Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= H20J04_3
         (426 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17534721|ref|NP_494764.1| prefoldin (16.1 kD) (2E617) [Caenor...   241   2e-63
gi|39595088|emb|CAE60125.1| Hypothetical protein CBG03668 [Caeno...   204   4e-52
gi|49522656|gb|AAH74083.1| Unknown (protein for IMAGE:7037785) [...    87   6e-17
gi|5690431|gb|AAD47084.1| prefoldin subunit 2 [Homo sapiens]           87   6e-17
gi|28189659|dbj|BAC56444.1| similar to prefoldin subunit 2 [Bos ...    87   6e-17
gi|12408675|ref|NP_036526.2| prefoldin 2 [Homo sapiens] >gnl|BL_...    87   6e-17
gi|47210787|emb|CAF91097.1| unnamed protein product [Tetraodon n...    86   1e-16
gi|31981577|ref|NP_035200.2| prefoldin 2 [Mus musculus] >gnl|BL_...    86   2e-16
gi|3212116|emb|CAA76760.1| prefoldin subunit 2 [Mus musculus]          86   2e-16
gi|31215893|ref|XP_316121.1| ENSANGP00000020462 [Anopheles gambi...    78   4e-14
gi|24662461|ref|NP_729659.1| CG6302-PA [Drosophila melanogaster]...    76   2e-13
gi|7106852|gb|AAF36151.1| HSPC231 [Homo sapiens]                       72   2e-12
gi|46125421|ref|XP_387264.1| conserved hypothetical protein [Gib...    69   2e-11
gi|6855446|emb|CAB71282.1| prefoldin subunit [Leishmania major]        69   2e-11
gi|32422395|ref|XP_331641.1| hypothetical protein [Neurospora cr...    67   1e-10
gi|15228766|ref|NP_188887.1| prefoldin-related KE2 family protei...    66   2e-10
gi|29248515|gb|EAA40047.1| GLP_387_42629_42303 [Giardia lamblia ...    62   2e-09
gi|49076918|ref|XP_402382.1| hypothetical protein UM04767.1 [Ust...    61   4e-09
gi|49093418|ref|XP_408170.1| hypothetical protein AN4033.2 [Aspe...    55   2e-07
gi|50260474|gb|EAL23129.1| hypothetical protein CNBA4740 [Crypto...    55   4e-07
gi|50292883|ref|XP_448874.1| unnamed protein product [Candida gl...    52   3e-06
gi|6320834|ref|NP_010913.1| Prefoldin subunit 2; putative homolo...    51   4e-06
gi|45187870|ref|NP_984093.1| ADL004Wp [Eremothecium gossypii] >g...    49   3e-05
gi|38110253|gb|EAA56001.1| hypothetical protein MG01652.4 [Magna...    48   5e-05
gi|19113876|ref|NP_592964.1| putative GIM complex; prefoldin sub...    46   2e-04
gi|46435430|gb|EAK94811.1| hypothetical protein CaO19.2305 [Cand...    45   2e-04
gi|23509388|ref|NP_702055.1| hypothetical protein [Plasmodium fa...    44   0.001
gi|23481433|gb|EAA17712.1| probable prefoldin subunit 2 [Plasmod...    42   0.002
gi|27469122|ref|NP_765759.1| conserved hypothetical protein [Sta...    41   0.005
gi|15897632|ref|NP_342237.1| Hypothetical protein SSO0730 [Sulfo...    40   0.010
gi|50417032|ref|XP_457624.1| unnamed protein product [Debaryomyc...    39   0.023
gi|15789532|ref|NP_279356.1| Vng0234c [Halobacterium sp. NRC-1] ...    37   0.086
gi|8037933|gb|AAF71541.1| cystathionine beta-synthase [Leishmani...    37   0.11
gi|23489827|gb|EAA21743.1| GTPase of unknown function, putative ...    37   0.11
gi|46435677|gb|EAK95054.1| hypothetical protein CaO19.11591 [Can...    35   0.25
gi|15606308|ref|NP_213687.1| hypothetical protein aq_1006 [Aquif...    35   0.25
gi|45383139|ref|NP_989848.1| cohesin complex subunit [Gallus gal...    35   0.33
gi|38566257|gb|AAH62935.1| Chondroitin sulfate proteoglycan 6 [M...    34   0.56
gi|27805841|ref|NP_776720.1| chondroitin sulfate proteoglycan 6 ...    34   0.56
gi|13928790|ref|NP_113771.1| chondroitin sulfate proteoglycan 6;...    34   0.56
gi|29840551|ref|NP_829657.1| hypothetical protein [Chlamydophila...    34   0.56
gi|28958118|gb|AAH47324.1| Chondroitin sulfate proteoglycan 6 (b...    34   0.56
gi|4885399|ref|NP_005436.1| chondroitin sulfate proteoglycan 6 (...    34   0.56
gi|36031035|ref|NP_031816.2| chondroitin sulfate proteoglycan 6 ...    34   0.56
gi|42627759|tpe|CAD59554.1| TPA: SMC3 protein [Bos taurus]             34   0.56
gi|46438733|gb|EAK98059.1| hypothetical protein CaO19.12772 [Can...    34   0.73
gi|30249508|ref|NP_841578.1| conserved hypothetical protein [Nit...    34   0.73
gi|47937470|gb|AAH72043.1| LOC432330 protein [Xenopus laevis]          33   0.95
gi|28211163|ref|NP_782107.1| methyl-accepting chemotaxis-like pr...    33   0.95
gi|27263154|emb|CAD59446.1| structural maintenance of chromosome...    33   0.95
gi|15897827|ref|NP_342432.1| Hypothetical protein SSO0947 [Sulfo...    33   1.2
gi|15899766|ref|NP_344371.1| Hypothetical protein SSO3061 [Sulfo...    33   1.2
gi|29250049|gb|EAA41549.1| GLP_546_13955_10599 [Giardia lamblia ...    33   1.2
gi|22297672|ref|NP_680919.1| ORF_ID:tll0128~hypothetical protein...    33   1.2
gi|15605353|ref|NP_220139.1| CHLPN 76kDa Homolog [Chlamydia trac...    33   1.6
gi|46370922|gb|AAS90234.1| CHLPN 76 kD like-protein [Chlamydia t...    33   1.6
gi|46370926|gb|AAS90236.1| CHLPN 76 kD like-protein [Chlamydia t...    33   1.6
gi|23509096|ref|NP_701764.1| hypothetical protein [Plasmodium fa...    33   1.6
gi|45383263|ref|NP_989782.1| UNC5-like protein 3 [Gallus gallus]...    32   2.1
gi|29246650|gb|EAA38239.1| GLP_72_28964_21126 [Giardia lamblia A...    32   2.1
gi|50284899|ref|XP_444877.1| unnamed protein product [Candida gl...    32   2.1
gi|46431250|gb|EAK90848.1| hypothetical protein CaO19.2629 [Cand...    32   2.1
gi|39580315|emb|CAE56050.1| Hypothetical protein CBG23621 [Caeno...    32   2.1
gi|15606061|ref|NP_213438.1| chromosome assembly protein homolog...    32   2.1
gi|48859214|ref|ZP_00313152.1| COG0840: Methyl-accepting chemota...    32   2.8
gi|50121568|ref|YP_050735.1| seryl-tRNA synthetase [Erwinia caro...    32   2.8
gi|16933525|ref|NP_003719.2| unc5C; homolog of C. elegans transm...    32   2.8
gi|3789765|gb|AAC67491.1| transmembrane receptor UNC5C [Homo sap...    32   2.8
gi|15904033|ref|NP_359583.1| Hypothetical protein [Streptococcus...    32   2.8
gi|15237772|ref|NP_200696.1| hypothetical protein [Arabidopsis t...    32   2.8
gi|2854208|gb|AAC02621.1| miranda [Drosophila melanogaster]            32   2.8
gi|7511964|pir||T00029 Miranda protein - fruit fly (Drosophila m...    32   2.8
gi|38505837|ref|NP_942455.1| slr6012 [Synechocystis sp. PCC 6803...    32   2.8
gi|17137436|ref|NP_477292.1| CG12249-PB [Drosophila melanogaster...    32   2.8
gi|46105599|ref|XP_380558.1| hypothetical protein FG00382.1 [Gib...    32   2.8
gi|17137434|ref|NP_477291.1| CG12249-PA [Drosophila melanogaster...    32   2.8
gi|50307407|ref|XP_453682.1| unnamed protein product [Kluyveromy...    32   2.8
gi|27805181|emb|CAD58849.2| SMC3 protein [Takifugu rubripes]           32   2.8
gi|47214763|emb|CAG01298.1| unnamed protein product [Tetraodon n...    32   2.8
gi|31980916|ref|NP_061204.2| guanylate nucleotide binding protei...    32   2.8
gi|23508889|ref|NP_701557.1| hypothetical protein [Plasmodium fa...    32   3.6
gi|50749152|ref|XP_421507.1| PREDICTED: similar to stimulatory G...    32   3.6
gi|50748027|ref|XP_421078.1| PREDICTED: similar to golgi-associa...    32   3.6
gi|39653215|gb|AAR29265.1| pollen-specific lysine-rich protein S...    32   3.6
gi|15079014|ref|NP_149765.1| 302L [Invertebrate iridescent virus...    32   3.6
gi|23481838|gb|EAA17995.1| hypothetical protein [Plasmodium yoel...    32   3.6
gi|48102332|ref|XP_392766.1| similar to 309 kDa centrosomal prot...    32   3.6
gi|23483537|gb|EAA19173.1| hypothetical protein [Plasmodium yoel...    32   3.6
gi|20978622|sp|Q96YR5|RA50_SULTO DNA double-strand break repair ...    31   4.7
gi|7509482|pir||T26558 hypothetical protein Y24F12A.a - Caenorha...    31   4.7
gi|15901994|ref|NP_346598.1| conserved domain protein [Streptoco...    31   4.7
gi|45198658|ref|NP_985687.1| AFR140Cp [Eremothecium gossypii] >g...    31   4.7
gi|41222035|ref|XP_371874.1| similar to Matn2-prov protein [Homo...    31   4.7
gi|39593798|emb|CAE62091.1| Hypothetical protein CBG06117 [Caeno...    31   4.7
gi|17543028|ref|NP_502187.1| rag protein (4M368) [Caenorhabditis...    31   4.7
gi|50291017|ref|XP_447941.1| unnamed protein product [Candida gl...    31   4.7
gi|30020428|ref|NP_832059.1| Exonuclease SbcC [Bacillus cereus A...    31   4.7
gi|29248476|gb|EAA40009.1| GLP_572_37897_39453 [Giardia lamblia ...    31   4.7
gi|32455348|ref|NP_862359.1| unknown [Helicobacter pylori] >gnl|...    31   4.7
gi|29245534|gb|EAA37167.1| GLP_42_17299_17664 [Giardia lamblia A...    31   4.7
gi|45550695|ref|NP_649557.2| CG2919-PA [Drosophila melanogaster]...    31   4.7
gi|11499153|ref|NP_070387.1| chromosome segregation protein (smc...    31   4.7
gi|15922434|ref|NP_378103.1| 882aa long hypothetical purine NTPa...    31   4.7
gi|29245994|gb|EAA37608.1| GLP_448_12867_13895 [Giardia lamblia ...    31   4.7
gi|42658209|ref|XP_295195.4| similar to Matn2-prov protein [Homo...    31   4.7
gi|29826905|ref|NP_821539.1| putative IS4 family transposase [St...    31   6.1
gi|32450573|gb|AAH54173.1| Unknown (protein for IMAGE:6875131) [...    31   6.1
gi|41146959|ref|XP_030300.6| netrin receptor Unc5h1 [Homo sapiens]     31   6.1
gi|48857505|ref|ZP_00311503.1| COG3547: Transposase and inactiva...    31   6.1
gi|47550693|ref|NP_999854.1| chondroitin sulfate proteoglycan 6 ...    31   6.1
gi|22901943|gb|AAN10131.1| breast cancer 2 [Pan troglodytes]           31   6.1
gi|46370912|gb|AAS90229.1| CHLPN 76 kD like-protein [Chlamydia t...    31   6.1
gi|37725926|gb|AAO38041.1| reticulocyte binding-like protein 4 [...    31   6.1
gi|27467337|ref|NP_763974.1| pyrimidine nucleoside transporter [...    31   6.1
gi|34784159|gb|AAH58084.1| Unc5a protein [Mus musculus]                31   6.1
gi|16116616|emb|CAA98995.2| 214K23.1 (breast cancer 2, early ons...    31   6.1
gi|14424438|sp|P51587|BRC2_HUMAN Breast cancer type 2 susceptibi...    31   6.1
gi|4502451|ref|NP_000050.1| breast cancer 2, early onset; Fancon...    31   6.1
gi|37675289|gb|AAQ97181.1| breast cancer 2, early onset [Homo sa...    31   6.1
gi|1177438|emb|CAA64484.1| brca2 [Homo sapiens]                        31   6.1
gi|15645880|ref|NP_208058.1| NADH-ubiquinone oxidoreductase, NQO...    31   6.1
gi|46370914|gb|AAS90230.1| CHLPN 76 kD like-protein [Chlamydia t...    31   6.1
gi|23510096|ref|NP_702762.1| Hypothetical GTP-binding protein [P...    31   6.1
gi|11527033|gb|AAG36875.1| golgin-80 [Manduca sexta]                   31   6.1
gi|40226528|gb|AAH09333.2| UNC5A protein [Homo sapiens]                31   6.1
gi|46370916|gb|AAS90231.1| CHLPN 76 kD like-protein [Chlamydia t...    31   6.1
gi|23346571|ref|NP_694771.1| netrin receptor Unc5h1; unc5 homolo...    31   6.1
gi|11559980|ref|NP_071542.1| transmembrane receptor Unc5H1 [Ratt...    31   6.1
gi|13278154|gb|AAH03921.1| Rabep1 protein [Mus musculus]               30   8.0
gi|14600971|ref|NP_147497.1| hypothetical protein APE0790 [Aerop...    30   8.0
gi|49354323|gb|AAT65051.1| Mem [Bacteriophage phiMFV1]                 30   8.0
gi|50058561|ref|YP_044803.1| Mem [Bacteriophage phiMFV1] >gnl|BL...    30   8.0
gi|9279697|dbj|BAB01254.1| centromere protein [Arabidopsis thali...    30   8.0
gi|48859547|ref|ZP_00313480.1| COG0419: ATPase involved in DNA r...    30   8.0
gi|41387142|ref|NP_957101.1| hypothetical protein MGC73369 [Dani...    30   8.0
gi|13241614|gb|AAK16397.1| cystathionine beta-synthase 1 [Trypan...    30   8.0
gi|13241624|gb|AAK16402.1| cystathionine beta-synthase 6 [Trypan...    30   8.0
gi|39997311|ref|NP_953262.1| GAF domain protein [Geobacter sulfu...    30   8.0
gi|46103667|ref|XP_380276.1| hypothetical protein FG00100.1 [Gib...    30   8.0
gi|47186413|emb|CAF93529.1| unnamed protein product [Tetraodon n...    30   8.0
gi|15228859|ref|NP_188918.1| kinase interacting family protein [...    30   8.0
gi|46047435|ref|NP_996769.1| sarcoma antigen NY-SAR-41 [Homo sap...    30   8.0
gi|31203491|ref|XP_310694.1| ENSANGP00000020013 [Anopheles gambi...    30   8.0
gi|24214004|ref|NP_711485.1| conserved hypothetical protein [Lep...    30   8.0
gi|50545793|ref|XP_500435.1| hypothetical protein [Yarrowia lipo...    30   8.0
gi|45658261|ref|YP_002347.1| conserved hypothetical protein [Lep...    30   8.0
gi|19705415|ref|NP_602910.1| DNA gyrase subunit A [Fusobacterium...    30   8.0
gi|34763291|ref|ZP_00144249.1| DNA gyrase subunit A [Fusobacteri...    30   8.0
gi|15223710|ref|NP_175518.1| basic helix-loop-helix (bHLH) famil...    30   8.0


>gi|17534721|ref|NP_494764.1| prefoldin (16.1 kD) (2E617)
           [Caenorhabditis elegans]
 gi|12230466|sp|Q9N5M2|PFD2_CAEEL Probable prefoldin subunit 2
 gi|7206732|gb|AAF39891.1| Hypothetical protein H20J04.5
           [Caenorhabditis elegans]
          Length = 141

 Score =  241 bits (615), Expect = 2e-63
 Identities = 126/141 (89%), Positives = 126/141 (89%)
 Frame = +1

Query: 1   MSXXXXXXXXXXXXXXXRKVVEKFKALRDQQQDIAAEVTRIEEERREFGRVLEVIKDLEP 180
           MS               RKVVEKFKALRDQQQDIAAEVTRIEEERREFGRVLEVIKDLEP
Sbjct: 1   MSAAQTAAATPAEQEEQRKVVEKFKALRDQQQDIAAEVTRIEEERREFGRVLEVIKDLEP 60

Query: 181 DQKCFRLISDTLVEYTVKDVIPDLQNNIANLTIVSKQLNDQLVEKGKELNTHKTTHNIRL 360
           DQKCFRLISDTLVEYTVKDVIPDLQNNIANLTIVSKQLNDQLVEKGKELNTHKTTHNIRL
Sbjct: 61  DQKCFRLISDTLVEYTVKDVIPDLQNNIANLTIVSKQLNDQLVEKGKELNTHKTTHNIRL 120

Query: 361 LTEKESAELRKAEALGQLPKA 423
           LTEKESAELRKAEALGQLPKA
Sbjct: 121 LTEKESAELRKAEALGQLPKA 141




[DB home][top]