein rhp54 [Schizosac... 94 9e-18
gi|542215|pir||S41886 DNA repair protein - fission yeast (Schizo... 94 9e-18
gi|21224583|ref|NP_630362.1| putative helicase [Streptomyces coe... 94 9e-18
gi|18310607|ref|NP_562541.1| SWI/SNF family helicase [Clostridiu... 94 9e-18
gi|50546160|ref|XP_500607.1| hypothetical protein [Yarrowia lipo... 94 9e-18
gi|32141133|ref|NP_733524.1| putative helicase [Streptomyces coe... 94 1e-17
gi|46434315|gb|EAK93728.1| hypothetical protein CaO19.11978 [Can... 94 1e-17
gi|28631399|gb|AAO49697.1| similar to Arabidopsis thaliana (Mous... 94 1e-17
gi|22299156|ref|NP_682403.1| ORF_ID:tlr1613~putative helicase [T... 94 1e-17
gi|15220993|ref|NP_172004.1| SNF2 domain-containing protein / he... 94 1e-17
gi|15836368|ref|NP_300892.1| SWI/SNF family helicase_1 [Chlamydo... 94 1e-17
gi|23101871|ref|ZP_00088417.1| COG0553: Superfamily II DNA/RNA h... 94 1e-17
gi|39591892|emb|CAE71470.1| Hypothetical protein CBG18388 [Caeno... 94 1e-17
gi|23125415|ref|ZP_00107348.1| COG0553: Superfamily II DNA/RNA h... 93 2e-17
gi|38637850|ref|NP_942824.1| putative helicase, superfamily II [... 93 2e-17
gi|33866892|ref|NP_898451.1| SNF2 helicase homolog [Synechococcu... 93 2e-17
gi|46580490|ref|YP_011298.1| Snf2 family protein [Desulfovibrio ... 93 2e-17
gi|15605441|ref|NP_220227.1| SWF/SNF family helicase [Chlamydia ... 92 2e-17
gi|31199727|ref|XP_308811.1| ENSANGP00000007696 [Anopheles gambi... 93 2e-17
gi|26326753|dbj|BAC27120.1| unnamed protein product [Mus musculus] 93 2e-17
gi|46914265|emb|CAG21045.1| hypothetical protein [Photobacterium... 93 2e-17
gi|47777671|gb|AAT38113.1| RAD54-like (S. cerevisiae) [Homo sapi... 93 2e-17
gi|1495708|emb|CAA66380.1| RAD54 [Mus musculus] 93 2e-17
gi|26353994|dbj|BAC40627.1| unnamed protein product [Mus musculus] 93 2e-17
gi|4506397|ref|NP_003570.1| RAD54-like protein; RAD54 homolog; R... 93 2e-17
gi|31982068|ref|NP_033041.2| RAD54 like [Mus musculus] >gnl|BL_O... 93 2e-17
gi|34870243|ref|XP_216497.2| similar to RAD54 [Rattus norvegicus] 93 2e-17
gi|50751544|ref|XP_422447.1| PREDICTED: similar to putative reco... 92 3e-17
gi|15289872|dbj|BAB63568.1| putative helicase-like transcription... 92 3e-17
gi|32408661|ref|XP_324811.1| hypothetical protein [Neurospora cr... 92 3e-17
gi|38637840|ref|NP_942814.1| putative helicase, superfamily II [... 92 3e-17
gi|1905887|gb|AAB54115.1| putative recombination factor GdRad54 ... 92 3e-17
gi|46226722|gb|EAK87701.1| Swi2/Snf2 ATpase,Rad16 ortholog [Cryp... 92 3e-17
gi|15618758|ref|NP_225044.1| SWI/SNF family helicase_2 [Chlamydo... 91 3e-17
gi|15836382|ref|NP_300906.1| SWI/SNF family helicase_2 [Chlamydo... 91 3e-17
gi|7106417|ref|NP_033236.1| SWI/SNF related, matrix associated, ... 92 3e-17
gi|47459148|ref|YP_016010.1| swf/snf family helicase-like protei... 92 3e-17
gi|9627784|ref|NP_054071.1| global transactivator-like protein [... 92 3e-17
gi|26554357|ref|NP_758291.1| helicase with SNF2 domain [Mycoplas... 92 4e-17
gi|45524679|ref|ZP_00175949.1| COG0553: Superfamily II DNA/RNA h... 92 4e-17
gi|39597216|emb|CAE59443.1| Hypothetical protein CBG02816 [Caeno... 91 6e-17
gi|38086734|ref|XP_125439.2| similar to SWI/SNF related, matrix ... 91 6e-17
gi|50553882|ref|XP_504352.1| hypothetical protein [Yarrowia lipo... 91 6e-17
gi|25465825|pir||T51892 hypothetical protein B23I11.40 [imported... 91 8e-17
gi|50289211|ref|XP_447036.1| unnamed protein product [Candida gl... 91 8e-17
gi|50310019|ref|XP_455023.1| unnamed protein product [Kluyveromy... 91 8e-17
gi|47575794|ref|NP_001001241.1| hypothetical protein MGC69368 [X... 91 8e-17
gi|19074741|ref|NP_586247.1| similarity to THE ATPase COMPONENT ... 91 8e-17
gi|46190976|ref|ZP_00120784.2| COG0553: Superfamily II DNA/RNA h... 91 8e-17
gi|9630851|ref|NP_047448.1| GTA=Global Transactivator=AcMNPV orf... 91 8e-17
gi|23466281|ref|NP_696884.1| possible helicase [Bifidobacterium ... 91 8e-17
gi|15834706|ref|NP_296465.1| helicase, Snf2 family [Chlamydia mu... 90 8e-17
gi|46136625|ref|XP_390004.1| hypothetical protein FG09828.1 [Gib... 83 8e-17
gi|6324765|ref|NP_014834.1| contains motifs that are present in ... 91 1e-16
gi|46227534|gb|EAK88469.1| RAD54 like SWI/SNF2 ATpase [Cryptospo... 91 1e-16
gi|25402644|pir||A86245 hypothetical protein [imported] - Arabid... 91 1e-16
gi|42561912|ref|NP_172577.2| SNF2 domain-containing protein / he... 91 1e-16
gi|23474884|ref|ZP_00130175.1| COG0553: Superfamily II DNA/RNA h... 91 1e-16
gi|9294624|dbj|BAB02963.1| DNA repair protein RAD54-like [Arabid... 90 1e-16
gi|49093726|ref|XP_408324.1| hypothetical protein AN4187.2 [Aspe... 90 1e-16
gi|24373219|ref|NP_717262.1| Snf2 family protein [Shewanella one... 90 1e-16
gi|50555271|ref|XP_505044.1| hypothetical protein [Yarrowia lipo... 90 1e-16
gi|46434839|gb|EAK94239.1| hypothetical protein CaO19.5675 [Cand... 90 1e-16
gi|34495520|ref|NP_899735.1| probable SWI/SNF family helicase [C... 90 1e-16
gi|18403061|ref|NP_564568.1| SNF2 domain-containing protein / he... 90 1e-16
gi|34783716|gb|AAH57115.1| Smarca1 protein [Mus musculus] 90 1e-16
gi|30578398|ref|NP_444353.2| SWI/SNF related, matrix associated,... 90 1e-16
gi|14028667|gb|AAK52453.1| DNA-dependent ATPase SNF2L [Mus muscu... 90 1e-16
gi|15239896|ref|NP_199166.1| SNF2 domain-containing protein / he... 90 1e-16
gi|25405372|pir||D96540 hypothetical protein F11F12.23 [imported... 90 1e-16
gi|45190351|ref|NP_984605.1| AEL256Cp [Eremothecium gossypii] >g... 90 1e-16
gi|15896547|ref|NP_349896.1| Superfamily II DNA/RNA helicases, S... 89 2e-16
gi|15841592|ref|NP_336629.1| helicase, SNF2/RAD54 family [Mycoba... 90 2e-16
gi|15609238|ref|NP_216617.1| helZ [Mycobacterium tuberculosis H3... 90 2e-16
gi|31793283|ref|NP_855776.1| PROBABLE HELICASE HELZ [Mycobacteri... 90 2e-16
gi|46441365|gb|EAL00663.1| hypothetical protein CaO19.2097 [Cand... 90 2e-16
gi|6325175|ref|NP_015243.1| Essential abundant protein involved ... 90 2e-16
gi|49085796|ref|XP_404992.1| hypothetical protein AN0855.2 [Aspe... 90 2e-16
gi|50256174|gb|EAL18901.1| hypothetical protein CNBI1620 [Crypto... 90 2e-16
gi|46443104|gb|EAL02388.1| hypothetical protein CaO19.10486 [Can... 90 2e-16
gi|46228591|gb|EAK89461.1| SNF2L ortholog with a SWI/SNF2 like A... 90 2e-16
gi|48844716|ref|ZP_00299016.1| COG0553: Superfamily II DNA/RNA h... 89 2e-16
gi|29840686|ref|NP_829792.1| helicase, Snf2/Rad54 family [Chlamy... 89 2e-16
gi|10178052|dbj|BAB11535.1| helicase-like transcription factor-l... 89 2e-16
gi|1763712|emb|CAB05939.1| ywqA [Bacillus subtilis] 89 2e-16
gi|22326612|ref|NP_196132.2| SNF2 domain-containing protein / he... 89 2e-16
gi|46111685|ref|XP_382900.1| hypothetical protein FG02724.1 [Gib... 89 2e-16
gi|16080681|ref|NP_391509.1| ywqA [Bacillus subtilis subsp. subt... 89 2e-16
gi|49073298|ref|XP_400878.1| hypothetical protein UM03263.1 [Ust... 89 2e-16
gi|38344264|emb|CAE02069.2| OSJNBa0005N02.1 [Oryza sativa (japon... 87 3e-16
gi|17737463|ref|NP_523719.1| CG8625-PA [Drosophila melanogaster]... 89 3e-16
gi|20151803|gb|AAM11261.1| RH13158p [Drosophila melanogaster] 89 3e-16
gi|50557340|ref|XP_506078.1| hypothetical protein [Yarrowia lipo... 89 3e-16
gi|50257851|gb|EAL20552.1| hypothetical protein CNBE4720 [Crypto... 89 3e-16
gi|15226870|ref|NP_178318.1| SNF2 domain-containing protein / he... 89 3e-16
gi|13507759|ref|NP_109708.1| similar to helicases [Mycoplasma pn... 89 3e-16
gi|17533247|ref|NP_496802.1| TBP-associated factor BTAF homolog ... 89 3e-16
gi|49074294|ref|XP_401291.1| hypothetical protein UM03676.1 [Ust... 89 3e-16
gi|46432408|gb|EAK91891.1| hypothetical protein CaO19.13670 [Can... 89 4e-16
gi|49134234|ref|XP_413214.1| hypothetical protein AN9077.2 [Aspe... 89 4e-16
gi|15219872|ref|NP_176309.1| SNF2 domain-containing protein / he... 89 4e-16
gi|50427483|ref|XP_462354.1| unnamed protein product [Debaryomyc... 89 4e-16
gi|38105927|gb|EAA52297.1| hypothetical protein MG04989.4 [Magna... 89 4e-16
gi|41725682|ref|ZP_00152440.1| COG0553: Superfamily II DNA/RNA h... 89 4e-16
gi|50745990|ref|XP_420328.1| PREDICTED: similar to SWI/SNF-relat... 89 4e-16
gi|19704721|ref|NP_604283.1| SWF/SNF family helicase [Fusobacter... 88 5e-16
gi|29828134|ref|NP_822768.1| putative SNF2/RAD54 family helicase... 88 5e-16
gi|25517999|pir||G86156 T14P4.5 protein - Arabidopsis thaliana >... 88 5e-16
gi|31209871|ref|XP_313902.1| ENSANGP00000003358 [Anopheles gambi... 88 5e-16
gi|31216396|ref|XP_316223.1| ENSANGP00000017802 [Anopheles gambi... 88 5e-16
gi|34763541|ref|ZP_00144479.1| SWF/SNF family helicase [Fusobact... 88 5e-16
gi|25412286|pir||B84645 hypothetical protein At2g25170 [imported... 88 6e-16
gi|50254945|gb|EAL17685.1| hypothetical protein CNBL2000 [Crypto... 88 6e-16
gi|18400745|ref|NP_565587.1| chromatin remodeling factor CHD3 (P... 88 6e-16
gi|48138739|ref|XP_393420.1| similar to ENSANGP00000008413 [Apis... 88 6e-16
gi|15228256|ref|NP_188282.1| SNF2 domain-containing protein / he... 88 6e-16
gi|11994614|dbj|BAB02751.1| unnamed protein product [Arabidopsis... 88 6e-16
gi|48851519|ref|ZP_00305733.1| COG0553: Superfamily II DNA/RNA h... 88 6e-16
gi|34881588|ref|XP_229124.2| similar to SWI/SNF-related matrix-a... 88 6e-16
gi|28211487|ref|NP_782431.1| SWF/SNF family helicase [Clostridiu... 87 8e-16
gi|32416130|ref|XP_328543.1| hypothetical protein [Neurospora cr... 87 8e-16
gi|49077958|ref|XP_402781.1| hypothetical protein UM05166.1 [Ust... 87 8e-16
gi|15320696|ref|NP_203208.1| GTA [Epiphyas postvittana nucleopol... 87 8e-16
gi|28317220|gb|AAO39617.1| GH12153p [Drosophila melanogaster] 87 1e-15
gi|37699520|gb|AAB95091.3| 89B helicase [Drosophila melanogaster] 87 1e-15
gi|49075576|ref|XP_401845.1| hypothetical protein UM04230.1 [Ust... 87 1e-15
gi|6324879|ref|NP_014948.1| has strong homology to Drosophila IS... 87 1e-15
gi|48763750|ref|ZP_00268304.1| COG0553: Superfamily II DNA/RNA h... 87 1e-15
gi|50311185|ref|XP_455616.1| unnamed protein product [Kluyveromy... 87 1e-15
gi|38111185|gb|EAA56800.1| hypothetical protein MG07155.4 [Magna... 87 1e-15
gi|45199055|ref|NP_986084.1| AFR537Wp [Eremothecium gossypii] >g... 87 1e-15
gi|33086941|gb|AAP92713.1| Swi2/Snf2-related protein DDM1; decre... 87 1e-15
gi|48767278|ref|ZP_00271637.1| COG0553: Superfamily II DNA/RNA h... 87 1e-15
gi|15605284|ref|NP_220070.1| SWI/SNF family helicase [Chlamydia ... 87 1e-15
gi|50748161|ref|XP_421134.1| PREDICTED: similar to hypothetical ... 87 1e-15
gi|25013136|gb|AAN71681.1| SD16865p [Drosophila melanogaster] 87 1e-15
gi|33469139|ref|NP_115572.2| yeast INO80-like protein [Homo sapi... 87 1e-15
gi|17233188|ref|NP_490278.1| putative helicase [Nostoc sp. PCC 7... 87 1e-15
gi|24647318|ref|NP_732097.1| CG4261-PA [Drosophila melanogaster]... 87 1e-15
gi|50312307|ref|XP_456186.1| unnamed protein product [Kluyveromy... 87 1e-15
gi|37521987|ref|NP_925364.1| probable helicase [Gloeobacter viol... 87 1e-15
gi|6330933|dbj|BAA86573.1| KIAA1259 protein [Homo sapiens] 87 1e-15
gi|15835457|ref|NP_297216.1| helicase, Snf2 family [Chlamydia mu... 87 1e-15
gi|37360298|dbj|BAC98127.1| mKIAA1259 protein [Mus musculus] 87 1e-15
gi|41052809|dbj|BAD07677.1| putative photoperiod independent ear... 87 1e-15
gi|37590263|gb|AAH59235.1| 4632409L19Rik protein [Mus musculus] 87 1e-15
gi|32414725|ref|XP_327842.1| hypothetical protein [Neurospora cr... 87 1e-15
gi|23509180|ref|NP_701848.1| DNA repair protein rhp16, putative ... 87 1e-15
gi|46397086|sp|O13682|YDY1_SCHPO Hypothetical helicase C11E3.01c... 87 1e-15
gi|50290467|ref|XP_447665.1| unnamed protein product [Candida gl... 87 1e-15
gi|15240074|ref|NP_201476.1| SNF2 domain-containing protein / he... 87 1e-15
gi|34857610|ref|XP_230473.2| similar to KIAA1259 protein [Rattus... 87 1e-15
gi|12083522|gb|AAG48831.1| similar to Arabidopsis thaliana putat... 87 1e-15
gi|37542688|gb|AAL47203.1| chromatin-remodeling factor CHD3 [Ory... 87 1e-15
gi|26383483|dbj|BAB31000.2| unnamed protein product [Mus musculus] 87 1e-15
gi|37542684|gb|AAL47211.1| chromatin-remodeling factor CHD3 [Ory... 87 1e-15
gi|23612829|ref|NP_704368.1| hypothetical protein [Plasmodium fa... 87 1e-15
gi|38075621|ref|XP_355376.1| RIKEN cDNA 4632409L19 [Mus musculus] 87 1e-15
gi|31418196|gb|AAH52963.1| Unknown (protein for IMAGE:5785548) [... 86 2e-15
gi|19347965|gb|AAL86315.1| putative helicase [Arabidopsis thaliana] 86 2e-15
gi|25406830|pir||D86185 hypothetical protein [imported] - Arabid... 86 2e-15
gi|24047226|gb|AAH38596.1| CHD4 protein [Homo sapiens] 86 2e-15
gi|34535199|dbj|BAC87237.1| unnamed protein product [Homo sapiens] 86 2e-15
gi|30694618|ref|NP_191289.2| transcriptional activator, putative... 86 2e-15
gi|34914698|ref|NP_918696.1| putative DNA-dependent ATPase [Oryz... 86 2e-15
gi|26330021|dbj|BAC28749.1| unnamed protein product [Mus musculus] 86 2e-15
gi|4557453|ref|NP_001264.1| chromodomain helicase DNA binding pr... 86 2e-15
gi|19112872|ref|NP_596080.1| putative helicase [Schizosaccharomy... 86 2e-15
gi|34858460|ref|XP_232354.2| similar to chromodomain helicase DN... 86 2e-15
gi|50551961|ref|XP_503455.1| hypothetical protein [Yarrowia lipo... 86 2e-15
gi|34859306|ref|XP_341933.1| similar to Snf2-related CBP activat... 86 2e-15
gi|11359241|pir||T40642 probable helicase - fission yeast (Schiz... 86 2e-15
gi|34327954|dbj|BAA20768.2| KIAA0309 [Homo sapiens] 86 2e-15
gi|5730067|ref|NP_006653.1| Snf2-related CBP activator protein [... 86 2e-15
gi|39204553|ref|NP_666091.1| chromodomain helicase DNA binding p... 86 2e-15
gi|47217344|emb|CAG11049.1| unnamed protein product [Tetraodon n... 86 2e-15
gi|7485374|pir||T06312 hypothetical protein F11C18.100 - Arabido... 86 2e-15
gi|49093896|ref|XP_408409.1| hypothetical protein AN4272.2 [Aspe... 86 2e-15
gi|31234796|ref|XP_319118.1| ENSANGP00000022335 [Anopheles gambi... 86 2e-15
gi|42567315|ref|NP_194918.2| chromatin remodeling factor, putati... 86 2e-15
gi|15291937|gb|AAK93237.1| LD32234p [Drosophila melanogaster] 86 3e-15
gi|24656962|ref|NP_726065.1| CG9696-PD [Drosophila melanogaster]... 86 3e-15
gi|8953897|gb|AAF82185.1| helicase DOMINO A [Drosophila melanoga... 86 3e-15
gi|49389246|dbj|BAD25208.1| putative SNF2 domain-containing prot... 86 3e-15
gi|16332119|ref|NP_442847.1| helicase of the snf2/rad54 family [... 86 3e-15
gi|14090511|gb|AAK53539.1| DOMINO B [Drosophila melanogaster] 86 3e-15
gi|28573600|ref|NP_788424.1| CG9696-PE [Drosophila melanogaster]... 86 3e-15
gi|24656966|ref|NP_524833.2| CG9696-PA [Drosophila melanogaster]... 86 3e-15
gi|16198155|gb|AAL13882.1| LD35434p [Drosophila melanogaster] 86 3e-15
gi|24648168|ref|NP_732413.1| CG31212-PA [Drosophila melanogaster... 86 3e-15
gi|17862908|gb|AAL39931.1| SD02886p [Drosophila melanogaster] 86 3e-15
gi|46123559|ref|XP_386333.1| hypothetical protein FG06157.1 [Gib... 86 3e-15
gi|50555161|ref|XP_504989.1| hypothetical protein [Yarrowia lipo... 86 3e-15
gi|50548883|ref|XP_501912.1| hypothetical protein [Yarrowia lipo... 85 4e-15
gi|46104617|ref|ZP_00191573.2| COG0553: Superfamily II DNA/RNA h... 85 4e-15
gi|23481248|gb|EAA17582.1| similar nucleotide excision repair pr... 85 4e-15
gi|50554893|ref|XP_504855.1| hypothetical protein [Yarrowia lipo... 85 4e-15
gi|49104376|ref|XP_411240.1| hypothetical protein AN7103.2 [Aspe... 85 4e-15
gi|45533168|ref|ZP_00184160.1| COG0553: Superfamily II DNA/RNA h... 85 4e-15
gi|50422435|ref|XP_459783.1| unnamed protein product [Debaryomyc... 85 4e-15
gi|6319590|ref|NP_009672.1| Protein that recognizes and binds da... 85 5e-15
gi|31204937|ref|XP_311417.1| ENSANGP00000016886 [Anopheles gambi... 85 5e-15
gi|11994423|dbj|BAB02425.1| helicase-like protein [Arabidopsis t... 85 5e-15
gi|38346175|emb|CAE04093.2| OSJNBa0096F01.2 [Oryza sativa (japon... 85 5e-15
gi|33944265|ref|XP_340280.1| transcription activator, putative [... 85 5e-15
gi|50255395|gb|EAL18130.1| hypothetical protein CNBK1510 [Crypto... 85 5e-15
gi|42564102|ref|NP_187887.3| SNF2 domain-containing protein / he... 85 5e-15
gi|6322495|ref|NP_012569.1| Protein involved in transcription-co... 85 5e-15
gi|550429|emb|CAA57290.1| RAD26 [Saccharomyces cerevisiae] 85 5e-15
gi|50255809|gb|EAL18541.1| hypothetical protein CNBJ1830 [Crypto... 85 5e-15
gi|45515961|ref|ZP_00167515.1| COG0553: Superfamily II DNA/RNA h... 84 7e-15
gi|46447008|ref|YP_008373.1| conserved hypothetical protein [Par... 84 7e-15
gi|15242960|ref|NP_197667.1| SNF2 domain-containing protein / he... 84 7e-15
gi|38567839|emb|CAE05788.2| OSJNBb0020J19.17 [Oryza sativa (japo... 84 7e-15
gi|15896682|ref|NP_350031.1| DNA/RNA helicase, SNF2 [Clostridium... 84 7e-15
gi|42525525|ref|NP_970623.1| Snf2 family protein [Treponema dent... 84 7e-15
gi|28422180|gb|AAH46866.1| B230399n07-prov protein [Xenopus laevis] 84 7e-15
gi|38109409|gb|EAA55288.1| hypothetical protein MG06945.4 [Magna... 84 9e-15
gi|49089418|ref|XP_406422.1| hypothetical protein AN2285.2 [Aspe... 84 9e-15
gi|46122747|ref|XP_385927.1| hypothetical protein FG05751.1 [Gib... 84 9e-15
gi|46128445|ref|XP_388776.1| hypothetical protein FG08600.1 [Gib... 84 9e-15
gi|50792784|ref|XP_423617.1| PREDICTED: similar to Chromodomain-... 84 1e-14
gi|47206539|emb|CAF92235.1| unnamed protein product [Tetraodon n... 84 1e-14
gi|45198479|ref|NP_985508.1| AFL040Wp [Eremothecium gossypii] >g... 84 1e-14
gi|38088468|ref|XP_145698.4| similar to Chromodomain-helicase-DN... 84 1e-14
gi|47210118|emb|CAF91684.1| unnamed protein product [Tetraodon n... 84 1e-14
gi|46125779|ref|XP_387443.1| hypothetical protein FG07267.1 [Gib... 84 1e-14
gi|47211690|emb|CAF91815.1| unnamed protein product [Tetraodon n... 84 1e-14
gi|32408243|ref|XP_324603.1| hypothetical protein [Neurospora cr... 84 1e-14
gi|50557192|ref|XP_506004.1| hypothetical protein [Yarrowia lipo... 84 1e-14
gi|46228613|gb|EAK89483.1| Swr1p like SWI/SNF2 family ATpase wit... 84 1e-14
gi|34857217|ref|XP_218790.2| similar to Chromodomain-helicase-DN... 84 1e-14
gi|50749615|ref|XP_421689.1| PREDICTED: similar to TBP-associate... 84 1e-14
gi|548669|sp|P36607|RAD8_SCHPO DNA repair protein rad8 >gnl|BL_O... 83 2e-14
gi|6437558|gb|AAF08585.1| putative ATPase (ISW2-like) [Arabidops... 83 2e-14
gi|38108120|gb|EAA54198.1| hypothetical protein MG02183.4 [Magna... 83 2e-14
gi|46111317|ref|XP_382716.1| hypothetical protein FG02540.1 [Gib... 83 2e-14
gi|31241609|ref|XP_321235.1| ENSANGP00000008413 [Anopheles gambi... 83 2e-14
gi|50309923|ref|XP_454975.1| unnamed protein product [Kluyveromy... 83 2e-14
gi|4557449|ref|NP_001262.1| chromodomain helicase DNA binding pr... 83 2e-14
gi|47206405|emb|CAG01534.1| unnamed protein product [Tetraodon n... 83 2e-14
gi|49083872|ref|XP_404181.1| hypothetical protein AN0044.2 [Aspe... 83 2e-14
gi|46137317|ref|XP_390350.1| hypothetical protein FG10174.1 [Gib... 83 2e-14
gi|46226948|gb|EAK87914.1| chromodomain-helicase-DNA-binding'mul... 83 2e-14
gi|45198738|ref|NP_985767.1| AFR220Wp [Eremothecium gossypii] >g... 83 2e-14
gi|26353950|dbj|BAC40605.1| unnamed protein product [Mus musculus] 83 2e-14
gi|34865564|ref|XP_347207.1| similar to TBP-associated factor 17... 83 2e-14
gi|45187527|ref|NP_983750.1| ADL345Cp [Eremothecium gossypii] >g... 83 2e-14
gi|49388292|dbj|BAD25407.1| putative DNA repair protein rad8 [Or... 83 2e-14
gi|27477070|ref|NP_003963.1| BTAF1 RNA polymerase II, B-TFIID tr... 83 2e-14
gi|34862672|ref|XP_220044.2| similar to TBP-associated factor 17... 83 2e-14
gi|42523166|ref|NP_968546.1| putative helicase/SNF2 family domai... 83 2e-14
gi|50289791|ref|XP_447327.1| unnamed protein product [Candida gl... 83 2e-14
gi|47156981|gb|AAT12357.1| helicase MOT1-like protein [Antonospo... 83 2e-14
gi|6474545|dbj|BAA87269.1| Hypothetical nuclear protein [Schizos... 83 2e-14
gi|12044868|ref|NP_072678.1| ATP-dependent RNA helicase, putativ... 83 2e-14
gi|50256237|gb|EAL18964.1| hypothetical protein CNBI2250 [Crypto... 83 2e-14
gi|32404476|ref|XP_322851.1| hypothetical protein [Neurospora cr... 83 2e-14
gi|20988306|gb|AAH29930.1| Similar to BTAF1 RNA polymerase II, B... 83 2e-14
gi|46435782|gb|EAK95157.1| hypothetical protein CaO19.607 [Candi... 83 2e-14
gi|46435735|gb|EAK95111.1| hypothetical protein CaO19.8240 [Cand... 83 2e-14
gi|38085063|ref|XP_129248.4| RIKEN cDNA E430027O22 [Mus musculus] 83 2e-14
gi|50549971|ref|XP_502458.1| hypothetical protein [Yarrowia lipo... 83 2e-14
gi|2130312|pir||S62418 hypothetical protein SPAC22F3.03c - fissi... 82 3e-14
gi|32398963|emb|CAD98428.1| SNF2 helicase, possible [Cryptospori... 82 3e-14
gi|50424107|ref|XP_460638.1| unnamed protein product [Debaryomyc... 82 3e-14
gi|19113950|ref|NP_593038.1| hypothetical helicase; putative dna... 82 3e-14
gi|15230098|ref|NP_189077.1| SNF2 domain-containing protein / he... 82 3e-14
gi|38258935|sp|Q09772|RD54_SCHPO Meiotic recombination protein r... 82 3e-14
gi|48108143|ref|XP_396195.1| similar to ENSANGP00000016886 [Apis... 82 3e-14
gi|38110812|gb|EAA56476.1| hypothetical protein MG06447.4 [Magna... 82 3e-14
gi|19704495|ref|NP_604057.1| SWF/SNF family helicase [Fusobacter... 82 3e-14
gi|22331177|ref|NP_188552.2| DNA repair protein RAD54, putative ... 82 3e-14
gi|6319300|ref|NP_009383.1| Protein whose overexpression affects... 82 3e-14
gi|32416406|ref|XP_328681.1| hypothetical protein [Neurospora cr... 76 3e-14
gi|3413850|dbj|BAA32289.1| KIAA0444 protein [Homo sapiens] 82 4e-14
gi|32418794|ref|XP_329875.1| hypothetical protein [Neurospora cr... 82 4e-14
gi|29348762|ref|NP_812265.1| Snf2 family helicase [Bacteroides t... 82 4e-14
gi|6319722|ref|NP_009804.1| has strong homology to Drosophila IS... 82 4e-14
gi|7512678|pir||T17269 hypothetical protein DKFZp434N231.1 - hum... 82 4e-14
gi|39593093|emb|CAE64562.1| Hypothetical protein CBG09312 [Caeno... 82 4e-14
gi|24308089|ref|NP_056372.1| chromodomain helicase DNA binding p... 82 4e-14
gi|18463957|gb|AAL73042.1| chromatin complex subunit A101 [Zea m... 82 4e-14
gi|19075591|ref|NP_588091.1| DNA repair and recombination protei... 82 4e-14
gi|34872518|ref|XP_243049.2| similar to chromodomain helicase DN... 82 4e-14
gi|45185972|ref|NP_983688.1| ACR286Cp [Eremothecium gossypii] >g... 82 4e-14
gi|626929|pir||S46122 SNF2 protein homolog YBR245c - yeast (Sacc... 82 4e-14
gi|31202135|ref|XP_310015.1| ENSANGP00000015114 [Anopheles gambi... 80 4e-14
gi|586510|sp|P38086|YBS3_YEAST Hypothetical 108.0 kDa helicase i... 82 5e-14
gi|49097798|ref|XP_410359.1| hypothetical protein AN6222.2 [Aspe... 82 5e-14
gi|24666729|ref|NP_649111.1| CG9594-PA [Drosophila melanogaster]... 82 5e-14
gi|37362617|ref|NP_009629.2| genetic interaction with DMC1; Rdh5... 82 5e-14
gi|34904734|ref|NP_913714.1| helicase-like transcription factor-... 82 5e-14
gi|2645435|gb|AAB87384.1| CHD3 [Drosophila melanogaster] 82 5e-14
gi|46126713|ref|XP_387910.1| hypothetical protein FG07734.1 [Gib... 82 5e-14
gi|50420017|ref|XP_458541.1| unnamed protein product [Debaryomyc... 82 5e-14
gi|46437717|gb|EAK97058.1| hypothetical protein CaO19.7401 [Cand... 82 5e-14
gi|31240219|ref|XP_320523.1| ENSANGP00000008665 [Anopheles gambi... 81 6e-14
gi|13543768|gb|AAH06035.1| Chd4 protein [Mus musculus] 81 6e-14
gi|15224228|ref|NP_179466.1| SNF2 domain-containing protein / he... 81 6e-14
gi|31204935|ref|XP_311416.1| ENSANGP00000016881 [Anopheles gambi... 81 6e-14
gi|20259462|gb|AAM13851.1| putative ATPase (ISW2) [Arabidopsis t... 81 6e-14
gi|22330875|ref|NP_187291.2| DNA-dependent ATPase, putative [Ara... 81 6e-14
gi|50306047|ref|XP_452985.1| unnamed protein product [Kluyveromy... 81 6e-14
gi|47229701|emb|CAG06897.1| unnamed protein product [Tetraodon n... 81 6e-14
gi|14334972|gb|AAK59663.1| putative chromatin remodelling comple... 81 8e-14
gi|23482279|gb|EAA18305.1| Helicase conserved C-terminal domain,... 81 8e-14
gi|30686915|ref|NP_568365.2| DNA-dependent ATPase, putative [Ara... 81 8e-14
gi|42520462|ref|NP_966377.1| helicase, SNF2 family [Wolbachia en... 81 8e-14
gi|6323060|ref|NP_013132.1| Single-stranded DNA-dependent ATPase... 81 8e-14
gi|17562600|ref|NP_504523.1| CHromoDomain protein, helicase Mi-2... 81 8e-14
gi|38079062|ref|XP_196334.3| similar to chromodomain helicase DN... 81 8e-14
gi|46125449|ref|XP_387278.1| hypothetical protein FG07102.1 [Gib... 81 8e-14
gi|50289267|ref|XP_447064.1| unnamed protein product [Candida gl... 81 8e-14
gi|30686918|ref|NP_850847.1| DNA-dependent ATPase, putative [Ara... 81 8e-14
gi|38102523|gb|EAA49354.1| hypothetical protein MG01012.4 [Magna... 81 8e-14
gi|23481408|gb|EAA17695.1| SNF2 family N-terminal domain, putati... 81 8e-14
gi|50303981|ref|XP_451940.1| unnamed protein product [Kluyveromy... 81 8e-14
gi|50419689|ref|XP_458372.1| unnamed protein product [Debaryomyc... 81 8e-14
gi|6321012|ref|NP_011091.1| Sole S. cerevisiae member of CHD gen... 80 1e-13
gi|17569817|ref|NP_510140.1| CHromoDomain protein, DNA binding h... 80 1e-13
gi|38233618|ref|NP_939385.1| SNF2/RAD54 family protein [Coryneba... 80 1e-13
gi|25407048|pir||F86218 protein F22O13.8 [imported] - Arabidopsi... 80 1e-13
gi|134584|sp|P28370|SN21_HUMAN Possible global transcription act... 80 1e-13
gi|30840950|gb|AAL29689.1| Snf2-related chromatin remodeling fac... 80 1e-13
gi|479805|pir||S35458 SNF2 protein homolog - human (fragment) >g... 80 1e-13
gi|21071046|ref|NP_620604.1| SWI/SNF-related matrix-associated a... 80 1e-13
gi|7485004|pir||T00713 helicase homolog F22O13.8 - Arabidopsis t... 80 1e-13
gi|23612323|ref|NP_703903.1| iswi protein homologue [Plasmodium ... 80 1e-13
gi|21071044|ref|NP_003060.2| SWI/SNF-related matrix-associated a... 80 1e-13
gi|50293969|ref|XP_449396.1| unnamed protein product [Candida gl... 80 1e-13
gi|38109494|gb|EAA55357.1| hypothetical protein MG07014.4 [Magna... 80 1e-13
gi|50310795|ref|XP_455420.1| unnamed protein product [Kluyveromy... 80 1e-13
gi|2967452|dbj|BAA25173.1| hSNF2H [Homo sapiens] >gnl|BL_ORD_ID|... 80 1e-13
gi|21071058|ref|NP_003592.2| SWI/SNF-related matrix-associated a... 80 1e-13
gi|49089344|ref|XP_406393.1| hypothetical protein AN2256.2 [Aspe... 80 1e-13
gi|14028669|gb|AAK52454.1| DNA-dependent ATPase SNF2H [Mus muscu... 80 1e-13
gi|34851567|ref|XP_226380.2| similar to ATP-dependent chromatin ... 80 1e-13
>gi|17561718|ref|NP_503548.1| SNF2 related domain and helicase,
C-terminal family member (5C489) [Caenorhabditis elegans]
gi|25396267|pir||G88961 protein F59A7.8 [imported] - Caenorhabditis
elegans
gi|2291218|gb|AAB65339.1| Hypothetical protein F59A7.8
[Caenorhabditis elegans]
Length = 518
Score = 1014 bits (2622), Expect = 0.0
Identities = 507/518 (97%), Positives = 507/518 (97%)
Frame = +1
Query: 1 MNVSDPSKNEYSKEIRRTVSSEIIGQSRSPMTLENQPVSPMTKRRRLENMDRTITEQMVE 180
MNVSDPSKNEYSKEIRRTVSSEIIGQSRSPMTLENQPVSPMTKRRRLENMDRTITEQMVE
Sbjct: 1 MNVSDPSKNEYSKEIRRTVSSEIIGQSRSPMTLENQPVSPMTKRRRLENMDRTITEQMVE 60
Query: 181 DEIVATAISPPSQPKNVVVPIPQDFAAMLTNSWTKPIRGPMTEKKKLKINETFNKLTQQL 360
DEIVATAISPPSQPKNVVVPIPQDFAAMLTNSWTKPIRGPMTEKKKLKINETFNKLTQQL
Sbjct: 61 DEIVATAISPPSQPKNVVVPIPQDFAAMLTNSWTKPIRGPMTEKKKLKINETFNKLTQQL 120
Query: 361 ADATHTIPAETDLTETPDGFLVDLMPHQKAGLCWLLWRESQPHSXXXXXXXXXXXKTLSM 540
ADATHTIPAETDLTETPDGFLVDLMPHQKAGLCWLLWRESQPHS KTLSM
Sbjct: 121 ADATHTIPAETDLTETPDGFLVDLMPHQKAGLCWLLWRESQPHSGGILGGDMGLGKTLSM 180
Query: 541 ISLIVHQKAARKTRKDAGDDAIAPESLVHHWEAEIARRLKQDLLSVLVYHGNRRHINPKD 720
ISLIVHQKAARKTRKDAGDDAIAPESLVHHWEAEIARRLKQDLLSVLVYHGNRRHINPKD
Sbjct: 181 ISLIVHQKAARKTRKDAGDDAIAPESLVHHWEAEIARRLKQDLLSVLVYHGNRRHINPKD 240
Query: 721 LKKHIELDYDLEDEHNPCSKLRPRVCPKADKNSSPLARIAWSYVILDEAHIIKNRNAQCS 900
LKKHIELDYDLEDEHNPCSKLRPRVCPKADKNSSPLARIAWSYVILDEAHIIKNRNAQCS
Sbjct: 241 LKKHIELDYDLEDEHNPCSKLRPRVCPKADKNSSPLARIAWSYVILDEAHIIKNRNAQCS 300
Query: 901 EAACKISAFSRWCLSGTPIHNNMRRKKIVHLMEKNIVIHKLEMVGQEAKGFAMMMEAALS 1080
EAACKISAFSRWCLSGTPIHNNMRRKKIVHLMEKNIVIHKLEMVGQEAKGFAMMMEAALS
Sbjct: 301 EAACKISAFSRWCLSGTPIHNNMRRKKIVHLMEKNIVIHKLEMVGQEAKGFAMMMEAALS 360
Query: 1081 LSPNGLLFCVSCKDIQEGGHGYTSITGEVAIKDRQERVDSFNQEKGGAQDMLLSLTAGGV 1260
LSPNGLLFCVSCKDIQEGGHGYTSITGEVAIKDRQERVDSFNQEKGGAQDMLLSLTAGGV
Sbjct: 361 LSPNGLLFCVSCKDIQEGGHGYTSITGEVAIKDRQERVDSFNQEKGGAQDMLLSLTAGGV 420
Query: 1261 GLNLIGGNHLIMVDLHWNPALEQQACDRIYRMGQKKEVHIHRLIVKETIEQRVMSLQEKK 1440
GLNLIGGNHLIMVDLHWNPALEQQACDRIYRMGQKKEVHIHRLIVKETIEQRVMSLQEKK
Sbjct: 421 GLNLIGGNHLIMVDLHWNPALEQQACDRIYRMGQKKEVHIHRLIVKETIEQRVMSLQEKK 480
Query: 1441 LALAASVLEGSATRGMNKLTNSDIRTLFGLDEEFELDT 1554
LALAASVLEGSATRGMNKLTNSDIRTLFGLDEEFELDT
Sbjct: 481 LALAASVLEGSATRGMNKLTNSDIRTLFGLDEEFELDT 518