Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= F59D6_1
         (1425 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17561740|ref|NP_503825.1| aspartic protease family member (5D...   921   0.0
gi|34146966|gb|AAB65877.2| Hypothetical protein F59D6.2 [Caenorh...   627   e-178
gi|17561738|ref|NP_503826.1| aspartic protease precursor family ...   626   e-178
gi|39580229|emb|CAE72985.1| Hypothetical protein CBG20329 [Caeno...   383   e-105
gi|25151802|ref|NP_741677.1| aspartic protease (42.7 kD) (asp-1)...   357   4e-97
gi|3413442|emb|CAA08899.1| aspartic protease [Caenorhabditis ele...   347   5e-94
gi|25155274|ref|NP_741674.1| aspartic protease precursor family ...   344   3e-93
gi|39580231|emb|CAE72987.1| Hypothetical protein CBG20332 [Caeno...   308   2e-82
gi|11359778|pir||T45036 hypothetical protein Y39B6B.j [imported]...   307   4e-82
gi|17566864|ref|NP_507653.1| predicted CDS, aspartic protease fa...   307   5e-82
gi|25154801|ref|NP_741675.1| predicted CDS, aspartic protease pr...   301   3e-80
gi|4103749|gb|AAD09345.1| aspartic protease precursor [Strongylo...   293   7e-78
gi|25151573|ref|NP_741673.1| aspartic protease precursor family ...   282   2e-74
gi|39588731|emb|CAE58255.1| Hypothetical protein CBG01356 [Caeno...   272   2e-71
gi|11265726|pir||T45035 hypothetical protein Y39B6B.i [imported]...   271   2e-71
gi|11359777|pir||T45034 hypothetical protein Y39B6B.h [imported]...   256   7e-67
gi|1507727|gb|AAB06576.1| aspartic protease                           254   5e-66
gi|39590349|emb|CAE66088.1| Hypothetical protein CBG11305 [Caeno...   233   8e-60
gi|39590348|emb|CAE66087.1| Hypothetical protein CBG11304 [Caeno...   232   1e-59
gi|39588689|emb|CAE58213.1| Hypothetical protein CBG01308 [Caeno...   232   1e-59
gi|17557208|ref|NP_505133.1| aspartic protease (41.5 kD) (asp-6)...   228   4e-58
gi|17557206|ref|NP_505135.1| aspartic protease (42.0 kD) (asp-5)...   225   2e-57
gi|17560024|ref|NP_505134.1| aspartic protease precursor family ...   220   7e-56
gi|39590347|emb|CAE66086.1| Hypothetical protein CBG11303 [Caeno...   216   1e-54
gi|21907887|dbj|BAC05688.1| aspartic protease BmAsp-1 [Brugia ma...   216   1e-54
gi|39588688|emb|CAE58212.1| Hypothetical protein CBG01307 [Caeno...   216   1e-54
gi|25154798|ref|NP_741676.1| aspartic protease family member (5T...   212   2e-53
gi|39583893|emb|CAE63983.1| Hypothetical protein CBG08575 [Caeno...   210   8e-53
gi|17557992|ref|NP_506185.1| pepsinogen precursor family member ...   202   2e-50
gi|104296|pir||A39314 gastricsin (EC 3.4.23.3) precursor - bullf...   199   1e-49
gi|25289999|pir||JC7573 pepsinogen C - African clawed frog >gnl|...   198   3e-49
gi|7507925|pir||T29692 hypothetical protein T18H9.2 - Caenorhabd...   195   2e-48
gi|32566657|ref|NP_872129.1| aspartic protease (46.6 kD) (asp-2)...   195   2e-48
gi|32566655|ref|NP_505384.2| aspartic protease (asp-2) [Caenorha...   195   2e-48
gi|9798654|dbj|BAB11749.1| pepsinogen A [Suncus murinus]              194   3e-48
gi|39581226|emb|CAE70423.1| Hypothetical protein CBG16997 [Caeno...   194   6e-48
gi|18203304|sp|Q9N2D3|PEPC_CALJA Gastricsin precursor (Pepsinoge...   193   7e-48
gi|39594552|emb|CAE72130.1| Hypothetical protein CBG19226 [Caeno...   191   5e-47
gi|7435833|pir||JE0371 pepsin C (EC 3.4.23.-) precursor - chicken     190   8e-47
gi|4589842|dbj|BAA76892.1| pepsinogen C [Gallus gallus]               190   8e-47
gi|45382395|ref|NP_990208.1| pepsinogen C [Gallus gallus] >gnl|B...   190   8e-47
gi|9798664|dbj|BAB11754.1| pepsinogen C [Sorex unguiculatus]          188   2e-46
gi|129797|sp|P03955|PEPC_MACFU Gastricsin precursor (Pepsinogen ...   187   7e-46
gi|387014|gb|AAA60062.1| pepsinogen                                   187   7e-46
gi|4505757|ref|NP_002621.1| progastricsin (pepsinogen C); Prepro...   187   7e-46
gi|25290001|pir||JC7575 pepsinogen A - bullfrog >gnl|BL_ORD_ID|3...   186   9e-46
gi|9798662|dbj|BAB11753.1| pepsinogen C [Suncus murinus]              186   1e-45
gi|9798666|dbj|BAB11755.1| pepsinogen C [Rhinolophus ferrumequinum]   186   2e-45
gi|48675385|ref|NP_001001600.1| pepsinogen A [Bos taurus] >gnl|B...   184   4e-45
gi|12043774|gb|AAG47643.1| progastricsin [Salvelinus fontinalis]      181   4e-44
gi|999902|pdb|1HTR|B Chain B, Progastricsin (Pepsinogen C) (E.C....   181   4e-44
gi|29244579|ref|NP_080249.2| progastricsin (pepsinogen C); urina...   181   5e-44
gi|18203305|sp|Q9N2D4|PEPA_CALJA Pepsin A precursor >gnl|BL_ORD_...   180   8e-44
gi|3024367|sp|Q64411|PEPC_CAVPO Gastricsin precursor (Pepsinogen...   179   1e-43
gi|39581556|emb|CAE58341.1| Hypothetical protein CBG01462 [Caeno...   179   1e-43
gi|9798656|dbj|BAB11750.1| pepsinogen A [Sorex unguiculatus]          179   1e-43
gi|11990128|emb|CAC19555.1| pepsin A [Camelus dromedarius]            179   2e-43
gi|12082176|dbj|BAB20798.1| pepsinogen A [Xenopus laevis]             178   3e-43
gi|11493777|gb|AAG35646.1| progastricsin [Salvelinus fontinalis]      178   3e-43
gi|18959216|ref|NP_579818.1| progastricsin; progastricsin (pepsi...   177   4e-43
gi|9798658|dbj|BAB11751.1| pepsinogen A [Rhinolophus ferrumequinum]   177   5e-43
gi|45382405|ref|NP_990209.1| pepsinogen A [Gallus gallus] >gnl|B...   177   7e-43
gi|45384244|ref|NP_990385.1| pepsinogen [Gallus gallus] >gnl|BL_...   176   9e-43
gi|360431|prf||1403354A pepsinogen                                    176   9e-43
gi|9798668|dbj|BAB11756.1| pepsinogen C [Oryctolagus cuniculus]       176   1e-42
gi|20129385|ref|NP_609235.1| CG13095-PA [Drosophila melanogaster...   176   2e-42
gi|25290000|pir||JC7574 pepsinogen A - African clawed frog            175   2e-42
gi|50260546|gb|EAL23201.1| hypothetical protein CNBA5450 [Crypto...   175   2e-42
gi|48374065|ref|NP_001001536.1| pregnancy-associated glycoprotei...   175   2e-42
gi|8896140|gb|AAF81255.1| pregnancy-associated glycoprotein 6 [S...   175   3e-42
gi|129776|sp|P03954|PEP1_MACFU Pepsin A-1 precursor (Pepsin III-...   174   4e-42
gi|164604|gb|AAA31096.1| pepsinogen A precursor                       174   6e-42
gi|129793|sp|P11489|PEPA_MACMU Pepsin A precursor >gnl|BL_ORD_ID...   173   8e-42
gi|23943854|ref|NP_055039.1| pepsinogen 5, group I (pepsinogen A...   173   8e-42
gi|115721|sp|P25796|CATE_CAVPO Cathepsin E precursor >gnl|BL_ORD...   173   1e-41
gi|46395760|sp|Q805F2|CTE2_XENLA Cathepsin E2 precursor >gnl|BL_...   173   1e-41
gi|50760547|ref|XP_425832.1| PREDICTED: similar to pepsinogen B ...   173   1e-41
gi|50593064|gb|AAT79343.1| ASP-1 [Parastrongyloides trichosuri]       172   1e-41
gi|129792|sp|P00790|PEPA_HUMAN Pepsin A precursor >gnl|BL_ORD_ID...   172   1e-41
gi|2136603|pir||I46617 pregnancy-associated glycoprotein - pig >...   172   2e-41
gi|530795|gb|AAA20876.1| pepsinogen                                   172   2e-41
gi|49019533|emb|CAD80098.1| gastricsin [Trematomus bernacchii]        171   3e-41
gi|129786|sp|P27678|PEP4_MACFU Pepsin A-4 precursor (Pepsin I/II...   171   3e-41
gi|625424|pir||B30142 pepsin A (EC 3.4.23.1) 4 precursor - human      171   3e-41
gi|129780|sp|P27677|PEP2_MACFU Pepsin A-2/A-3 precursor (Pepsin ...   171   3e-41
gi|4503145|ref|NP_001901.1| cathepsin E isoform a preproprotein;...   171   4e-41
gi|2689727|gb|AAB91422.1| pregnancy-associated glycoprotein [Fel...   171   5e-41
gi|625423|pir||A30142 pepsin A (EC 3.4.23.1) 5 precursor - human      171   5e-41
gi|2664292|emb|CAA75754.1| cellular aspartic protease [Aspergill...   171   5e-41
gi|5921651|gb|AAD56284.1| pepsinogen A form IIb precursor [Pseud...   171   5e-41
gi|231168|pdb|5PEP|  Pepsin (E.C.3.4.23.1)                            171   5e-41
gi|47523112|ref|NP_999038.1| pepsin; pepsinogen [Sus scrofa] >gn...   170   7e-41
gi|230676|pdb|2PSG|  Pepsinogen >gnl|BL_ORD_ID|1163236 gi|230912...   170   7e-41
gi|30575834|gb|AAP32823.1| aspartyl proteinase [Paracoccidioides...   170   9e-41
gi|46138535|ref|XP_390958.1| hypothetical protein FG10782.1 [Gib...   169   1e-40
gi|46395761|sp|Q805F3|CTE1_XENLA Cathepsin E1 precursor >gnl|BL_...   169   1e-40
gi|17560290|ref|NP_505232.1| aspartic protease precursor family ...   169   1e-40
gi|31197673|ref|XP_307784.1| ENSANGP00000013568 [Anopheles gambi...   169   1e-40
gi|129783|sp|P27822|PEP3_RABIT Pepsin III precursor (Pepsin A) >...   169   1e-40
gi|1858020|gb|AAC60301.1| cathepsin D [Oncorhynchus mykiss]           169   1e-40
gi|387013|gb|AAA60061.1| pepsinogen A                                 169   1e-40
gi|21914374|gb|AAM81358.1| aspartyl proteinase [Leptosphaeria ma...   169   1e-40
gi|2288908|emb|CAA71859.1| cathepsin E [Mus musculus]                 169   1e-40
gi|6681081|ref|NP_031825.1| cathepsin E preproprotein [Mus muscu...   169   1e-40
gi|19911571|dbj|BAB86888.1| pepsinogen B [Canis familiaris]           169   1e-40
gi|22218078|dbj|BAC07516.1| pepsinogen III [Oryctolagus cuniculus]    169   2e-40
gi|5748654|emb|CAA08880.2| cathepsin E protein [Mus musculus]         169   2e-40
gi|34576991|gb|AAQ75735.1| pregnancy-associated glycoprotein 8 [...   168   3e-40
gi|494476|pdb|1PSA|A Chain A, Pepsin Hydrolase (Acid Proteinase)...   168   3e-40
gi|6760077|gb|AAF28186.1| aspartyl proteinase [Coccidioides immi...   168   3e-40
gi|2499824|sp|Q28389|PAG_HORSE Pregnancy-associated glycoprotein...   168   3e-40
gi|46395759|sp|Q800A0|CATE_RANCA Cathepsin E precursor >gnl|BL_O...   168   3e-40
gi|230907|pdb|3PEP|  Pepsin (E.C.3.4.23.1) >gnl|BL_ORD_ID|165015...   168   3e-40
gi|13096225|pdb|1F34|A Chain A, Crystal Structure Of Ascaris Pep...   168   3e-40
gi|9798660|dbj|BAB11752.1| pepsinogen A [Canis familiaris]            167   4e-40
gi|38303893|gb|AAH62002.1| Ctse protein [Rattus norvegicus]           167   4e-40
gi|2851407|sp|P16228|CATE_RAT Cathepsin E precursor >gnl|BL_ORD_...   167   4e-40
gi|129802|sp|P27823|PEPF_RABIT Pepsin F precursor >gnl|BL_ORD_ID...   167   6e-40
gi|16974928|pdb|1FLH|A Chain A, Crystal Structure Of Human Urope...   167   6e-40
gi|46397366|sp|P14091|CATE_HUMAN Cathepsin E precursor                167   6e-40
gi|28603736|ref|NP_788802.1| pregnancy-associated glycoprotein 2...   167   7e-40
gi|6325103|ref|NP_015171.1| vacuolar proteinase A; Pep4p [Saccha...   167   7e-40
gi|1065258|pdb|1PSN|  Pepsin 3a (E.C.3.4.23.1) >gnl|BL_ORD_ID|25...   167   7e-40
gi|2624629|pdb|2JXR|A Chain A, Structure Of Yeast Proteinase A >...   167   7e-40
gi|7766834|pdb|1DP5|A Chain A, The Structure Of Proteinase A Com...   167   7e-40
gi|3288145|emb|CAA76563.1| preprocathepsin D [Dictyostelium disc...   166   1e-39
gi|50557048|ref|XP_505932.1| hypothetical protein [Yarrowia lipo...   166   1e-39
gi|129791|sp|P00793|PEPA_CHICK Pepsin A precursor                     166   1e-39
gi|109338|pir||A38302 pepsin (EC 3.4.23.-) F precursor - rabbit       166   1e-39
gi|3392909|emb|CAA20104.1| EG:EG0001.1 [Drosophila melanogaster]      166   1e-39
gi|17986011|ref|NP_525030.1| CG13374-PA [Drosophila melanogaster...   166   1e-39
gi|49091158|ref|XP_407040.1| hypothetical protein AN2903.2 [Aspe...   166   1e-39
gi|47523226|ref|NP_998974.1| pregnancy-associated glycoprotein 3...   166   2e-39
gi|109340|pir||C38302 pepsin (EC 3.4.23.-) II-2/3 precursor - ra...   166   2e-39
gi|129781|sp|P27821|PEP2_RABIT Pepsin II-2/3 precursor (Pepsin A...   166   2e-39
gi|1710090|sp|P52115|RENI_SHEEP Renin precursor (Angiotensinogen...   165   2e-39
gi|129787|sp|P28713|PEP4_RABIT Pepsin II-4 precursor (Pepsin A) ...   165   2e-39
gi|1585064|prf||2124254A pepsin:ISOTYPE=3a >gnl|BL_ORD_ID|864601...   165   2e-39
gi|47213062|emb|CAF91576.1| unnamed protein product [Tetraodon n...   165   2e-39
gi|6179993|gb|AAF05743.1| pregnancy-associated glycoprotein-4 [C...   165   3e-39
gi|2499825|sp|Q29078|PAG1_PIG Pregnancy-associated glycoprotein ...   164   4e-39
gi|6179997|gb|AAF05745.1| pregnancy-associated glycoprotein-6 [C...   164   5e-39
gi|543860|sp|Q03168|ASPP_AEDAE Lysosomal aspartic protease precu...   164   5e-39
gi|1168791|sp|P43159|CATE_RABIT Cathepsin E precursor >gnl|BL_OR...   164   5e-39
gi|1585066|prf||2124254C pepsin:ISOTYPE=3c                            164   5e-39
gi|6753556|ref|NP_034113.1| cathepsin D [Mus musculus] >gnl|BL_O...   164   6e-39
gi|223891|prf||1004236A renin                                         164   6e-39
gi|2689725|gb|AAB91421.1| pregnancy-associated glycoprotein [Equ...   164   6e-39
gi|132329|sp|P00796|RENS_MOUSE Renin 2 precursor (Angiotensinoge...   164   6e-39
gi|13676837|ref|NP_112469.1| renin 1 structural [Mus musculus] >...   163   8e-39
gi|129777|sp|P28712|PEP1_RABIT Pepsin II-1 precursor (Pepsin A) ...   163   8e-39
gi|2499826|sp|Q29079|PAG2_PIG Pregnancy-associated glycoprotein ...   163   8e-39
gi|2055435|gb|AAB53225.1| pregnancy-associated glycoprotein 4 [O...   163   8e-39
gi|17538662|ref|NP_500928.1| cathepsin e family member (4G953) [...   163   8e-39
gi|39584216|emb|CAE61591.1| Hypothetical protein CBG05505 [Caeno...   163   8e-39
gi|494607|pdb|1SMR|A Chain A, Renin (E.C.3.4.23.15) Complex With...   163   1e-38
gi|40557489|gb|AAR88043.1| pregnancy-associated glycoprotein 2 [...   162   1e-38
gi|11120702|ref|NP_068521.1| pepsinogen F protein [Rattus norveg...   162   2e-38
gi|15079273|gb|AAH11473.1| Renin 2 tandem duplication of Ren1 [M...   162   2e-38
gi|2055433|gb|AAB53224.1| pregnancy-associated glycoprotein 3 [O...   161   3e-38
gi|14278413|pdb|1G0V|A Chain A, The Structure Of Proteinase A Co...   161   3e-38
gi|21629629|gb|AAM61957.1| synthetic renin 2/1d [Mus musculus]        161   3e-38
gi|28207660|gb|AAO32627.1| pregnancy-associated glycoprotein 5 [...   161   3e-38
gi|31197675|ref|XP_307785.1| ENSANGP00000022754 [Anopheles gambi...   161   4e-38
gi|31981154|ref|NP_067428.2| pepsinogen 5, group I; pepsinogen F...   161   4e-38
gi|38195404|gb|AAR13364.1| aspartic proteinase precursor [Botryo...   161   4e-38
gi|40557491|gb|AAR88044.1| pregnancy-associated glycoprotein 2 v...   161   4e-38
gi|28849951|ref|NP_788787.1| pregnancy-associated glycoprotein 2...   161   4e-38
gi|42476045|ref|NP_599161.2| cathepsin D [Rattus norvegicus] >gn...   160   5e-38
gi|49019802|emb|CAD80095.2| pepsin A1 [Trematomus bernacchii]         160   5e-38
gi|6179987|gb|AAF05740.1| pregnancy-associated glycoprotein-1 [C...   160   5e-38
gi|200688|gb|AAA40043.1| renin (Ren-1-d)                              160   7e-38
gi|7341306|gb|AAF61241.1| pepsinogen F [Mus musculus]                 160   7e-38
gi|12843350|dbj|BAB25952.1| unnamed protein product [Mus musculus]    160   7e-38
gi|38073842|ref|XP_110285.2| similar to renin (Ren-1-d) [Mus mus...   160   7e-38
gi|28603730|ref|NP_788799.1| pregnancy-associated glycoprotein 1...   160   7e-38
gi|7435834|pir||T10264 pregnancy-specific antigen 7 precursor - ...   160   9e-38
gi|40557487|gb|AAR88042.1| pregnancy-associated glycoprotein 1 [...   160   9e-38
gi|28603728|ref|NP_788798.1| pregnancy-associated glycoprotein 1...   159   1e-37
gi|24647683|ref|NP_650623.1| CG5863-PA [Drosophila melanogaster]...   159   2e-37
gi|871442|emb|CAA25391.1| renin [Mus musculus]                        159   2e-37
gi|24583545|ref|NP_609457.1| CG6508-PA [Drosophila melanogaster]...   158   3e-37
gi|6179991|gb|AAF05742.1| pregnancy-associated glycoprotein-3 [C...   158   3e-37
gi|49019527|emb|CAD80096.1| pepsin A2 [Trematomus bernacchii]         158   3e-37
gi|21392388|dbj|BAC00850.1| pepsinogen [Aspergillus oryzae]           158   3e-37
gi|1246038|gb|AAB35842.1| pepsinogen A [turtles, Peptide, 361 aa]     158   3e-37
gi|13654253|ref|NP_112470.1| renin 2 tandem duplication of Ren1 ...   158   3e-37
gi|223468|prf||0807285A renin precursor                               158   3e-37
gi|28603726|ref|NP_788797.1| pregnancy-associated glycoprotein 1...   158   3e-37
gi|6179995|gb|AAF05744.1| pregnancy-associated glycoprotein-5 [C...   158   3e-37
gi|2118133|pir||JC4870 pepsin A (EC 3.4.23.1) precursor - soft-s...   157   4e-37
gi|115720|sp|P24268|CATD_RAT Cathepsin D precursor >gnl|BL_ORD_I...   157   4e-37
gi|3378161|emb|CAA07719.1| cathepsin D [Chionodraco hamatus]          157   4e-37
gi|27806043|ref|NP_776836.1| pregnancy-associated glycoprotein 1...   157   4e-37
gi|19921120|ref|NP_609458.1| CG17134-PA [Drosophila melanogaster...   157   6e-37
gi|22651403|gb|AAL61540.1| cathepsin D precursor [Danio rerio]        157   6e-37
gi|27503926|gb|AAH42316.1| Ctsd protein [Danio rerio] >gnl|BL_OR...   157   6e-37
gi|49019530|emb|CAD80097.1| pepsin A3 [Trematomus bernacchii]         157   6e-37
gi|2136604|pir||I47176 chymosin (EC 3.4.23.4) precursor - pig (f...   157   6e-37
gi|28603722|ref|NP_788794.1| pregnancy-associated glycoprotein 1...   157   6e-37
gi|28603738|ref|NP_788803.1| pregnancy-associated glycoprotein 2...   157   8e-37
gi|2347147|gb|AAC37302.1| aspartic proteinase precursor [Schisto...   157   8e-37
gi|34740274|dbj|BAC87742.1| pepsinogen [Paralichthys olivaceus]       157   8e-37
gi|2102722|gb|AAB63357.1| aspartic protease precursor [Schistoso...   157   8e-37
gi|6224883|gb|AAF05996.1| pregnancy-associated glycoprotein-13 [...   156   1e-36
gi|50058380|gb|AAT68959.1| preprorenin [Canis familiaris]             156   1e-36
gi|25452827|sp|Q9DEX3|CATD_CLUHA Cathepsin D precursor >gnl|BL_O...   155   2e-36
gi|39540664|tpg|DAA01803.1| TPA: pro-renin [Takifugu rubripes]        155   2e-36
gi|402686|gb|AAA30684.1| pregnancy-specific glycoprotein              155   3e-36
gi|39590350|emb|CAE66089.1| Hypothetical protein CBG11306 [Caeno...   155   3e-36
gi|1246039|gb|AAB35843.1| pepsinogen 2 [tuna, Peptide, 360 aa]        155   3e-36
gi|18858489|ref|NP_571785.1| cathepsin D; etID16901.18 [Danio re...   154   5e-36
gi|5921649|gb|AAD56283.1| pepsinogen A form IIa [Pseudopleuronec...   154   5e-36
gi|1350571|sp|P08424|RENI_RAT Renin precursor (Angiotensinogenas...   154   5e-36
gi|40557503|gb|AAR88050.1| pregnancy-associated glycoprotein 8 [...   153   8e-36
gi|6180005|gb|AAF05749.1| pregnancy-associated glycoprotein-10 [...   153   1e-35
gi|40557501|gb|AAR88049.1| pregnancy-associated glycoprotein 7 [...   153   1e-35
gi|109130|pir||A41545 pregnancy-specific antigen 1 precursor - s...   153   1e-35
gi|1778026|gb|AAB63442.1| aspartic proteinase [Schistosoma mansoni]   153   1e-35
gi|50306705|ref|XP_453326.1| unnamed protein product [Kluyveromy...   153   1e-35
gi|40557499|gb|AAR88048.1| pregnancy-associated glycoprotein 6 [...   152   1e-35
gi|28603710|ref|NP_788788.1| pregnancy-associated glycoprotein 4...   152   1e-35
gi|206609|gb|AAA42030.1| preprorenin (EC 3.4.99.19)                   152   2e-35
gi|57046|emb|CAA30082.1| unnamed protein product [Rattus norvegi...   152   2e-35
gi|6224885|gb|AAF05997.1| pregnancy-associated glycoprotein-14 [...   152   2e-35
gi|45185829|ref|NP_983545.1| ACR143Wp [Eremothecium gossypii] >g...   151   3e-35
gi|18152941|gb|AAB68519.2| proteinase A [Pichia angusta]              151   3e-35
gi|21907889|dbj|BAC05689.1| aspartic protease BmAsp-2 [Brugia ma...   151   3e-35
gi|16119024|gb|AAL14708.1| aspartic protease [Clonorchis sinensis]    151   3e-35
gi|47223178|emb|CAG11313.1| unnamed protein product [Tetraodon n...   151   3e-35
gi|6179989|gb|AAF05741.1| pregnancy-associated glycoprotein-2 [C...   151   3e-35
gi|28603732|ref|NP_788800.1| pregnancy-associated glycoprotein 1...   151   4e-35
gi|6180001|gb|AAF05747.1| pregnancy-associated glycoprotein-8 [C...   151   4e-35
gi|49077340|ref|XP_402541.1| hypothetical protein UM04926.1 [Ust...   151   4e-35
gi|32421211|ref|XP_331049.1| VACUOLAR PROTEASE A PRECURSOR [Neur...   151   4e-35
gi|30584113|gb|AAP36305.1| Homo sapiens cathepsin D (lysosomal a...   150   5e-35
gi|4503143|ref|NP_001900.1| cathepsin D preproprotein [Homo sapi...   150   5e-35
gi|6180003|gb|AAF05748.1| pregnancy-associated glycoprotein-9 [C...   150   7e-35
gi|41053329|ref|NP_956325.1| Unknown (protein for MGC:63831); wu...   150   7e-35
gi|28849955|ref|NP_788795.1| pregnancy-associated glycoprotein 1...   150   7e-35
gi|12832561|dbj|BAB22158.1| unnamed protein product [Mus musculus]    150   9e-35
gi|17549907|ref|NP_509142.1| aspartic protease (43.4 kD) (asp-3)...   150   9e-35
gi|49522906|gb|AAH75134.1| Unknown (protein for IMAGE:7009273) [...   150   9e-35
gi|48734644|gb|AAH72252.1| Unknown (protein for MGC:82347) [Xeno...   150   9e-35
gi|9581803|emb|CAC00542.1| necepsin I [Necator americanus]            150   9e-35
gi|40557493|gb|AAR88045.1| pregnancy-associated glycoprotein 3 [...   150   9e-35
gi|50728326|ref|XP_416090.1| PREDICTED: similar to aspartic prot...   149   1e-34
gi|6680552|ref|NP_032463.1| napsin A aspartic peptidase; kidney-...   149   1e-34
gi|1619323|emb|CAA69878.1| aspartic protease [Trematomus bernacc...   149   1e-34
gi|6180007|gb|AAF05750.1| pregnancy-associated glycoprotein-11 [...   149   1e-34
gi|28603714|ref|NP_788790.1| pregnancy-associated glycoprotein 6...   149   1e-34
gi|4927648|gb|AAD33219.1| cathepsin D; lysosomal aspartic protei...   149   2e-34
gi|50294061|ref|XP_449442.1| unnamed protein product [Candida gl...   149   2e-34
gi|21552717|gb|AAM62283.1| cathepsin D preproprotein [Silurus as...   149   2e-34
gi|1585311|prf||2124395A Asp protease                                 149   2e-34
gi|28603718|ref|NP_788792.1| pregnancy-associated glycoprotein 8...   148   3e-34
gi|9581805|emb|CAC00543.1| necepsin II [Necator americanus]           148   3e-34
gi|39586749|emb|CAE65791.1| Hypothetical protein CBG10895 [Caeno...   148   3e-34
gi|46309251|dbj|BAD15111.1| cathepsin D [Todarodes pacificus]         148   4e-34
gi|2499817|sp|Q01294|CARP_NEUCR Vacuolar protease A precursor >g...   148   4e-34
gi|28603734|ref|NP_788801.1| pregnancy-associated glycoprotein 1...   147   5e-34
gi|6978973|dbj|BAA90785.1| aspartic proteinase family member sim...   147   5e-34
gi|28573989|ref|NP_787961.1| CG33128-PA [Drosophila melanogaster...   147   6e-34
gi|50401196|sp|Q9TSZ1|RENI_CALJA Renin precursor (Angiotensinoge...   147   8e-34
gi|40557497|gb|AAR88047.1| pregnancy-associated glycoprotein 5 [...   147   8e-34
gi|40557495|gb|AAR88046.1| pregnancy-associated glycoprotein 4 [...   147   8e-34
gi|2499827|sp|Q28755|PAG1_SHEEP Pregnancy-associated glycoprotei...   147   8e-34
gi|3024354|sp|P56272|PEP1_GADMO Pepsin IIB >gnl|BL_ORD_ID|116723...   147   8e-34
gi|1322391|emb|CAA96571.1| parasite pepsinogen [Haemonchus conto...   146   1e-33
gi|67678|pir||KHPGD cathepsin D (EC 3.4.23.5) - pig                   146   1e-33
gi|17560028|ref|NP_505132.1| predicted CDS, aspartic protease fa...   146   1e-33
gi|915540|gb|AAA73628.1| pregnancy-specific antigen                   146   1e-33
gi|3378673|emb|CAA08878.1| Cathepsin D [Podarcis sicula]              146   1e-33
gi|2055439|gb|AAB53227.1| pregnancy-associated glycoprotein 6 [O...   145   2e-33
gi|38102423|gb|EAA49264.1| hypothetical protein MG00922.4 [Magna...   145   2e-33
gi|21355083|ref|NP_652013.1| CG1548-PA [Drosophila melanogaster]...   145   2e-33
gi|30024582|dbj|BAC75704.1| proteinase A [Candida boidinii]           145   2e-33
gi|24647679|ref|NP_650621.1| CG17283-PA [Drosophila melanogaster...   145   2e-33
gi|2832610|emb|CAA11580.1| cathepsin [Chionodraco hamatus]            145   2e-33
gi|5081317|gb|AAD39344.1| pepsinogen [Haemonchus contortus]           144   4e-33
gi|18203303|sp|Q9N2D2|CHYM_CALJA Chymosin precursor (Preprorenni...   144   4e-33
gi|45185830|ref|NP_983546.1| ACR144Wp [Eremothecium gossypii] >g...   144   5e-33
gi|17549909|ref|NP_510191.1| aspartic protease (49.3 kD) (asp-4)...   144   5e-33
gi|45360583|ref|NP_988964.1| hypothetical protein MGC76043 [Xeno...   144   5e-33
gi|6978719|ref|NP_037070.1| cathepsin E [Rattus norvegicus] >gnl...   144   5e-33
gi|2055437|gb|AAB53226.1| pregnancy-associated glycoprotein 5 [O...   144   5e-33
gi|11990126|emb|CAC19554.1| chymosin [Camelus dromedarius]            144   7e-33
gi|37787745|gb|AAO41706.1| renin precursor [Danio rerio]              143   9e-33
gi|299522|gb|AAB26186.1| cathepsin D {EC 3.4.23.5} [cattle, Pept...   143   9e-33
gi|18859121|ref|NP_571879.1| nothepsin; aspartic proteinase [Dan...   143   9e-33
gi|13637914|sp|P80209|CATD_BOVIN Cathepsin D precursor                143   9e-33
gi|47086317|ref|NP_998025.1| renin; renin precursor [Danio rerio...   143   1e-32
gi|28603712|ref|NP_788789.1| pregnancy-associated glycoprotein 5...   143   1e-32
gi|1705600|sp|P10977|CARV_CANAL Vacuolar aspartic protease precu...   143   1e-32
gi|39590346|emb|CAE66085.1| Hypothetical protein CBG11302 [Caeno...   142   1e-32
gi|28603720|ref|NP_788793.1| pregnancy-associated glycoprotein 9...   142   2e-32
gi|28603724|ref|NP_788796.1| pregnancy-associated glycoprotein 1...   142   3e-32
gi|115719|sp|P00795|CATD_PIG Cathepsin D                              142   3e-32
gi|4099023|gb|AAD00524.1| aspartic protease [Onchocerca volvulus]     142   3e-32
gi|31559113|gb|AAP50847.1| cathepsin D [Bombyx mori]                  141   4e-32
gi|13928928|ref|NP_113858.1| kidney-derived aspartic protease-li...   141   4e-32
gi|116405|sp|P18276|CHYM_SHEEP Chymosin precursor (Preprorennin)...   140   6e-32
gi|46434627|gb|EAK94031.1| hypothetical protein CaO19.1891 [Cand...   140   6e-32
gi|45384002|ref|NP_990508.1| prepro-cathepsin D; prepro-cathepsi...   140   6e-32
gi|50419019|ref|XP_458031.1| unnamed protein product [Debaryomyc...   140   1e-31
gi|39583181|emb|CAE61399.1| Hypothetical protein CBG05258 [Caeno...   139   1e-31
gi|4506475|ref|NP_000528.1| renin precursor; angiotensin-forming...   139   1e-31
gi|12697815|dbj|BAB21620.1| cathepsin D [Bos taurus]                  139   2e-31
gi|50346961|gb|AAT75162.1| renin [Macaca fascicularis]                139   2e-31
gi|48103318|ref|XP_392857.1| similar to aspartic protease [Apis ...   138   3e-31
gi|26354406|dbj|BAC40831.1| unnamed protein product [Mus musculus]    138   3e-31
gi|47210711|emb|CAF90003.1| unnamed protein product [Tetraodon n...   137   5e-31
gi|38197533|gb|AAH61685.1| MGC68767 protein [Xenopus laevis]          137   6e-31
gi|27803878|gb|AAO22152.1| cathepsin D-like aspartic protease [A...   137   8e-31
gi|49094196|ref|XP_408559.1| hypothetical protein AN4422.2 [Aspe...   137   8e-31
gi|50345843|gb|AAT74864.1| prorenin [Macaca mulatta]                  137   8e-31
gi|625238|pir||CMBO chymosin (EC 3.4.23.4) precursor - bovine         136   1e-30
gi|162856|gb|AAA30446.1| chymosin                                     136   1e-30
gi|1065326|pdb|1HRN|A Chain A, Renin Complexed With Polyhydroxym...   135   2e-30
gi|101979|pir||S03433 candidapepsin (EC 3.4.23.24) precursor - y...   135   2e-30
gi|2510|emb|CAA31962.1| pre-aspartyl proteinase [Candida albicans]    135   2e-30
gi|443239|pdb|1RNE|  Renin (Activated, Glycosylated, Inhibited) ...   135   2e-30
gi|162858|gb|AAA30447.1| preprochymosin a [Bos taurus]                135   2e-30
gi|37790800|gb|AAR03502.1| renin [Homo sapiens]                       135   2e-30
gi|116403|sp|P00794|CHYM_BOVIN Chymosin precursor (Preprorennin)      135   2e-30
gi|49522956|gb|AAH75272.1| Unknown (protein for MGC:88899) [Xeno...   135   3e-30
gi|6739580|gb|AAF27315.1| prochymosin [Bubalus bubalis]               134   4e-30
gi|30794284|ref|NP_851337.1| prochymosin; chymosin precursor; re...   134   5e-30
gi|20875195|ref|XP_131138.1| similar to prochymosin [Mus musculus]    134   7e-30
gi|337347|gb|AAA60364.1| renin                                        134   7e-30
gi|17389633|gb|AAH17842.1| Pronapsin A [Homo sapiens]                 132   2e-29
gi|4758754|ref|NP_004842.1| NAPSA gene product [Homo sapiens] >g...   132   2e-29
gi|230825|pdb|3CMS|  Chymosin B (Formerly Known As Rennin) (E.C....   132   2e-29
gi|24580868|ref|NP_722706.1| CG31926-PA [Drosophila melanogaster...   132   3e-29
gi|350733|prf||0803215A rennin,pro                                    132   3e-29
gi|9910338|ref|NP_064476.1| prochymosin [Rattus norvegicus] >gnl...   131   3e-29
gi|229748|pdb|1CMS|  Chymosin B (Formerly Known As Rennin) (E.C....   131   5e-29
gi|50257335|gb|EAL20044.1| hypothetical protein CNBF3700 [Crypto...   131   5e-29
gi|2055445|gb|AAB53230.1| pregnancy-associated glycoprotein 9 [O...   130   6e-29
gi|101001|pir||A41415 rhizopuspepsin (EC 3.4.23.21) I - Rhizopus...   129   1e-28
gi|625239|pir||A26681 rhizopuspepsin (EC 3.4.23.21) II precursor...   129   2e-28
gi|169742|gb|AAA33881.1| rhizopuspepsinogen precursor [Rhizopus ...   129   2e-28
gi|1705599|sp|P06026|CARP_RHICH Rhizopuspepsin precursor >gnl|BL...   129   2e-28
gi|169740|gb|AAA33879.1| rhizopuspepsin precursor (EC 3.4.23.6)       129   2e-28
gi|6981472|ref|NP_036774.1| renin 1; Renin [Rattus norvegicus] >...   129   2e-28
gi|21063965|gb|AAM29212.1| AT05209p [Drosophila melanogaster]         129   2e-28
gi|24653643|ref|NP_610961.1| CG10104-PA [Drosophila melanogaster...   129   2e-28
gi|1929102|emb|CAA72511.1| extracellular aspartic proteinase [Rh...   129   2e-28
gi|360235|prf||1402278B rhizopuspepsin II                             129   2e-28
gi|24647681|ref|NP_650622.1| CG5860-PA [Drosophila melanogaster]...   129   2e-28
gi|6561816|gb|AAF17080.1| aspartyl protease 3 [Homo sapiens]          128   3e-28
gi|45752338|emb|CAE12199.1| aspartyl protease precursor [Haemonc...   128   3e-28
gi|230424|pdb|2APR|  Acid Proteinase (Rhizopuspepsin) (E.C.3.4.2...   127   5e-28
gi|50513832|pdb|1UH7|A Chain A, Crystal Structure Of Rhizopuspep...   126   1e-27
gi|24580865|ref|NP_722705.1| CG31928-PA [Drosophila melanogaster...   126   1e-27
gi|2144165|pir||JC5077 aspartic proteinase (EC 3.4.23.-) - dog h...   125   2e-27
gi|18203300|sp|Q9MZS8|CATD_SHEEP Cathepsin D precursor >gnl|BL_O...   125   2e-27
gi|3152654|gb|AAC17105.1| aspartic protease precursor [Phaffia r...   125   3e-27
gi|47211933|emb|CAF92442.1| unnamed protein product [Tetraodon n...   124   4e-27
gi|9858101|gb|AAG00993.1| heme-binding aspartic proteinase [Boop...   123   9e-27
gi|499671|gb|AAA33880.1| rhizopuspepsin I                             123   9e-27
gi|627805|pir||A61388 renin (EC 3.4.23.15) - rabbit (fragment)        122   2e-26
gi|1469396|gb|AAB57763.1| secreted aspartic proteinase precursor      121   4e-26
gi|33352213|emb|CAE18153.1| aspartic proteinase [Chlamydomonas r...   121   5e-26
gi|23110952|ref|NP_683865.1| cathepsin E isoform b preproprotein...   120   1e-25
gi|45643446|gb|AAS72876.1| aspartyl protease [Triatoma infestans]     119   1e-25
gi|46126795|ref|XP_387951.1| hypothetical protein FG07775.1 [Gib...   118   3e-25
gi|28436104|dbj|BAC57431.1| cathepsin D [Xenopus laevis]              117   9e-25
gi|25290002|pir||C96715 protein F4N2.8 [imported] - Arabidopsis ...   115   2e-24
gi|17560022|ref|NP_505136.1| aspartic protease like family membe...   115   3e-24
gi|50255620|gb|EAL18353.1| hypothetical protein CNBJ2760 [Crypto...   114   4e-24
gi|1705595|sp|P43231|CAR2_RHINI Rhizopuspepsin 2 precursor (Aspa...   113   1e-23
gi|1168765|sp|Q03699|CAR3_RHINI Rhizopuspepsin 3 precursor (Aspa...   113   1e-23
gi|17981530|gb|AAL51056.1| cathepsin D [Apriona germari]              112   2e-23
gi|10880353|emb|CAC14005.1| aspartic protease [Ostertagia ostert...   111   4e-23
gi|12002205|gb|AAG43236.1| aspartic proteinase precursor; aspart...   111   4e-23
gi|1168767|sp|Q03700|CAR4_RHINI Rhizopuspepsin 4 precursor (Aspa...   111   5e-23
gi|115640|sp|P10602|CAR1_RHINI Rhizopuspepsin 1 precursor (Aspar...   110   1e-22
gi|1705596|sp|P43232|CAR5_RHINI Rhizopuspepsin 5 precursor (Aspa...   110   1e-22
gi|18448713|gb|AAL69900.1| aspartic protease [Fusarium venenatum]     110   1e-22
gi|2687645|gb|AAB88862.1| cathepsin D [Sparus aurata]                 109   1e-22
gi|24580870|ref|NP_722707.1| CG31661-PA [Drosophila melanogaster...   109   2e-22
gi|19851890|gb|AAL99906.1| chymosin precursor [Bos taurus]            108   2e-22
gi|38111212|gb|EAA56824.1| hypothetical protein MG07179.4 [Magna...   108   2e-22
gi|2554745|pdb|2RMP|A Chain A, Rmp-Pepstatin A Complex                108   3e-22
gi|5915874|sp|P81214|CARP_SYNRA Syncephapepsin precursor >gnl|BL...   108   3e-22
gi|115639|sp|P00799|CARP_RHIMI Mucorpepsin precursor (Mucor renn...   108   3e-22
gi|35952|emb|CAA24937.1| unnamed protein product [Homo sapiens]       108   3e-22
gi|49070738|ref|XP_399658.1| hypothetical protein UM02043.1 [Ust...   107   7e-22
gi|32407597|ref|XP_324310.1| hypothetical protein [Neurospora cr...   107   7e-22
gi|847749|gb|AAA73476.1| prochymosin                                  107   9e-22
gi|49175773|gb|AAR87747.2| aspartic proteinase precursor [Botryo...   105   2e-21
gi|261083|gb|AAB24375.1| rennin [Mucor pusillus, Peptide, 427 aa...   105   2e-21
gi|47215111|emb|CAG02535.1| unnamed protein product [Tetraodon n...   105   3e-21
gi|28948409|pdb|1IZD|A Chain A, Crystal Structure Of Aspergillus...   105   3e-21
gi|1246046|gb|AAB35849.1| aspartic proteinase II-1 [Aspergillus ...   105   3e-21
gi|1827844|pdb|2ASI|  Aspartic Proteinase                             104   5e-21
gi|3599956|gb|AAC35460.1| SAP2 [Rhizopus arrhizus]                    104   5e-21
gi|34894316|ref|NP_908483.1| unnamed protein product [Oryza sati...   104   5e-21
gi|443132|pdb|1MPP|  Pepsin (Renin) (E.C.3.4.23.23) >gnl|BL_ORD_...   104   6e-21
gi|46371116|gb|AAS90335.1| toxomepsin 1 [Toxoplasma gondii]           104   6e-21
gi|7435839|pir||S71591 aspartic proteinase precursor, wound-indu...   104   6e-21
gi|11558498|emb|CAC17811.1| putative aspartate protease [Hypocre...   103   8e-21
gi|32409387|ref|XP_325174.1| hypothetical protein [Neurospora cr...   103   1e-20
gi|115641|sp|P09177|CARP_RHIPU Mucorpepsin precursor (Mucor rennin)   103   1e-20
gi|47088525|gb|AAT10592.1| toxomepsin 3 [Toxoplasma gondii]           103   1e-20
gi|33620983|gb|AAC47992.2| Hypothetical protein F21F8.2 [Caenorh...   103   1e-20
gi|11265728|pir||JC7272 aspartic proteinase (EC 3.4.23.-) - comm...   103   1e-20
gi|82779|pir||A25767 mucorpepsin (EC 3.4.23.23) - Rhizomucor pus...   102   2e-20
gi|12231180|dbj|BAB20973.1| aspartic proteinase 5 [Nepenthes alata]   102   2e-20
gi|12231178|dbj|BAB20972.1| aspartic proteinase 4 [Nepenthes alata]   102   2e-20
gi|46485798|gb|AAS98423.1| aspartic proteinase [Oryza sativa (ja...   102   2e-20
gi|49098328|ref|XP_410624.1| hypothetical protein AN6487.2 [Aspe...   102   2e-20
gi|49071008|ref|XP_399793.1| hypothetical protein UM02178.1 [Ust...   101   4e-20
gi|115637|sp|P17576|CARP_POLTU Polyporopepsin (Aspartic proteina...   101   4e-20
gi|494296|pdb|1LYA|B Chain B, Cathepsin D (E.C.3.4.23.5) >gnl|BL...   101   4e-20
gi|1168537|sp|P42211|ASPR_ORYSA Aspartic proteinase precursor >g...   101   4e-20
gi|21392382|dbj|BAC00848.1| aspartic protease [Aspergillus oryzae]    101   4e-20
gi|422305|pir||S35971 aspartic proteinase - Eimeria acervulina >...   101   5e-20
gi|21616051|emb|CAC86003.1| aspartic proteinase [Theobroma cacao]     101   5e-20
gi|15186732|dbj|BAB62890.1| aspartic proteinase 1 [Glycine max]       101   5e-20
gi|15222219|ref|NP_177073.1| aspartyl protease family protein [A...   101   5e-20
gi|3599954|gb|AAC35459.1| SAP1 [Rhizopus arrhizus]                    101   5e-20
gi|50804477|ref|XP_428716.1| PREDICTED: similar to renin precurs...   101   5e-20
gi|50259458|gb|EAL22131.1| hypothetical protein CNBC2690 [Crypto...   100   7e-20
gi|16507116|gb|AAL24045.1| aspartic proteinase [Plasmodium chaba...   100   7e-20
gi|30685656|ref|NP_193936.2| aspartyl protease family protein [A...   100   9e-20
gi|22219360|pdb|1M43|A Chain A, Crystal Structure Of Pmii In Com...   100   9e-20
gi|21616053|emb|CAC86004.1| aspartic proteinase [Theobroma cacao]     100   9e-20
gi|50540937|gb|AAT77954.1| Asp [Solanum tuberosum]                    100   1e-19
gi|416748|sp|P11838|CARP_CRYPA Endothiapepsin precursor (Asparta...   100   1e-19
gi|46122187|ref|XP_385647.1| hypothetical protein FG05471.1 [Gib...   100   1e-19
gi|12231174|dbj|BAB20970.1| aspartic proteinase 2 [Nepenthes alata]   100   1e-19
gi|3095036|gb|AAC15793.1| plasmepsin [Plasmodium ovale]               100   1e-19
gi|12054066|emb|CAC20153.1| aspartyl proteinase (eimepsin) [Eime...   100   1e-19
gi|229897|pdb|1ER8|E Chain E, Endothia Aspartic Proteinase (Endo...   100   1e-19
gi|1665867|emb|CAA70340.1| aspartic proteinase [Centaurea calcit...   100   1e-19
gi|40641523|emb|CAE52913.1| putative vacuaolar aspartic proteina...   100   1e-19
gi|12231172|dbj|BAB20969.1| aspartic proteinase 1 [Nepenthes alata]   100   1e-19
gi|38110671|gb|EAA56356.1| hypothetical protein MG06327.4 [Magna...    99   2e-19
gi|40557505|gb|AAR88051.1| pregnancy-associated glycoprotein 9 [...    99   2e-19
gi|115642|sp|P22929|CARP_SACFI Acid protease precursor >gnl|BL_O...    99   2e-19
gi|45201503|ref|NP_987073.1| AGR407Cp [Eremothecium gossypii] >g...    99   2e-19
gi|50545607|ref|XP_500342.1| hypothetical protein [Yarrowia lipo...    99   2e-19
gi|50543010|ref|XP_499671.1| hypothetical protein [Yarrowia lipo...    99   2e-19
gi|23509298|ref|NP_701965.1| plasmepsin 2 precursor [Plasmodium ...    99   2e-19
gi|50547341|ref|XP_501140.1| hypothetical protein [Yarrowia lipo...    99   3e-19
gi|1942549|pdb|1SME|A Chain A, Plasmepsin Ii, A Hemoglobin-Degra...    99   3e-19
gi|4389167|pdb|1PFZ|A Chain A, Proplasmepsin Ii From Plasmodium ...    99   3e-19
gi|1172530|sp|P46925|PLM2_PLAFA Plasmepsin 2 precursor (Aspartic...    99   3e-19
gi|858754|gb|AAA68217.1| aspartic proteinase                           99   3e-19
gi|90314|pir||JH0240 aspartic proteinase (EC 3.4.23.-) - mouse (...    99   3e-19
gi|24987569|pdb|1LF3|A Chain A, Crystal Structure Of Plasmepsin ...    99   3e-19
gi|50549149|ref|XP_502045.1| hypothetical protein [Yarrowia lipo...    98   4e-19
gi|6323150|ref|NP_013222.1| Aspartic protease, attached to the p...    98   4e-19
gi|13897888|gb|AAK48494.1| putative aspartic protease [Ipomoea b...    98   4e-19
gi|14494876|emb|CAC42132.1| protease [Amanita muscaria]                98   4e-19
gi|50257332|gb|EAL20041.1| hypothetical protein CNBF3670 [Crypto...    98   6e-19
gi|1076696|pir||S49349 cyprosin (EC 3.4.23.-) - cardoon >gnl|BL_...    98   6e-19
gi|38048659|gb|AAR10232.1| similar to Drosophila melanogaster CG...    98   6e-19
gi|46117110|ref|XP_384573.1| hypothetical protein FG04397.1 [Gib...    97   7e-19
gi|22218665|pdb|1GVT|A Chain A, Endothiapepsin Complex With Cp-8...    97   9e-19
gi|1763684|gb|AAB63942.1| propenicillopepsin-JT2 precursor [Peni...    97   9e-19
gi|38104824|gb|EAA51334.1| hypothetical protein MG09351.4 [Magna...    97   1e-18
gi|17942667|pdb|1GKT|A Chain A, Neutron Laue Diffraction Structu...    96   2e-18
gi|12231176|dbj|BAB20971.1| aspartic proteinase 3 [Nepenthes alata]    96   2e-18
gi|22330379|ref|NP_176419.2| aspartyl protease family protein [A...    96   2e-18
gi|46391592|gb|AAS90844.1| toxomepsin 2 [Toxoplasma gondii]            96   2e-18
gi|15425751|dbj|BAB64296.1| aspartic proteinase 2 [Glycine max]        96   2e-18
gi|49071846|ref|XP_400212.1| hypothetical protein UM02597.1 [Ust...    96   3e-18
gi|49175772|gb|AAR87746.2| aspartic proteinase precursor [Botryo...    95   4e-18
gi|3551952|gb|AAC34854.1| senescence-associated protein 4 [Hemer...    95   4e-18
gi|7435838|pir||T07915 probable aspartic proteinase (EC 3.4.23.-...    95   4e-18
gi|23509297|ref|NP_701964.1| plasmepsin 1 precursor [Plasmodium ...    95   5e-18
gi|3550545|emb|CAA11249.1| plasmepsin [Plasmodium berghei]             95   5e-18
gi|4582534|emb|CAB40349.1| preprocardosin B [Cynara cardunculus]       95   5e-18
gi|29788116|emb|CAD45577.1| putative aspartyl protease [Sordaria...    94   6e-18
gi|50555686|ref|XP_505251.1| hypothetical protein [Yarrowia lipo...    94   1e-17
gi|12667097|emb|CAC28136.1| aspartic protease Asp1 [Ostertagia o...    94   1e-17
gi|34912970|ref|NP_917832.1| putative aspartic protease [Oryza s...    94   1e-17
gi|23509296|ref|NP_701963.1| plasmepsin, putative [Plasmodium fa...    93   1e-17
gi|50550399|ref|XP_502672.1| hypothetical protein [Yarrowia lipo...    93   1e-17
gi|49087582|ref|XP_405710.1| hypothetical protein AN1573.2 [Aspe...    93   2e-17
gi|32420825|ref|XP_330856.1| hypothetical protein [Neurospora cr...    93   2e-17
gi|1354272|gb|AAC49730.1| aspartic proteinase [Arabidopsis thali...    93   2e-17
gi|21730846|pdb|1LS5|A Chain A, Crystal Structure Of Plasmepsin ...    93   2e-17
gi|15221141|ref|NP_172655.1| aspartyl protease family protein [A...    93   2e-17
gi|15233518|ref|NP_192355.1| aspartyl protease family protein [A...    92   2e-17
gi|21392384|dbj|BAC00849.1| secreted aspartic protease [Aspergil...    92   3e-17
gi|963013|emb|CAA59419.1| aspergillopepsin i [Aspergillus fumiga...    92   3e-17
gi|7489316|pir||T12049 cyprosin (EC 3.4.23.-) - cardoon (fragmen...    91   5e-17
gi|1169175|sp|P40782|CYP1_CYNCA Cyprosin precursor >gnl|BL_ORD_I...    91   5e-17
gi|11345300|gb|AAG34660.1| prepropenicillopepsin-JT3 [Penicilliu...    91   7e-17
gi|2811025|sp|O04057|ASPR_CUCPE Aspartic proteinase precursor >g...    91   7e-17
gi|32398959|emb|CAD98424.1| aspartyl protease precursor, probabl...    91   9e-17
gi|37196694|dbj|BAC97797.1| acid proteinase [Monascus purpureus]       91   9e-17
gi|32405992|ref|XP_323609.1| related to pepsin precursor [MIPS] ...    91   9e-17
gi|24571212|gb|AAN62917.1| cathepsin D [Ctenopharyngodon idella]       90   1e-16
gi|50548267|ref|XP_501603.1| hypothetical protein [Yarrowia lipo...    90   1e-16
gi|50550685|ref|XP_502815.1| hypothetical protein [Yarrowia lipo...    90   2e-16


>gi|17561740|ref|NP_503825.1| aspartic protease family member (5D505)
            [Caenorhabditis elegans]
 gi|7504761|pir||T31770 hypothetical protein F59D6.3 - Caenorhabditis
            elegans
 gi|2315321|gb|AAB65878.1| Hypothetical protein F59D6.3
            [Caenorhabditis elegans]
          Length = 474

 Score =  921 bits (2381), Expect = 0.0
 Identities = 454/474 (95%), Positives = 454/474 (95%)
 Frame = +1

Query: 1    MKQGFLIYYSXXXXXXXXXXXXXXXXXXXXVQFSICITQLVQKLFICVNTTFLCAERGEM 180
            MKQGFLIYYS                    VQFSICITQLVQKLFICVNTTFLCAERGEM
Sbjct: 1    MKQGFLIYYSRLLLDFRAFFCRALALAIFFVQFSICITQLVQKLFICVNTTFLCAERGEM 60

Query: 181  ITGGTKILRNTFQSIKLEDNRKIFIFHKMFGKLISLLGLVALCSAGQFSISVEKSGSLRE 360
            ITGGTKILRNTFQSIKLEDNRKIFIFHKMFGKLISLLGLVALCSAGQFSISVEKSGSLRE
Sbjct: 61   ITGGTKILRNTFQSIKLEDNRKIFIFHKMFGKLISLLGLVALCSAGQFSISVEKSGSLRE 120

Query: 361  QLIREGRYGQELARIQQLSTGNVSFFDHFDEYYTAGVRIGTPAQHFQVAFDTTSSNLWVF 540
            QLIREGRYGQELARIQQLSTGNVSFFDHFDEYYTAGVRIGTPAQHFQVAFDTTSSNLWVF
Sbjct: 121  QLIREGRYGQELARIQQLSTGNVSFFDHFDEYYTAGVRIGTPAQHFQVAFDTTSSNLWVF 180

Query: 541  GVECRSQNCHGGRGRRDREYNRTASSTFVAGTSSFNLPYDGGHVSGNVGKDTAQFAGFTI 720
            GVECRSQNCHGGRGRRDREYNRTASSTFVAGTSSFNLPYDGGHVSGNVGKDTAQFAGFTI
Sbjct: 181  GVECRSQNCHGGRGRRDREYNRTASSTFVAGTSSFNLPYDGGHVSGNVGKDTAQFAGFTI 240

Query: 721  QSQDFGIGTAATRLFGETFDGVLGLGWPATALNGTSTTMQNLLPQLDQKLFTTYFTKSNM 900
            QSQDFGIGTAATRLFGETFDGVLGLGWPATALNGTSTTMQNLLPQLDQKLFTTYFTKSNM
Sbjct: 241  QSQDFGIGTAATRLFGETFDGVLGLGWPATALNGTSTTMQNLLPQLDQKLFTTYFTKSNM 300

Query: 901  HNGTAGGDIMFGAIDTTHCQSQVNYVPLAYNSFWSYSVDGFSIGTYSRTQTETTIPDTSS 1080
            HNGTAGGDIMFGAIDTTHCQSQVNYVPLAYNSFWSYSVDGFSIGTYSRTQTETTIPDTSS
Sbjct: 301  HNGTAGGDIMFGAIDTTHCQSQVNYVPLAYNSFWSYSVDGFSIGTYSRTQTETTIPDTSS 360

Query: 1081 GWTGVPNVVLAGIVKATGATYDWNHQAYTLPCSSTATLPDMVFTIGGNSYNVRAVEYVVN 1260
            GWTGVPNVVLAGIVKATGATYDWNHQAYTLPCSSTATLPDMVFTIGGNSYNVRAVEYVVN
Sbjct: 361  GWTGVPNVVLAGIVKATGATYDWNHQAYTLPCSSTATLPDMVFTIGGNSYNVRAVEYVVN 420

Query: 1261 LNLPNGQCALSLFGTAASQSGPAWILGDNFLRSYCHVFDFGNSRIGLAKAIQNY 1422
            LNLPNGQCALSLFGTAASQSGPAWILGDNFLRSYCHVFDFGNSRIGLAKAIQNY
Sbjct: 421  LNLPNGQCALSLFGTAASQSGPAWILGDNFLRSYCHVFDFGNSRIGLAKAIQNY 474




[DB home][top]