Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F59F4_2
(198 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17568315|ref|NP_510604.1| ribosome associated membrane protei... 136 1e-31
gi|39596100|emb|CAE69736.1| Hypothetical protein CBG16007 [Caeno... 132 2e-30
gi|25153780|ref|NP_741461.1| ribosome associated membrane protei... 96 2e-19
gi|20810547|gb|AAH29067.1| Similar to stress-associated endoplas... 92 2e-18
gi|37703266|gb|AAR01199.1| RAMP4-2 [Mus musculus musculus] 91 5e-18
gi|31242287|ref|XP_321574.1| ENSANGP00000025348 [Anopheles gambi... 85 4e-16
gi|24656574|ref|NP_728830.1| CG32276-PA [Drosophila melanogaster... 79 2e-14
gi|50540212|ref|NP_001002573.1| zgc:92744 [Danio rerio] >gnl|BL_... 79 2e-14
gi|41202631|ref|XP_370724.1| similar to ribosome associated memb... 78 6e-14
gi|4585827|emb|CAB40910.1| ribosome associated membrane protein ... 77 1e-13
gi|7657552|ref|NP_055260.1| stress-associated endoplasmic reticu... 77 1e-13
gi|45360819|ref|NP_989085.1| hypothetical protein MGC75578 [Xeno... 77 1e-13
gi|41053319|ref|NP_956328.1| ribosome associated membrane protei... 76 2e-13
gi|47216486|emb|CAG02137.1| unnamed protein product [Tetraodon n... 75 3e-13
gi|47210807|emb|CAF89799.1| unnamed protein product [Tetraodon n... 73 1e-12
gi|47086153|ref|NP_998108.1| hypothetical protein zgc:85858 [Dan... 70 1e-11
gi|47201869|emb|CAF88539.1| unnamed protein product [Tetraodon n... 51 6e-06
gi|27817834|dbj|BAC55602.1| unknown protein [Oryza sativa (japon... 51 6e-06
gi|23479574|gb|EAA16367.1| Arabidopsis thaliana F17L21.12-relate... 50 1e-05
gi|12840905|dbj|BAB25004.1| unnamed protein product [Mus musculus] 50 2e-05
gi|33327292|gb|AAQ09002.1| hypothetical protein [Phaseolus vulga... 49 3e-05
gi|46226396|gb|EAK87401.1| similar to IMP4 family, transcript id... 48 5e-05
gi|25403305|pir||A86399 protein F17L21.12 [imported] - Arabidops... 48 7e-05
gi|18396294|ref|NP_564277.1| expressed protein [Arabidopsis thal... 48 7e-05
gi|23593330|ref|NP_703173.1| hypothetical protein [Plasmodium fa... 45 6e-04
gi|39587501|emb|CAE58439.1| Hypothetical protein CBG01575 [Caeno... 44 7e-04
gi|49121618|ref|XP_412427.1| hypothetical protein AN8290.2 [Aspe... 37 0.12
gi|29377461|ref|NP_816615.1| cytosine/purines, uracil, thiamine,... 31 6.3
gi|25012842|gb|AAN71510.1| RH05583p [Drosophila melanogaster] 31 8.3
>gi|17568315|ref|NP_510604.1| ribosome associated membrane protein
(XQ461) [Caenorhabditis elegans]
gi|7504801|pir||T23009 hypothetical protein F59F4.2 -
Caenorhabditis elegans
gi|3877972|emb|CAB03157.1| Hypothetical protein F59F4.2
[Caenorhabditis elegans]
Length = 65
Score = 136 bits (343), Expect = 1e-31
Identities = 65/65 (100%), Positives = 65/65 (100%)
Frame = +1
Query: 1 MAPKQRMTLANKQFSKNVNNRGNVAKSLKPAEDKYPAAPWLIGLFVFVVCGSAVFEIIRY 180
MAPKQRMTLANKQFSKNVNNRGNVAKSLKPAEDKYPAAPWLIGLFVFVVCGSAVFEIIRY
Sbjct: 1 MAPKQRMTLANKQFSKNVNNRGNVAKSLKPAEDKYPAAPWLIGLFVFVVCGSAVFEIIRY 60
Query: 181 VKMGW 195
VKMGW
Sbjct: 61 VKMGW 65