Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F59E12_12
(936 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17531395|ref|NP_495104.1| BLIstered cuticle BLI-2, Nematode c... 305 1e-81
gi|39596930|emb|CAE59157.1| Hypothetical protein CBG02463 [Caeno... 288 2e-76
gi|39597358|emb|CAE59586.1| Hypothetical protein CBG02987 [Caeno... 146 7e-34
gi|17533809|ref|NP_496362.1| COLlagen structural gene (29.2 kD) ... 145 2e-33
gi|17535253|ref|NP_495759.1| COLlagen structural gene (29.4 kD) ... 127 3e-28
gi|39587231|emb|CAE57699.1| Hypothetical protein CBG00703 [Caeno... 126 8e-28
gi|17541194|ref|NP_499905.1| COLlagen structural gene (col-101) ... 119 1e-25
gi|1814029|gb|AAB41793.1| cuticle collagen [Caenorhabditis brigg... 119 1e-25
gi|39593349|emb|CAE64819.1| Hypothetical protein CBG09613 [Caeno... 119 1e-25
gi|39581442|emb|CAE74724.1| Hypothetical protein CBG22542 [Caeno... 117 4e-25
gi|17559058|ref|NP_505678.1| COLlagen structural gene (30.1 kD) ... 115 1e-24
gi|17561542|ref|NP_506283.1| COLlagen structural gene (col-159) ... 115 2e-24
gi|17559060|ref|NP_505677.1| COLlagen structural gene (col-13) [... 114 2e-24
gi|32567317|ref|NP_506284.2| COLlagen structural gene (30.3 kD) ... 113 7e-24
gi|17550996|ref|NP_509960.1| COLlagen structural gene (col-180Co... 108 1e-22
gi|39587054|emb|CAE62989.1| Hypothetical protein CBG07217 [Caeno... 108 2e-22
gi|17532495|ref|NP_493660.1| COLlagen structural gene (col-68) [... 105 2e-21
gi|30025105|gb|AAP13769.1| Hypothetical protein T07H6.3b [Caenor... 104 2e-21
gi|17569675|ref|NP_509051.1| COLlagen structural gene (col-166) ... 104 2e-21
gi|39585825|emb|CAE61238.1| Hypothetical protein CBG05038 [Caeno... 104 3e-21
gi|32566570|ref|NP_872255.1| COLlagen structural gene (28.4 kD) ... 104 3e-21
gi|39586875|emb|CAE62810.1| Hypothetical protein CBG06986 [Caeno... 103 4e-21
gi|39585826|emb|CAE61239.1| Hypothetical protein CBG05039 [Caeno... 103 7e-21
gi|32566594|ref|NP_872267.1| COLlagen structural gene (col-170) ... 102 9e-21
gi|39585828|emb|CAE61241.1| Hypothetical protein CBG05041 [Caeno... 102 9e-21
gi|17569753|ref|NP_509060.1| COLlagen structural gene (28.5 kD) ... 102 9e-21
gi|7507620|pir||T16841 hypothetical protein T10E10.2 - Caenorhab... 100 2e-20
gi|17536359|ref|NP_496665.1| COLlagen structural gene (col-85) [... 101 2e-20
gi|39585827|emb|CAE61240.1| Hypothetical protein CBG05040 [Caeno... 101 3e-20
gi|39585817|emb|CAE61230.1| Hypothetical protein CBG05029 [Caeno... 101 3e-20
gi|39585576|emb|CAE65336.1| Hypothetical protein CBG10272 [Caeno... 101 3e-20
gi|17569755|ref|NP_509059.1| COLlagen structural gene (28.5 kD) ... 100 4e-20
gi|32566596|ref|NP_872268.1| COLlagen structural gene (col-171) ... 100 5e-20
gi|17536229|ref|NP_493913.1| COLlagen structural gene (col-40) [... 99 1e-19
gi|39585824|emb|CAE61237.1| Hypothetical protein CBG05037 [Caeno... 99 1e-19
gi|17543526|ref|NP_502966.1| predicted CDS, COLlagen structural ... 97 7e-19
gi|39594125|emb|CAE70235.1| Hypothetical protein CBG16724 [Caeno... 94 6e-18
gi|39593182|emb|CAE64651.1| Hypothetical protein CBG09422 [Caeno... 93 7e-18
gi|563237|gb|AAC46628.1| cuticular collagen Bmcol-2 92 1e-17
gi|7504495|pir||T22827 hypothetical protein F57B1.4 - Caenorhabd... 91 5e-17
gi|17567743|ref|NP_509276.1| COLlagen structural gene (30.0 kD) ... 91 5e-17
gi|39593181|emb|CAE64650.1| Hypothetical protein CBG09421 [Caeno... 87 5e-16
gi|17533807|ref|NP_496361.1| COLlagen structural gene (30.9 kD) ... 86 9e-16
gi|1236783|emb|CAA65506.1| cuticular collagen [Teladorsagia circ... 83 8e-15
gi|1236781|emb|CAA65507.1| cuticular collagen [Teladorsagia circ... 83 8e-15
gi|22096343|sp|P34804|CC40_CAEEL Cuticle collagen 40 83 8e-15
gi|39597359|emb|CAE59587.1| Hypothetical protein CBG02988 [Caeno... 81 3e-14
gi|7378665|emb|CAB85468.1| putative cuticular collagen [Brugia p... 77 4e-13
gi|687636|gb|AAA62505.1| collagen [Caenorhabditis elegans] 77 4e-13
gi|687634|gb|AAA62504.1| collagen 77 7e-13
gi|1813688|gb|AAC47626.1| unknown [Brugia malayi] >gnl|BL_ORD_ID... 76 1e-12
gi|7494557|pir||T37286 collagen 40 - Caenorhabditis elegans >gnl... 73 8e-12
gi|32563747|ref|NP_494878.2| COLlagen structural gene (col-17) [... 73 8e-12
gi|5514647|emb|CAB50767.1| putative cuticular collagen protein [... 73 8e-12
gi|17532621|ref|NP_494879.1| COLlagen structural gene (col-20) [... 73 1e-11
gi|46195903|gb|AAB37842.2| Collagen protein 20 [Caenorhabditis e... 73 1e-11
gi|4335794|gb|AAD17458.1| cuticular collagen [Ascaris suum] 72 1e-11
gi|7498929|pir||T29980 hypothetical protein F11G11.10 - Caenorha... 70 9e-11
gi|39579269|emb|CAE56956.1| Hypothetical protein CBG24806 [Caeno... 68 3e-10
gi|17533115|ref|NP_494880.1| COLlagen structural gene (col-73) [... 68 3e-10
gi|39586900|emb|CAE62835.1| Hypothetical protein CBG07014 [Caeno... 67 6e-10
gi|17542966|ref|NP_501617.1| COLlagen structural gene (col-120) ... 66 1e-09
gi|17567513|ref|NP_509121.1| COLlagen structural gene (35.0 kD) ... 65 2e-09
gi|7508918|pir||T26125 hypothetical protein W03G11.1 - Caenorhab... 65 2e-09
gi|17570227|ref|NP_510021.1| COLlagen structural gene (col-181) ... 65 2e-09
gi|17158629|ref|NP_478050.1| wsv528 [shrimp white spot syndrome ... 65 2e-09
gi|17531401|ref|NP_493635.1| COLlagen structural gene (col-67Co)... 65 2e-09
gi|39596236|emb|CAE69873.1| Hypothetical protein CBG16210 [Caeno... 65 3e-09
gi|39586769|emb|CAE65811.1| Hypothetical protein CBG10919 [Caeno... 64 4e-09
gi|17567621|ref|NP_509162.1| COLlagen structural gene (col-173) ... 64 4e-09
gi|39586728|emb|CAE65770.1| Hypothetical protein CBG10862 [Caeno... 64 6e-09
gi|39595982|emb|CAE67485.1| Hypothetical protein CBG12990 [Caeno... 64 6e-09
gi|39584782|emb|CAE67677.1| Hypothetical protein CBG13240 [Caeno... 63 8e-09
gi|39582304|emb|CAE67553.1| Hypothetical protein CBG13078 [Caeno... 63 1e-08
gi|32565764|ref|NP_871702.1| COLlagen structural gene (col-95) [... 62 1e-08
gi|32563818|ref|NP_871912.1| ROLler: helically twisted, animals ... 61 4e-08
gi|17539404|ref|NP_503048.1| COLlagen structural gene (28.0 kD) ... 61 4e-08
gi|17535689|ref|NP_495582.1| ROLler: helically twisted, animals ... 61 4e-08
gi|84433|pir||JS0167 collagen col-6 - Caenorhabditis elegans >gn... 61 4e-08
gi|7494563|pir||T34507 cutical collagen 6 - Caenorhabditis elegans 61 4e-08
gi|17551382|ref|NP_508395.1| DumPY : shorter than wild-type DPY-... 60 5e-08
gi|39585160|emb|CAE57403.1| Hypothetical protein CBG00356 [Caeno... 60 7e-08
gi|17532623|ref|NP_495487.1| COLlagen structural gene (col-36) [... 59 1e-07
gi|7496625|pir||T15670 hypothetical protein C27H5.5 - Caenorhabd... 59 1e-07
gi|17550810|ref|NP_509869.1| COLlagen structural gene (27.8 kD) ... 59 2e-07
gi|39591778|emb|CAE71356.1| Hypothetical protein CBG18259 [Caeno... 59 2e-07
gi|17555472|ref|NP_499410.1| COLlagen structural gene (29.2 kD) ... 59 2e-07
gi|39596084|emb|CAE69720.1| Hypothetical protein CBG15991 [Caeno... 58 3e-07
gi|39578930|emb|CAE57041.1| Hypothetical protein CBG24927 [Caeno... 58 3e-07
gi|17540574|ref|NP_502700.1| COLlagen structural gene (col-133) ... 58 3e-07
gi|21954120|gb|AAM80556.1| cuticular collagen [Trichinella spira... 57 5e-07
gi|17538876|ref|NP_502107.1| COLlagen structural gene (28.7 kD) ... 57 6e-07
gi|17551374|ref|NP_510617.1| COLlagen structural gene (col-186) ... 57 6e-07
gi|39594818|emb|CAE70686.1| Hypothetical protein CBG17403 [Caeno... 57 6e-07
gi|50405040|ref|YP_054132.1| hypothetical protein PTMB.204c [Par... 57 8e-07
gi|17539484|ref|NP_501527.1| COLlagen structural gene (col-3) [C... 57 8e-07
gi|17555480|ref|NP_499408.1| COLlagen structural gene (29.2 kD) ... 57 8e-07
gi|39597656|emb|CAE68347.1| Hypothetical protein CBG14077 [Caeno... 56 1e-06
gi|39593732|emb|CAE62024.1| Hypothetical protein CBG06035 [Caeno... 56 1e-06
gi|17543264|ref|NP_500133.1| COLlagen structural gene (col-108) ... 56 1e-06
gi|48060128|gb|AAK68452.2| Collagen protein 108 [Caenorhabditis ... 56 1e-06
gi|39591777|emb|CAE71355.1| Hypothetical protein CBG18258 [Caeno... 55 2e-06
gi|17550812|ref|NP_509870.1| COLlagen structural gene (col-179) ... 54 4e-06
gi|17555478|ref|NP_499409.1| COLlagen structural gene (29.2 kD) ... 54 4e-06
gi|17566746|ref|NP_505074.1| COLlagen structural gene (29.5 kD) ... 54 5e-06
gi|39590411|emb|CAE66150.1| Hypothetical protein CBG11380 [Caeno... 54 5e-06
gi|5669894|gb|AAD46501.1| latent nuclear antigen [Human herpesvi... 54 5e-06
gi|18846043|ref|NP_572129.1| ORF 73; extensive acidic domains, p... 52 1e-05
gi|39584177|emb|CAE61552.1| Hypothetical protein CBG05461 [Caeno... 52 1e-05
gi|39594817|emb|CAE70685.1| Hypothetical protein CBG17402 [Caeno... 52 2e-05
gi|39592038|emb|CAE75258.1| Hypothetical protein CBG23219 [Caeno... 52 2e-05
gi|17561474|ref|NP_505886.1| COLlagen structural gene (29.3 kD) ... 52 2e-05
gi|39592014|emb|CAE75234.1| Hypothetical protein CBG23185 [Caeno... 52 2e-05
gi|39592016|emb|CAE75236.1| Hypothetical protein CBG23187 [Caeno... 52 2e-05
gi|39584181|emb|CAE61556.1| Hypothetical protein CBG05465 [Caeno... 52 2e-05
gi|25153764|ref|NP_741423.1| COLlagen structural gene (28.9 kD) ... 51 3e-05
gi|39580357|emb|CAE61462.1| Hypothetical protein CBG05354 [Caeno... 51 4e-05
gi|17539490|ref|NP_500520.1| abnormal RAy Morphology RAM-4, COLl... 51 4e-05
gi|11466451|ref|NP_046743.1| Rep-like [Dictyostelium discoideum]... 51 4e-05
gi|345339|pir||JC1448 collagen col-34 - Caenorhabditis elegans >... 51 4e-05
gi|9886896|gb|AAG01636.1| Orf73 [Human herpesvirus 8] 50 6e-05
gi|23482650|gb|EAA18573.1| hypothetical protein [Plasmodium yoel... 50 7e-05
gi|39582210|emb|CAE64161.1| Hypothetical protein CBG08781 [Caeno... 50 9e-05
gi|17564278|ref|NP_505913.1| predicted CDS, COLlagen structural ... 50 9e-05
gi|7378657|emb|CAB85466.1| putative cuticular collagen [Ascaris ... 50 9e-05
gi|17510331|ref|NP_491088.1| COLlagen structural gene (col-48) [... 49 1e-04
gi|39595524|emb|CAE60562.1| Hypothetical protein CBG04191 [Caeno... 49 1e-04
gi|28829276|gb|AAO51818.1| similar to Kaposi's sarcoma-associate... 49 2e-04
gi|39588210|emb|CAE68135.1| Hypothetical protein CBG13781 [Caeno... 49 2e-04
gi|17543328|ref|NP_502808.1| COLlagen structural gene (col-134) ... 49 2e-04
gi|23480318|gb|EAA16908.1| Drosophila melanogaster CG8797 gene p... 49 2e-04
gi|17542184|ref|NP_501700.1| COLlagen structural gene (29.4 kD) ... 49 2e-04
gi|39588940|emb|CAE69570.1| Hypothetical protein CBG15782 [Caeno... 48 3e-04
gi|2246532|gb|AAB62657.1| ORF 73, contains large complex repeat ... 48 3e-04
gi|32453014|gb|AAA96159.2| Collagen protein 33 [Caenorhabditis e... 48 3e-04
gi|39580360|emb|CAE61465.1| Hypothetical protein CBG05357 [Caeno... 48 3e-04
gi|84431|pir||JS0169 collagen col-14 - Caenorhabditis elegans >g... 48 4e-04
gi|17507951|ref|NP_491958.1| COLlagen structural gene (col-59) [... 48 4e-04
gi|7497485|pir||T29810 hypothetical protein C46A5.3 - Caenorhabd... 48 4e-04
gi|39595004|emb|CAE70872.1| Hypothetical protein CBG17662 [Caeno... 48 4e-04
gi|17560884|ref|NP_504252.1| COLlagen structural gene (col-139) ... 48 4e-04
gi|25145834|ref|NP_501273.2| COLlagen structural gene (col-14) [... 48 4e-04
gi|13936996|gb|AAK50002.1| ORF73 [Human herpesvirus 8] 47 5e-04
gi|32567349|ref|NP_872207.1| COLlagen structural gene (col-42) [... 47 5e-04
gi|11037008|gb|AAG27458.1| latent nuclear antigen [Human herpesv... 47 5e-04
gi|6708502|gb|AAD09454.2| superfast myosin heavy chain [Felis ca... 47 5e-04
gi|1184072|gb|AAC47437.1| COL-1 47 6e-04
gi|17385617|emb|CAD12628.1| involucrin [Sus scrofa] 47 6e-04
gi|39591241|emb|CAE73294.1| Hypothetical protein CBG20714 [Caeno... 47 6e-04
gi|39592242|emb|CAE75463.1| Hypothetical protein CBG23461 [Caeno... 47 6e-04
gi|17553060|ref|NP_499703.1| COLlagen structural gene (col-98) [... 47 8e-04
gi|39584781|emb|CAE67676.1| Hypothetical protein CBG13239 [Caeno... 46 0.001
gi|28850409|gb|AAO53177.1| similar to Dictyostelium discoideum (... 46 0.001
gi|124728|sp|P18174|INVO_CANFA Involucrin >gnl|BL_ORD_ID|458093 ... 46 0.001
gi|17538760|ref|NP_501867.1| COLlagen structural gene (29.1 kD) ... 46 0.001
gi|39581447|emb|CAE74729.1| Hypothetical protein CBG22547 [Caeno... 46 0.001
gi|1245105|gb|AAC52934.1| glutamine repeat protein-1 45 0.002
gi|39588428|emb|CAE72779.1| Hypothetical protein CBG20034 [Caeno... 45 0.002
gi|47219440|emb|CAG10804.1| unnamed protein product [Tetraodon n... 45 0.002
gi|17563290|ref|NP_506095.1| COLlagen structural gene, SQuaT SQT... 45 0.002
gi|48771947|ref|ZP_00276289.1| hypothetical protein Reut02000697... 45 0.002
gi|17385615|emb|CAD12627.1| involucrin [Sus scrofa] 45 0.002
gi|28828396|gb|AAO51028.1| similar to Dictyostelium discoideum (... 45 0.003
gi|39586422|emb|CAE74080.1| Hypothetical protein CBG21735 [Caeno... 44 0.004
gi|32565788|ref|NP_871711.1| predicted CDS, COLlagen structural ... 44 0.004
gi|50758577|ref|XP_417323.1| PREDICTED: similar to centrosomal p... 44 0.004
gi|115401|sp|P16253|CAC3_HAECO Cuticle collagen 3A3 >gnl|BL_ORD_... 44 0.004
gi|321006|pir||A44984 collagen - nematode (Haemonchus contortus) 44 0.004
gi|39598359|emb|CAE69052.1| Hypothetical protein CBG15061 [Caeno... 44 0.004
gi|50405059|ref|YP_054151.1| hypothetical protein PTMB.222 [Para... 44 0.004
gi|24658445|ref|NP_729077.1| CG10596-PA [Drosophila melanogaster... 44 0.005
gi|25013014|gb|AAN71591.1| RH50422p [Drosophila melanogaster] 44 0.005
gi|23613492|ref|NP_703336.1| P. falciparum RESA-like protein wit... 44 0.005
gi|28829807|gb|AAO52309.1| similar to Oryza sativa (japonica cul... 44 0.005
gi|39580356|emb|CAE61461.1| Hypothetical protein CBG05353 [Caeno... 44 0.005
gi|24658452|ref|NP_729078.1| CG10596-PC [Drosophila melanogaster... 44 0.005
gi|21355467|ref|NP_647973.1| CG10596-PB [Drosophila melanogaster... 44 0.005
gi|4809258|gb|AAD30169.1| collagen [Haemonchus contortus] 44 0.005
gi|39594094|emb|CAE70204.1| Hypothetical protein CBG16679 [Caeno... 44 0.007
gi|50417567|gb|AAH77588.1| K14 protein [Xenopus laevis] 44 0.007
gi|17539522|ref|NP_501150.1| COLlagen structural gene (col-114) ... 44 0.007
gi|28828998|gb|AAO51573.1| similar to Dictyostelium discoideum (... 43 0.009
gi|9631239|ref|NP_048021.1| orf 48 [Ateline herpesvirus 3] >gnl|... 43 0.009
gi|17539482|ref|NP_501829.1| COLlagen structural gene (col-2) [C... 43 0.009
gi|50547317|ref|XP_501128.1| hypothetical protein [Yarrowia lipo... 42 0.015
gi|39585707|emb|CAE59909.1| Hypothetical protein CBG03393 [Caeno... 42 0.015
gi|18676506|dbj|BAB84905.1| FLJ00150 protein [Homo sapiens] 42 0.020
gi|39585732|emb|CAE59934.1| Hypothetical protein CBG03420 [Caeno... 42 0.020
gi|3435244|gb|AAC32373.1| centriole associated protein CEP110 [H... 42 0.020
gi|18070853|emb|CAD20123.1| bA165P4.2 (centrosomal protein 1) [H... 42 0.020
gi|38158018|ref|NP_008949.3| centrosomal protein 1; centriole as... 42 0.020
gi|47208936|emb|CAF90803.1| unnamed protein product [Tetraodon n... 42 0.020
gi|17539418|ref|NP_501561.1| COLlagen structural gene (col-119) ... 42 0.026
gi|17540822|ref|NP_500071.1| COLlagen structural gene (col-105) ... 42 0.026
gi|39595798|emb|CAE67301.1| Hypothetical protein CBG12754 [Caeno... 42 0.026
gi|50419503|ref|XP_458278.1| unnamed protein product [Debaryomyc... 42 0.026
gi|33285161|gb|AAC48094.2| Dumpy : shorter than wild-type protei... 42 0.026
gi|13508497|gb|AAF15293.3| erythrocyte membrane-associated giant... 42 0.026
gi|32698037|emb|CAE11316.1| Hypothetical protein H06A10.2 [Caeno... 42 0.026
gi|29290086|gb|AAO67558.1| Gag protein [Drosophila virilis] >gnl... 42 0.026
gi|124732|sp|P17941|INVO_HYLLA Involucrin >gnl|BL_ORD_ID|1811533... 41 0.034
gi|6688931|emb|CAB65343.1| liver stage antigen-3 [Plasmodium fal... 41 0.034
gi|16805082|ref|NP_473111.1| liver stage antigen 3 [Plasmodium f... 41 0.034
gi|39579268|emb|CAE56955.1| Hypothetical protein CBG24805 [Caeno... 41 0.034
gi|42601246|gb|AAS21320.1| major royal jelly protein MRJP5 precu... 41 0.034
gi|23509322|ref|NP_701989.1| hypothetical protein [Plasmodium fa... 41 0.044
gi|39596498|emb|CAE63117.1| Hypothetical protein CBG07414 [Caeno... 41 0.044
gi|46434336|gb|EAK93748.1| hypothetical protein CaO19.4488 [Cand... 40 0.057
gi|47523948|ref|NP_999613.1| involucrin [Sus scrofa] >gnl|BL_ORD... 40 0.057
gi|17533675|ref|NP_496739.1| mature parasite-infected erythrocyt... 40 0.057
gi|17384366|emb|CAD13202.1| involucrin [Sus scrofa] 40 0.057
gi|28828729|gb|AAO51324.1| similar to Dictyostelium discoideum (... 40 0.057
gi|1711494|sp|P50470|SPH_STRPY Immunoglobulin G binding protein ... 40 0.057
gi|39593552|emb|CAE61844.1| Hypothetical protein CBG05818 [Caeno... 40 0.057
gi|115397|sp|P08124|CC01_CAEEL Cuticle collagen 1 precursor (Squ... 40 0.057
gi|9837385|gb|AAG00554.1| retinitis pigmentosa GTPase regulator-... 40 0.075
gi|7498195|pir||T34203 hypothetical protein D2024.8 - Caenorhabd... 40 0.075
gi|23619284|ref|NP_705246.1| hypothetical protein [Plasmodium fa... 40 0.075
gi|50258198|gb|EAL20892.1| hypothetical protein CNBE2530 [Crypto... 40 0.075
gi|46442819|gb|EAL02105.1| hypothetical protein CaO19.801 [Candi... 38 0.080
gi|32564228|ref|NP_499057.3| CoLlagen, Basement membrane type, a... 40 0.098
gi|23613570|ref|NP_704591.1| E1-E2_ATPase/hydrolase, putative [P... 40 0.098
gi|15644950|ref|NP_207120.1| poly E-rich protein [Helicobacter p... 40 0.098
gi|23488856|gb|EAA21422.1| immediate early protein homolog-relat... 40 0.098
gi|49387873|dbj|BAD26560.1| atency associated nuclear antigen-li... 40 0.098
gi|46198236|gb|AAS82574.1| truncated phospholipase C delta-4 [Ho... 40 0.098
gi|39580392|emb|CAE70951.1| Hypothetical protein CBG17762 [Caeno... 39 0.13
gi|20066260|gb|AAM09367.1| similar to Dictyostelium discoideum (... 39 0.13
gi|28828505|gb|AAO51113.1| similar to Dictyostelium discoideum (... 39 0.13
gi|17539566|ref|NP_500519.1| DumPY : shorter than wild-type DPY-... 39 0.13
gi|38344252|emb|CAE04334.2| OSJNBa0008M17.5 [Oryza sativa (japon... 39 0.13
gi|39584784|emb|CAE67679.1| Hypothetical protein CBG13242 [Caeno... 39 0.17
gi|17539488|ref|NP_500524.1| COLlagen structural gene (col-33) [... 39 0.17
gi|13376429|ref|NP_079222.1| NEFA-interacting nuclear protein NI... 39 0.17
gi|124731|sp|P07476|INVO_HUMAN Involucrin >gnl|BL_ORD_ID|1848736... 39 0.17
gi|11423493|ref|XP_001677.1| similar to Involucrin [Homo sapiens... 39 0.17
gi|2144789|pir||I37061 involucrin M - gorilla >gnl|BL_ORD_ID|838... 39 0.17
gi|46228478|gb|EAK89348.1| hypothetical protein with glutamine r... 39 0.17
gi|7332272|gb|AAA17398.2| collagen [Caenorhabditis elegans] 39 0.17
gi|19112576|ref|NP_595784.1| hypothetical coiled-coil protein [S... 39 0.17
gi|7494560|pir||T37285 collagen dpy-2 - Caenorhabditis elegans 39 0.17
gi|467292|gb|AAA17387.1| glutamine-asparagine rich protein 39 0.17
gi|50405284|ref|YP_054376.1| Inositol 1,4,5-triphosphate recepto... 39 0.22
gi|29893526|gb|AAN16519.1| merozoite surface protein-9 [Plasmodi... 39 0.22
gi|28631387|gb|AAL92355.2| similar to Dictyostelium discoideum (... 39 0.22
gi|28571201|ref|NP_788907.1| CG33206-PA [Drosophila melanogaster... 39 0.22
gi|28571203|ref|NP_788908.1| CG33206-PB [Drosophila melanogaster... 39 0.22
gi|50290531|ref|XP_447697.1| unnamed protein product [Candida gl... 39 0.22
gi|8468621|gb|AAF75554.1| mature parasite-infected erythrocyte s... 39 0.22
gi|1469904|gb|AAB49033.1| JF-2 39 0.22
gi|50306605|ref|XP_453276.1| unnamed protein product [Kluyveromy... 39 0.22
gi|40556166|ref|NP_955251.1| CNPV228 N1R/p28-like protein [Canar... 39 0.22
gi|30022804|ref|NP_834435.1| Spore germination protein IA [Bacil... 39 0.22
gi|28828911|gb|AAO51497.1| similar to Mus musculus (Mouse). simi... 39 0.22
gi|42733613|gb|AAS38587.1| similar to Dictyostelium discoideum (... 38 0.28
gi|28850383|gb|AAO53158.1| similar to Plasmodium falciparum (iso... 38 0.28
gi|15792502|ref|NP_282325.1| highly acidic protein [Campylobacte... 38 0.28
gi|23485072|gb|EAA20190.1| myosin heavy chain [Plasmodium yoelii... 38 0.28
gi|50424619|ref|XP_460899.1| unnamed protein product [Debaryomyc... 38 0.28
gi|50258309|gb|EAL21000.1| hypothetical protein CNBD6010 [Crypto... 38 0.28
gi|49085954|ref|XP_405060.1| hypothetical protein AN0923.2 [Aspe... 38 0.28
gi|31207321|ref|XP_312627.1| ENSANGP00000015381 [Anopheles gambi... 38 0.28
gi|124734|sp|P14591|INVO_PANPA Involucrin >gnl|BL_ORD_ID|553935 ... 38 0.28
gi|17532741|ref|NP_495367.1| DumPY : shorter than wild-type DPY-... 38 0.28
gi|543967|sp|P35799|CCD2_CAEEL Cuticle collagen dpy-2 precursor 38 0.28
gi|23508068|ref|NP_700738.1| hypothetical protein [Plasmodium fa... 38 0.37
gi|33946321|ref|NP_891991.1| ninein isoform 5; GSK3B-interacting... 38 0.37
gi|21930287|gb|AAG33512.2| ninein-Lm isoform [Homo sapiens] 38 0.37
gi|50731940|ref|XP_418425.1| PREDICTED: similar to collagen, typ... 38 0.37
gi|12655864|gb|AAK00630.1| ninein isotype 3 [Homo sapiens] 38 0.37
gi|33946319|ref|NP_891990.1| ninein isoform 3; GSK3B-interacting... 38 0.37
gi|50738301|ref|XP_419285.1| PREDICTED: hypothetical protein XP_... 38 0.37
gi|34857875|ref|XP_346628.1| hypothetical protein XP_346627 [Rat... 38 0.37
gi|12655862|gb|AAK00629.1| ninein isotype 2 [Homo sapiens] 38 0.37
gi|33946315|ref|NP_065972.2| ninein isoform 2; GSK3B-interacting... 38 0.37
gi|12655860|gb|AAK00628.1| ninein isotype 1 [Homo sapiens] 38 0.37
gi|33946317|ref|NP_891989.1| ninein isoform 1; GSK3B-interacting... 38 0.37
gi|45515101|ref|ZP_00166657.1| hypothetical protein Raeut561901 ... 38 0.37
gi|39596517|emb|CAE63136.1| Hypothetical protein CBG07436 [Caeno... 38 0.37
gi|20260804|gb|AAK54092.2| histidine kinase DhkL [Dictyostelium ... 38 0.37
gi|33946313|ref|NP_057434.3| ninein isoform 4; GSK3B-interacting... 38 0.37
gi|11559966|ref|NP_071531.1| involucrin gene [Rattus norvegicus]... 37 0.49
gi|46447121|ref|YP_008486.1| putative chromosome segregation SMC... 37 0.49
gi|39586913|emb|CAE62848.1| Hypothetical protein CBG07027 [Caeno... 37 0.49
gi|48110621|ref|XP_396273.1| similar to hypothetical protein DKF... 37 0.49
gi|46227256|gb|EAK88206.1| similar to hypothetical protein [Cryp... 37 0.49
gi|23491066|gb|EAA22695.1| hypothetical protein [Plasmodium yoel... 37 0.49
gi|17551704|ref|NP_508747.1| COLlagen structural gene (33.9 kD) ... 37 0.49
gi|39596499|emb|CAE63118.1| Hypothetical protein CBG07415 [Caeno... 37 0.49
gi|31077132|ref|NP_852034.1| histidine rich calcium binding prot... 37 0.63
gi|50783410|ref|XP_427584.1| PREDICTED: similar to Myosin Vc (My... 37 0.63
gi|17563224|ref|NP_506247.1| Pinin/SDK/memA protein (42.5 kD) (5... 37 0.63
gi|39582581|emb|CAE63900.1| Hypothetical protein CBG08471 [Caeno... 37 0.63
gi|50732309|ref|XP_418574.1| PREDICTED: similar to Kinesin heavy... 37 0.63
gi|7489885|pir||T14867 interaptin - slime mold (Dictyostelium di... 37 0.63
gi|7506774|pir||T24236 hypothetical protein R186.4 - Caenorhabdi... 37 0.63
gi|2425111|gb|AAB70839.1| ZipA [Dictyostelium discoideum] 37 0.63
gi|17568109|ref|NP_510274.1| COLlagen structural gene (col-44) [... 37 0.63
gi|28828918|gb|AAO51504.1| similar to Dictyostelium discoideum (... 37 0.63
gi|24664026|ref|NP_729947.1| CG32133-PA [Drosophila melanogaster... 37 0.63
gi|23509871|ref|NP_702538.1| hypothetical protein [Plasmodium fa... 37 0.83
gi|24640482|ref|NP_511078.2| CG2252-PB [Drosophila melanogaster]... 37 0.83
gi|27532950|ref|NP_080187.2| RIKEN cDNA 1810060J02 [Mus musculus... 37 0.83
gi|19354193|gb|AAH24946.1| 1810060J02Rik protein [Mus musculus] 37 0.83
gi|46434301|gb|EAK93714.1| hypothetical protein CaO19.11964 [Can... 37 0.83
gi|24286591|gb|AAN46654.1| M protein precursor [Streptococcus py... 37 0.83
gi|23508683|ref|NP_701352.1| antigen 332, putative [Plasmodium f... 37 0.83
gi|24286593|gb|AAN46655.1| M protein precursor [Streptococcus py... 37 0.83
gi|16804923|ref|NP_472952.1| hypothetical protein [Plasmodium fa... 37 0.83
gi|17557099|ref|NP_499700.1| COLlagen structural gene (30.3 kD) ... 37 0.83
gi|39588941|emb|CAE69571.1| Hypothetical protein CBG15783 [Caeno... 37 0.83
gi|50750157|ref|XP_421895.1| PREDICTED: similar to Disco-interac... 37 0.83
gi|631703|pir||S44925 IB3/5-polypeptide - mouse >gnl|BL_ORD_ID|1... 37 0.83
gi|50256526|gb|EAL19251.1| hypothetical protein CNBH3500 [Crypto... 37 0.83
gi|24286589|gb|AAN46653.1| M protein precursor [Streptococcus py... 37 0.83
gi|24286595|gb|AAN46656.1| M protein precursor [Streptococcus py... 37 0.83
gi|47551335|ref|NP_999978.1| zgc:85722 [Danio rerio] >gnl|BL_ORD... 37 0.83
gi|42523570|ref|NP_968950.1| hypthetical protein [Bdellovibrio b... 37 0.83
gi|46442947|gb|EAL02232.1| hypothetical protein CaO19.8420 [Cand... 34 1.0
gi|23613114|ref|NP_703436.1| chromosome condensation protein, pu... 36 1.1
gi|21955276|ref|NP_611059.1| CG30084-PB [Drosophila melanogaster... 36 1.1
gi|26353812|dbj|BAC40536.1| unnamed protein product [Mus musculus] 36 1.1
gi|31205229|ref|XP_311563.1| ENSANGP00000016041 [Anopheles gambi... 36 1.1
gi|48109395|ref|XP_396232.1| similar to CG6450-PC [Apis mellifera] 36 1.1
gi|1587031|prf||2205312A cis-Golgi matrix protein GM130 36 1.1
gi|23482074|gb|EAA18164.1| hypothetical protein [Plasmodium yoel... 36 1.1
gi|25151813|ref|NP_509145.2| putative protein, with 3 coiled coi... 36 1.1
gi|27367908|ref|NP_763435.1| TPR repeat containing protein [Vibr... 36 1.1
gi|30059152|gb|AAO34632.1| 280 kDa protein [Citrus psorosis virus] 36 1.1
gi|23380422|gb|AAN17925.1| Erp43 protein [Borrelia burgdorferi] 36 1.1
gi|4704439|gb|AAD28095.1| ElpA2 protein [Borrelia burgdorferi] 36 1.1
gi|1076839|pir||S49313 protein kinase - slime mold (Dictyosteliu... 36 1.1
gi|401497|sp|P31569|YCF2_OENVI Protein ycf2 >gnl|BL_ORD_ID|17895... 36 1.1
gi|12018260|ref|NP_072118.1| cis-Golgi matrix protein GM130 [Rat... 36 1.1
gi|3044185|gb|AAC13303.1| mature parasite-infected erythrocyte s... 36 1.1
gi|7505950|pir||T16637 hypothetical protein M03A8.2 - Caenorhabd... 36 1.1
gi|26006473|ref|NP_742120.1| rootletin [Mus musculus] >gnl|BL_OR... 36 1.1
gi|6680572|ref|NP_032474.1| kinesin family member 5B; kinesin he... 36 1.1
gi|28828961|gb|AAO51542.1| similar to Dictyostelium discoideum (... 36 1.1
gi|401496|sp|P31568|YCF2_OENPI Protein ycf2 >gnl|BL_ORD_ID|27360... 36 1.1
gi|28830050|gb|AAO52540.1| similar to Entamoeba histolytica. Myo... 36 1.4
gi|15217810|ref|NP_176681.1| expressed protein [Arabidopsis thal... 36 1.4
gi|25404512|pir||F96673 hypothetical protein F13O11.30 [imported... 36 1.4
gi|40556094|ref|NP_955179.1| CNPV156 hypothetical protein [Canar... 36 1.4
gi|24286732|gb|AAN46886.1| nucleotide exchange factor RasGEF R [... 36 1.4
gi|50258344|gb|EAL21033.1| hypothetical protein CNBD4090 [Crypto... 36 1.4
gi|41054033|ref|NP_956189.1| Unknown (protein for MGC:63502); wu... 36 1.4
gi|17551424|ref|NP_510247.1| COLlagen structural gene (col-183) ... 36 1.4
gi|39592327|emb|CAE63404.1| Hypothetical protein CBG07843 [Caeno... 36 1.4
gi|84186|pir||JN0292 antigen 332 - malaria parasite (Plasmodium ... 36 1.4
gi|14249340|ref|NP_116115.1| phospholipase C, delta 4; PLC delta... 36 1.4
gi|17542460|ref|NP_499889.1| COLlagen structural gene (col-100) ... 35 1.8
gi|14670381|ref|NP_057427.2| centromere protein F (350/400kD); m... 35 1.8
gi|47214561|emb|CAF96234.1| unnamed protein product [Tetraodon n... 35 1.8
gi|1345731|sp|P49454|CENF_HUMAN CENP-F kinetochore protein (Cent... 35 1.8
gi|30721677|gb|AAP33688.1| phoshoprotein 300 [Plasmodium falcipa... 35 1.8
gi|7489910|pir||T14004 trfA protein - slime mold (Dictyostelium ... 35 1.8
gi|34874095|ref|XP_221050.2| similar to fetal Alzheimer antigen ... 35 1.8
gi|2116688|dbj|BAA11178.1| deltaEF1 [Gallus gallus] 35 1.8
gi|45384096|ref|NP_990462.1| deltaEF1 [Gallus gallus] >gnl|BL_OR... 35 1.8
gi|586121|sp|P37709|TRHY_RABIT Trichohyalin >gnl|BL_ORD_ID|29628... 35 1.8
gi|34872243|ref|XP_233603.2| similar to rootletin [Rattus norveg... 35 1.8
gi|17385613|emb|CAD12626.1| involucrin [Sus scrofa] 35 1.8
gi|46437420|gb|EAK96767.1| hypothetical protein CaO19.2850 [Cand... 35 1.8
gi|29376816|ref|NP_815970.1| bacteriocin, putative [Enterococcus... 35 1.8
gi|50420779|ref|XP_458929.1| unnamed protein product [Debaryomyc... 35 1.8
gi|47077020|dbj|BAD18444.1| unnamed protein product [Homo sapiens] 35 1.8
gi|4758648|ref|NP_004512.1| kinesin family member 5B; kinesin 1 ... 35 1.8
gi|23613032|ref|NP_703354.1| Mature parasite-infected erythrocyt... 35 1.8
gi|46444529|gb|EAL03803.1| hypothetical protein CaO19.1500 [Cand... 35 1.8
gi|27467163|ref|NP_763800.1| triacylglycerol lipase precursor [S... 35 1.8
gi|28828361|gb|AAO51011.1| similar to Homo sapiens (Human). Hypo... 35 1.8
gi|17537301|ref|NP_494562.1| COLlagen structural gene (37.0 kD) ... 35 1.8
gi|120943|sp|P13816|GARP_PLAFF Glutamic acid-rich protein precur... 35 1.8
gi|21357267|ref|NP_649312.1| CG6014-PA [Drosophila melanogaster]... 35 1.8
gi|2119280|pir||I84737 kinesin heavy chain - mouse (fragment) >g... 35 1.8
gi|30348551|emb|CAC84343.1| hypothetical protein [Saimiriine her... 35 1.8
gi|7769648|gb|AAF69494.1| nuclear receptor E78A [Drosophila mela... 35 2.4
gi|34223729|sp|P45447|E78A_DROME Ecdysone-induced protein 78C (D... 35 2.4
gi|32413483|ref|XP_327221.1| predicted protein [Neurospora crass... 35 2.4
gi|23508409|ref|NP_701078.1| hypothetical protein [Plasmodium fa... 35 2.4
gi|2243140|emb|CAA67384.1| nuclear hormone receptor [Drosophila ... 35 2.4
gi|47230389|emb|CAF99582.1| unnamed protein product [Tetraodon n... 35 2.4
gi|50257635|gb|EAL20340.1| hypothetical protein CNBF1510 [Crypto... 35 2.4
gi|39582489|emb|CAE66580.1| Hypothetical protein CBG11897 [Caeno... 35 2.4
gi|40556157|ref|NP_955242.1| CNPV219 N1R/p28-like protein [Canar... 35 2.4
gi|34866267|ref|XP_232667.2| similar to coiled-coil protein [Rat... 35 2.4
gi|514833|gb|AAA19975.1| nuclear hormone receptor superfamily pr... 35 2.4
gi|24668202|ref|NP_649329.1| CG7177-PA [Drosophila melanogaster]... 35 2.4
gi|39579307|emb|CAE56326.1| Hypothetical protein CBG23991 [Caeno... 35 2.4
gi|47214544|emb|CAG04564.1| unnamed protein product [Tetraodon n... 35 2.4
gi|31235077|ref|XP_319177.1| ENSANGP00000012409 [Anopheles gambi... 35 2.4
gi|323126|pir||A45605 mature-parasite-infected erythrocyte surfa... 35 2.4
gi|23489064|gb|EAA21475.1| hypothetical protein [Plasmodium yoel... 35 2.4
gi|39593302|emb|CAE64772.1| Hypothetical protein CBG09563 [Caeno... 35 2.4
gi|39598361|emb|CAE69054.1| Hypothetical protein CBG15063 [Caeno... 35 2.4
gi|32413637|ref|XP_327298.1| hypothetical protein [Neurospora cr... 35 2.4
gi|48854370|ref|ZP_00308533.1| COG4487: Uncharacterized protein ... 35 2.4
gi|39581964|emb|CAE73826.1| Hypothetical protein CBG21388 [Caeno... 35 2.4
gi|13022018|gb|AAK11610.1| Emm58 [Streptococcus pyogenes] 35 2.4
gi|5052612|gb|AAD38636.1| BcDNA.GH10646 [Drosophila melanogaster] 35 2.4
gi|160409|gb|AAA29651.1| mature-parasite-infected erythrocyte su... 35 2.4
gi|21355671|ref|NP_652022.1| CG12218-PA [Drosophila melanogaster... 35 2.4
gi|23613218|ref|NP_703540.1| hypothetical protein [Plasmodium fa... 35 2.4
gi|7512173|pir||T30336 nuclear/mitotic apparatus protein - Afric... 35 2.4
gi|586120|sp|Q07283|TRHY_HUMAN Trichohyalin >gnl|BL_ORD_ID|13043... 35 2.4
gi|17561476|ref|NP_505888.1| COLlagen structural gene (col-155) ... 35 3.1
gi|39591568|emb|CAE71144.1| Hypothetical protein CBG17999 [Caeno... 35 3.1
gi|42734015|gb|AAS38898.1| similar to putative TFIIF-interacting... 35 3.1
gi|29290091|gb|AAO67562.1| Pol protein [Drosophila virilis] 35 3.1
gi|23612500|ref|NP_704061.1| erythrocyte membrane protein 1 (PfE... 35 3.1
gi|50287945|ref|XP_446401.1| unnamed protein product [Candida gl... 35 3.1
gi|22474513|dbj|BAC10618.1| Titin-like protein [Bombyx mori] 35 3.1
gi|1709191|sp|P54659|MVPB_DICDI Major vault protein beta (MVP-be... 35 3.1
gi|37595258|gb|AAQ94514.1| M protein [Streptococcus pyogenes] 35 3.1
gi|47219280|emb|CAG11742.1| unnamed protein product [Tetraodon n... 35 3.1
gi|16805171|ref|NP_473199.1| hypothetical protein [Plasmodium fa... 35 3.1
gi|28871907|ref|NP_794526.1| conserved hypothetical protein [Pse... 35 3.1
gi|39593233|emb|CAE64703.1| Hypothetical protein CBG09489 [Caeno... 35 3.1
gi|18700459|dbj|BAB85197.1| Titin-like protein [Bombyx mori] 35 3.1
gi|23483702|gb|EAA19286.1| threonyl-tRNA synthetase, putative [P... 35 3.1
gi|30681829|ref|NP_850032.1| expressed protein [Arabidopsis thal... 35 3.1
gi|39580220|emb|CAE72976.1| Hypothetical protein CBG20316 [Caeno... 34 4.1
gi|50258980|gb|EAL21661.1| hypothetical protein CNBC6970 [Crypto... 34 4.1
gi|23612484|ref|NP_704045.1| hypothetical protein [Plasmodium fa... 34 4.1
gi|50419727|ref|XP_458392.1| unnamed protein product [Debaryomyc... 34 4.1
gi|39597872|emb|CAE68564.1| Hypothetical protein CBG14399 [Caeno... 34 4.1
gi|46134375|ref|ZP_00157798.2| COG0457: FOG: TPR repeat [Anabaen... 34 4.1
gi|21231078|ref|NP_636995.1| unknown acidic aa rich protein [Xan... 34 4.1
gi|25152063|ref|NP_509435.2| putative protein, with 2 coiled coi... 34 4.1
gi|17486065|ref|XP_066752.1| similar to E2F transcription factor... 34 4.1
gi|47226278|emb|CAG09246.1| unnamed protein product [Tetraodon n... 34 4.1
gi|2144790|pir||I37060 involucrin L - gorilla >gnl|BL_ORD_ID|150... 34 4.1
gi|14164561|gb|AAK55123.1| Swift [Xenopus laevis] 34 4.1
gi|47568496|ref|ZP_00239196.1| spermine/spermidine synthase fami... 34 4.1
gi|10180804|gb|AAG14291.1| glutamic acid-rich protein [Plasmodiu... 34 4.1
gi|26337435|dbj|BAC32403.1| unnamed protein product [Mus musculus] 34 4.1
gi|26330708|dbj|BAC29084.1| unnamed protein product [Mus musculus] 34 4.1
gi|39596527|emb|CAE63146.1| Hypothetical protein CBG07448 [Caeno... 34 4.1
gi|50510551|dbj|BAD32261.1| mKIAA0619 protein [Mus musculus] 34 4.1
gi|28828096|gb|AAO50779.1| similar to Mus musculus (Mouse). Sex-... 34 4.1
gi|15223730|ref|NP_177804.1| expressed protein [Arabidopsis thal... 34 4.1
gi|11467826|ref|NP_050877.1| hypothetical chloroplast RF2 [Nephr... 34 4.1
gi|6677761|ref|NP_033098.1| Rho-associated coiled-coil forming k... 34 4.1
gi|42733675|gb|AAO50853.2| similar to Dictyostelium discoideum (... 34 4.1
gi|11345236|gb|AAG34656.1| involucrin [Mus musculus] 34 4.1
gi|48832772|ref|ZP_00289801.1| COG0457: FOG: TPR repeat [Magneto... 34 4.1
gi|7499248|pir||T25697 hypothetical protein F16F9.2 - Caenorhabd... 34 4.1
gi|42627815|tpe|CAE00399.1| TPA: putative ISG12(b2) protein [Mus... 34 4.1
gi|50311673|ref|XP_455863.1| unnamed protein product [Kluyveromy... 34 5.4
gi|34854301|ref|XP_342634.1| similar to A-kinase anchor protein ... 34 5.4
gi|23508767|ref|NP_701435.1| hypothetical protein [Plasmodium fa... 34 5.4
gi|41322927|ref|NP_958789.1| plectin 1 isoform 4 [Mus musculus] ... 34 5.4
gi|50746200|ref|XP_420401.1| PREDICTED: similar to Serine/threon... 34 5.4
gi|41322925|ref|NP_958787.1| plectin 1 isoform 2 [Mus musculus] ... 34 5.4
gi|23612220|ref|NP_703800.1| myosin-like protein, putative [Plas... 34 5.4
gi|6323883|ref|NP_013954.1| TFIID subunit (67 kDa), involved in ... 34 5.4
gi|29290087|gb|AAO67559.1| Pol protein [Drosophila virilis] 34 5.4
gi|39590295|emb|CAE66033.1| Hypothetical protein CBG11229 [Caeno... 34 5.4
gi|23509472|ref|NP_702139.1| hypothetical protein [Plasmodium fa... 34 5.4
gi|34880469|ref|XP_222745.2| similar to nuclear pore complex-ass... 34 5.4
gi|16040977|dbj|BAB69690.1| Rb1-inducible coiled coil protein [H... 34 5.4
gi|41281499|ref|NP_055596.2| Rb1-inducible coiled coil protein 1... 34 5.4
gi|40556103|ref|NP_955188.1| CNPV165 N1R/p28-like protein [Canar... 34 5.4
gi|50744910|ref|XP_419932.1| PREDICTED: similar to myelin transc... 34 5.4
gi|46131551|ref|ZP_00169819.2| COG0642: Signal transduction hist... 34 5.4
gi|38077811|ref|XP_128277.4| similar to plectin [Mus musculus] 34 5.4
gi|41322939|ref|NP_958795.1| plectin 1 isoform 10 [Mus musculus]... 34 5.4
gi|539440|pir||A49070 ecdysone-inducible protein E78A - fruit fl... 34 5.4
gi|7489869|pir||T30330 gelsolin-related protein GRP125 - slime m... 34 5.4
gi|41322904|ref|NP_035247.1| plectin 1 isoform 1 [Mus musculus] ... 34 5.4
gi|50293635|ref|XP_449229.1| unnamed protein product [Candida gl... 34 5.4
gi|23485922|gb|EAA20646.1| hypothetical protein [Plasmodium yoel... 34 5.4
gi|23479635|gb|EAA16409.1| glutamic acid-rich protein precursor,... 34 5.4
gi|246926|gb|AAB21710.1| antigen 332, Ag332=Pf332 gene clone C1 ... 34 5.4
gi|41322931|ref|NP_958791.1| plectin 1 isoform 6 [Mus musculus] ... 34 5.4
gi|49235357|ref|ZP_00329427.1| COG3599: Cell division initiation... 34 5.4
gi|41322941|ref|NP_958796.1| plectin 1 isoform 11 [Mus musculus]... 34 5.4
gi|41322935|ref|NP_958793.1| plectin 1 isoform 8 [Mus musculus] ... 34 5.4
gi|34859534|ref|XP_347224.1| similar to A-kinase anchor protein ... 34 5.4
gi|23613580|ref|NP_704601.1| beta subunit of coatomer complex, p... 34 5.4
gi|14150873|gb|AAK54666.1| phosphoprotein P [Canine distemper vi... 34 5.4
gi|9630647|ref|NP_047202.1| phosphoprotein P [canine distemper v... 34 5.4
gi|133662|sp|P06940|RRPP_CDVO RNA polymerase alpha subunit (Nucl... 34 5.4
gi|5833494|gb|AAD53535.1| polymerase-associated protein [canine ... 34 5.4
gi|5815245|gb|AAD52614.1| SANT domain protein SMRTER [Drosophila... 34 5.4
gi|40788906|dbj|BAA13194.2| KIAA0203 [Homo sapiens] 34 5.4
gi|41322921|ref|NP_958788.1| plectin 1 isoform 3 [Mus musculus] ... 34 5.4
gi|23619049|ref|NP_705011.1| hypothetical protein [Plasmodium fa... 34 5.4
gi|27261501|gb|AAN86033.1| kinesin 1 [Dictyostelium discoideum] 34 5.4
gi|46431910|gb|EAK91429.1| hypothetical protein CaO19.9173 [Cand... 34 5.4
gi|5803098|ref|NP_006757.1| MYST histone acetyltransferase (mono... 34 5.4
gi|50311883|ref|XP_455973.1| unnamed protein product [Kluyveromy... 34 5.4
gi|23612103|ref|NP_703683.1| ATP dependent RNA helicase, putativ... 34 5.4
gi|41322933|ref|NP_958792.1| plectin 1 isoform 7 [Mus musculus] ... 34 5.4
gi|45237195|ref|NP_055605.2| KIAA0555 gene product [Homo sapiens... 33 7.0
gi|40788305|dbj|BAA31594.2| KIAA0619 protein [Homo sapiens] 33 7.0
gi|120558|sp|P13709|FSH_DROME FEMALE STERILE HOMEOTIC PROTEIN (F... 33 7.0
gi|7513016|pir||T00331 hypothetical protein KIAA0555 - human 33 7.0
gi|46800552|emb|CAG25720.2| plectin [Rattus norvegicus] 33 7.0
>gi|17531395|ref|NP_495104.1| BLIstered cuticle BLI-2, Nematode
cuticle collagen (bli-2) [Caenorhabditis elegans]
gi|7446027|pir||T15268 hypothetical protein F59E12.12 -
Caenorhabditis elegans
gi|2088834|gb|AAB54250.1| Blistered cuticle protein 2
[Caenorhabditis elegans]
Length = 311
Score = 305 bits (780), Expect = 1e-81
Identities = 175/271 (64%), Positives = 175/271 (64%)
Frame = -1
Query: 936 MDEKELNHEASMLRKVAFLGICISTVSTLTCIIAIPLLYNYMQHVQTNLHSEIDFCRHRT 757
MDEKELNHEASMLRKVAFLGICISTVSTLTCIIAIPLLYNYMQHVQTNLHSEIDFCRHRT
Sbjct: 1 MDEKELNHEASMLRKVAFLGICISTVSTLTCIIAIPLLYNYMQHVQTNLHSEIDFCRHRT 60
Query: 756 VGLFIQYERMQSASGIKGRRIIVKKQAGYDFAESNTNAESGFSSSKSSLAPGGQCCSCKT 577
VGLFIQYERMQSASGIKGRRIIVKKQAGYDFAESNTNAESGFSSSKSSLAPGGQCCSCKT
Sbjct: 61 VGLFIQYERMQSASGIKGRRIIVKKQAGYDFAESNTNAESGFSSSKSSLAPGGQCCSCKT 120
Query: 576 XXXXXXXXXXXXXXXXXXXXXGLNGEDGTDAKDSAPRRDAAAPCYDCXXXXXXXXXXXXX 397
GLNGEDGTDAKDSAPRRDAAAPCYDC
Sbjct: 121 GPSGPPGPPGEDGRDGRDGKPGLNGEDGTDAKDSAPRRDAAAPCYDCPVGPPGPPGNIGS 180
Query: 396 XGQPGRNGKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGKCDEVNVAQXXXX 217
GQPGRNGK GKCDEVNVAQ
Sbjct: 181 KGQPGRNGKDGLPGVPGLPGQPGEPGDDGEPGEDGDPGQPGDNGEPGKCDEVNVAQGPPG 240
Query: 216 XXXXXXXXXXXXXXXXXXXXGQDGEQGPAGE 124
GQDGEQGPAGE
Sbjct: 241 SPGPPGLPGPDGLPGTPGNPGQDGEQGPAGE 271