Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F59G1_8
(411 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17534607|ref|NP_495183.1| FRataxin Homolog (15.7 kD) (frh-1) ... 236 1e-61
gi|39596993|emb|CAE59220.1| Hypothetical protein CBG02538 [Caeno... 206 6e-53
gi|6679863|ref|NP_032070.1| frataxin [Mus musculus] >gnl|BL_ORD_... 110 6e-24
gi|11493988|gb|AAG35732.1| frataxin-like protein [Drosophila mel... 110 8e-24
gi|17647048|ref|NP_511094.1| CG8971-PA [Drosophila melanogaster]... 110 8e-24
gi|11559522|gb|AAG37996.1| frataxin-like protein [Drosophila sub... 109 1e-23
gi|23574726|dbj|BAC20589.1| frataxin [Macaca fascicularis] 109 1e-23
gi|21730873|pdb|1LY7|A Chain A, The Solution Structure Of The Th... 108 2e-23
gi|11513844|pdb|1EKG|A Chain A, Mature Human Frataxin 108 2e-23
gi|31077081|ref|NP_000135.2| frataxin isoform 1 preproprotein [H... 108 2e-23
gi|1218024|gb|AAA98508.1| frataxin >gnl|BL_ORD_ID|162794 gi|1237... 107 7e-23
gi|38048059|gb|AAR09932.1| similar to Drosophila melanogaster fh... 106 1e-22
gi|50761767|ref|XP_424827.1| PREDICTED: similar to frataxin isof... 105 2e-22
gi|31204805|ref|XP_311351.1| ENSANGP00000021388 [Anopheles gambi... 100 5e-21
gi|48108742|ref|XP_393099.1| similar to CG14085-PB [Apis mellifera] 100 6e-21
gi|46432829|gb|EAK92294.1| hypothetical protein CaO19.8989 [Cand... 92 3e-18
gi|32419921|ref|XP_330404.1| hypothetical protein [Neurospora cr... 90 1e-17
gi|50419243|ref|XP_458144.1| unnamed protein product [Debaryomyc... 88 3e-17
gi|50308689|ref|XP_454348.1| unnamed protein product [Kluyveromy... 86 2e-16
gi|35193017|gb|AAH58533.1| Frda protein [Mus musculus] 86 2e-16
gi|50553130|ref|XP_503975.1| hypothetical protein [Yarrowia lipo... 85 3e-16
gi|45201483|ref|NP_987053.1| AGR387Cp [Eremothecium gossypii] >g... 85 3e-16
gi|50294360|ref|XP_449591.1| unnamed protein product [Candida gl... 84 8e-16
gi|38108435|gb|EAA54450.1| hypothetical protein MG02435.4 [Magna... 81 5e-15
gi|6320083|ref|NP_010163.1| Yeast Frataxin Homologue; Yfh1p [Sac... 80 1e-14
gi|46123257|ref|XP_386182.1| hypothetical protein FG06006.1 [Gib... 79 2e-14
gi|19075386|ref|NP_587886.1| putative regulator of mitochondrial... 79 2e-14
gi|1218025|gb|AAA98509.1| frataxin 78 4e-14
gi|31742516|ref|NP_852090.1| frataxin isoform 2 preproprotein [H... 78 4e-14
gi|9910703|sp|Q9ZR07|FRDA_ARATH Frataxin homolog >gnl|BL_ORD_ID|... 75 3e-13
gi|42566266|ref|NP_192233.2| frataxin protein-related [Arabidops... 75 3e-13
gi|37048704|gb|AAQ88214.1| frataxin-like protein [Cryptococcus n... 68 4e-11
gi|50256090|gb|EAL18817.1| hypothetical protein CNBI0780 [Crypto... 68 4e-11
gi|49076052|ref|XP_402043.1| hypothetical protein UM04428.1 [Ust... 66 2e-10
gi|49088642|ref|XP_406123.1| hypothetical protein AN1986.2 [Aspe... 64 5e-10
gi|42453577|ref|ZP_00153484.1| hypothetical protein Rick043201 [... 53 1e-06
gi|34580630|ref|ZP_00142110.1| cyaY protein [Rickettsia sibirica... 52 3e-06
gi|19075144|ref|NP_586745.1| FRATAXIN [Encephalitozoon cuniculi]... 52 3e-06
gi|15892366|ref|NP_360080.1| cyaY protein [Rickettsia conorii st... 52 3e-06
gi|23013073|ref|ZP_00053021.1| COG1965: Protein implicated in ir... 50 8e-06
gi|15604191|ref|NP_220706.1| CYAY PROTEIN (cyaY) [Rickettsia pro... 49 2e-05
gi|34862128|ref|XP_345013.1| similar to frataxin [Rattus norvegi... 46 2e-04
gi|48731108|ref|ZP_00264854.1| COG1965: Protein implicated in ir... 45 2e-04
gi|13626183|sp|Q9HTS5|CYAY_PSEAE CyaY protein 43 0.001
gi|15677807|ref|NP_274971.1| cyaY protein [Neisseria meningitidi... 43 0.001
gi|49079882|gb|AAT49945.1| PA5275 [synthetic construct] 43 0.001
gi|15600468|ref|NP_253962.1| conserved hypothetical protein [Pse... 43 0.001
gi|26991901|ref|NP_747326.1| cyaY protein [Pseudomonas putida KT... 42 0.002
gi|28867459|ref|NP_790078.1| cyaY protein [Pseudomonas syringae ... 41 0.005
gi|15640155|ref|NP_229782.1| cyaY protein [Vibrio cholerae O1 bi... 41 0.005
gi|15793468|ref|NP_283290.1| conserved hypothetical protein [Nei... 41 0.006
gi|23469517|ref|ZP_00124851.1| COG1965: Protein implicated in ir... 41 0.006
gi|32044654|ref|ZP_00141755.1| COG1965: Protein implicated in ir... 40 0.008
gi|46308814|ref|ZP_00211006.1| COG1965: Protein implicated in ir... 40 0.010
gi|23105835|ref|ZP_00092289.1| COG1965: Protein implicated in ir... 40 0.014
gi|16123982|ref|NP_407295.1| frataxin-like protein [Yersinia pes... 39 0.018
gi|22124298|ref|NP_667721.1| hypothetical protein y0383 [Yersini... 39 0.018
gi|50123105|ref|YP_052272.1| CyaY protein [Erwinia carotovora su... 39 0.030
gi|17547696|ref|NP_521098.1| PROBABLE CYAY PROTEIN [Ralstonia so... 38 0.051
gi|231927|sp|P30534|CYAY_YERIN CyaY protein >gnl|BL_ORD_ID|18044... 37 0.067
gi|16767214|ref|NP_462829.1| putative transport protein [Salmone... 36 0.15
gi|15804395|ref|NP_290435.1| orf, hypothetical protein [Escheric... 36 0.20
gi|37528459|ref|NP_931804.1| CyaY protein, which belongs to the ... 36 0.20
gi|28899760|ref|NP_799365.1| CyaY protein [Vibrio parahaemolytic... 35 0.26
gi|729251|sp|P40128|CYAY_ERWCH CyaY protein >gnl|BL_ORD_ID|25751... 35 0.26
gi|46226591|gb|EAK87579.1| frataxin like protein [Cryptosporidiu... 35 0.33
gi|50422959|ref|XP_460057.1| unnamed protein product [Debaryomyc... 35 0.33
gi|16762191|ref|NP_457808.1| CyaY protein [Salmonella enterica s... 35 0.33
gi|16131659|ref|NP_418251.1| orf, hypothetical protein; conserve... 35 0.33
gi|26250545|ref|NP_756585.1| CyaY protein [Escherichia coli CFT0... 35 0.44
gi|50755663|ref|XP_414842.1| PREDICTED: similar to KIAA1738 prot... 34 0.57
gi|46915020|emb|CAG21795.1| putative CyaY protein [Photobacteriu... 34 0.57
gi|4100063|gb|AAD00734.1| frataxin [Homo sapiens] 34 0.57
gi|24115099|ref|NP_709609.1| orf, conserved hypothetical protein... 33 0.97
gi|50757831|ref|XP_415667.1| PREDICTED: similar to uncharacteriz... 33 1.3
gi|31219007|ref|XP_316739.1| ENSANGP00000016100 [Anopheles gambi... 33 1.3
gi|48862581|ref|ZP_00316477.1| COG0642: Signal transduction hist... 33 1.7
gi|48826323|ref|ZP_00287533.1| COG1961: Site-specific recombinas... 33 1.7
gi|50307961|ref|XP_453979.1| unnamed protein product [Kluyveromy... 33 1.7
gi|45515206|ref|ZP_00166761.1| COG0642: Signal transduction hist... 32 2.2
gi|50085262|ref|YP_046772.1| hypothetical protein ACIAD2148 [Aci... 32 2.2
gi|7511905|pir||T13742 hypothetical protein 22E5.7 - fruit fly (... 32 3.7
gi|15617180|ref|NP_240393.1| CyaY protein [Buchnera aphidicola s... 32 3.7
gi|18543263|ref|NP_569973.1| CG4281-PA [Drosophila melanogaster]... 32 3.7
gi|23346525|ref|NP_694738.1| CD109 antigen; GPI-anchored alpha 2... 31 4.8
gi|2266656|emb|CAA74077.1| frataxin [Homo sapiens] >gnl|BL_ORD_I... 31 6.3
gi|29249782|gb|EAA41287.1| GLP_190_48722_47349 [Giardia lamblia ... 31 6.3
gi|47573681|ref|ZP_00243719.1| hypothetical protein Rgel01002239... 30 8.2
gi|7508383|pir||T25234 hypothetical protein T24D1.2 - Caenorhabd... 30 8.2
gi|27905005|ref|NP_778131.1| CyaY [Buchnera aphidicola (Baizongi... 30 8.2
gi|17509247|ref|NP_492632.1| putative nuclear protein family mem... 30 8.2
gi|45532165|ref|ZP_00183179.1| COG0751: Glycyl-tRNA synthetase, ... 30 8.2
>gi|17534607|ref|NP_495183.1| FRataxin Homolog (15.7 kD) (frh-1)
[Caenorhabditis elegans]
gi|9910696|sp|Q9TY03|FRDA_CAEEL Frataxin homolog
gi|7504816|pir||T34316 hypothetical protein F59G1.7 -
Caenorhabditis elegans
gi|13592434|gb|AAK31530.1| Hypothetical protein F59G1.7
[Caenorhabditis elegans]
gi|37542383|gb|AAL05950.1| frataxin [Caenorhabditis elegans]
Length = 136
Score = 236 bits (601), Expect = 1e-61
Identities = 119/136 (87%), Positives = 119/136 (87%)
Frame = +1
Query: 1 MLSTILXXXXXXXXXXXXXXXXXEYETAADSTLERLSDYFDQIADSFPVSEQFDVSHAMG 180
MLSTIL EYETAADSTLERLSDYFDQIADSFPVSEQFDVSHAMG
Sbjct: 1 MLSTILRNNFVRRSFSSRIFSQNEYETAADSTLERLSDYFDQIADSFPVSEQFDVSHAMG 60
Query: 181 VLTVNVSKSVGTYVINKQSPNKQIWLSSPMSGPKRYDLEEEGKWTYAHDGEQLDSLLNRE 360
VLTVNVSKSVGTYVINKQSPNKQIWLSSPMSGPKRYDLEEEGKWTYAHDGEQLDSLLNRE
Sbjct: 61 VLTVNVSKSVGTYVINKQSPNKQIWLSSPMSGPKRYDLEEEGKWTYAHDGEQLDSLLNRE 120
Query: 361 FRKILADDRIDFSRHV 408
FRKILADDRIDFSRHV
Sbjct: 121 FRKILADDRIDFSRHV 136