Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= H20J04_3
(426 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17534721|ref|NP_494764.1| prefoldin (16.1 kD) (2E617) [Caenor... 241 2e-63
gi|39595088|emb|CAE60125.1| Hypothetical protein CBG03668 [Caeno... 204 4e-52
gi|49522656|gb|AAH74083.1| Unknown (protein for IMAGE:7037785) [... 87 6e-17
gi|5690431|gb|AAD47084.1| prefoldin subunit 2 [Homo sapiens] 87 6e-17
gi|28189659|dbj|BAC56444.1| similar to prefoldin subunit 2 [Bos ... 87 6e-17
gi|12408675|ref|NP_036526.2| prefoldin 2 [Homo sapiens] >gnl|BL_... 87 6e-17
gi|47210787|emb|CAF91097.1| unnamed protein product [Tetraodon n... 86 1e-16
gi|31981577|ref|NP_035200.2| prefoldin 2 [Mus musculus] >gnl|BL_... 86 2e-16
gi|3212116|emb|CAA76760.1| prefoldin subunit 2 [Mus musculus] 86 2e-16
gi|31215893|ref|XP_316121.1| ENSANGP00000020462 [Anopheles gambi... 78 4e-14
gi|24662461|ref|NP_729659.1| CG6302-PA [Drosophila melanogaster]... 76 2e-13
gi|7106852|gb|AAF36151.1| HSPC231 [Homo sapiens] 72 2e-12
gi|46125421|ref|XP_387264.1| conserved hypothetical protein [Gib... 69 2e-11
gi|6855446|emb|CAB71282.1| prefoldin subunit [Leishmania major] 69 2e-11
gi|32422395|ref|XP_331641.1| hypothetical protein [Neurospora cr... 67 1e-10
gi|15228766|ref|NP_188887.1| prefoldin-related KE2 family protei... 66 2e-10
gi|29248515|gb|EAA40047.1| GLP_387_42629_42303 [Giardia lamblia ... 62 2e-09
gi|49076918|ref|XP_402382.1| hypothetical protein UM04767.1 [Ust... 61 4e-09
gi|49093418|ref|XP_408170.1| hypothetical protein AN4033.2 [Aspe... 55 2e-07
gi|50260474|gb|EAL23129.1| hypothetical protein CNBA4740 [Crypto... 55 4e-07
gi|50292883|ref|XP_448874.1| unnamed protein product [Candida gl... 52 3e-06
gi|6320834|ref|NP_010913.1| Prefoldin subunit 2; putative homolo... 51 4e-06
gi|45187870|ref|NP_984093.1| ADL004Wp [Eremothecium gossypii] >g... 49 3e-05
gi|38110253|gb|EAA56001.1| hypothetical protein MG01652.4 [Magna... 48 5e-05
gi|19113876|ref|NP_592964.1| putative GIM complex; prefoldin sub... 46 2e-04
gi|46435430|gb|EAK94811.1| hypothetical protein CaO19.2305 [Cand... 45 2e-04
gi|23509388|ref|NP_702055.1| hypothetical protein [Plasmodium fa... 44 0.001
gi|23481433|gb|EAA17712.1| probable prefoldin subunit 2 [Plasmod... 42 0.002
gi|27469122|ref|NP_765759.1| conserved hypothetical protein [Sta... 41 0.005
gi|15897632|ref|NP_342237.1| Hypothetical protein SSO0730 [Sulfo... 40 0.010
gi|50417032|ref|XP_457624.1| unnamed protein product [Debaryomyc... 39 0.023
gi|15789532|ref|NP_279356.1| Vng0234c [Halobacterium sp. NRC-1] ... 37 0.086
gi|8037933|gb|AAF71541.1| cystathionine beta-synthase [Leishmani... 37 0.11
gi|23489827|gb|EAA21743.1| GTPase of unknown function, putative ... 37 0.11
gi|46435677|gb|EAK95054.1| hypothetical protein CaO19.11591 [Can... 35 0.25
gi|15606308|ref|NP_213687.1| hypothetical protein aq_1006 [Aquif... 35 0.25
gi|45383139|ref|NP_989848.1| cohesin complex subunit [Gallus gal... 35 0.33
gi|38566257|gb|AAH62935.1| Chondroitin sulfate proteoglycan 6 [M... 34 0.56
gi|27805841|ref|NP_776720.1| chondroitin sulfate proteoglycan 6 ... 34 0.56
gi|13928790|ref|NP_113771.1| chondroitin sulfate proteoglycan 6;... 34 0.56
gi|29840551|ref|NP_829657.1| hypothetical protein [Chlamydophila... 34 0.56
gi|28958118|gb|AAH47324.1| Chondroitin sulfate proteoglycan 6 (b... 34 0.56
gi|4885399|ref|NP_005436.1| chondroitin sulfate proteoglycan 6 (... 34 0.56
gi|36031035|ref|NP_031816.2| chondroitin sulfate proteoglycan 6 ... 34 0.56
gi|42627759|tpe|CAD59554.1| TPA: SMC3 protein [Bos taurus] 34 0.56
gi|46438733|gb|EAK98059.1| hypothetical protein CaO19.12772 [Can... 34 0.73
gi|30249508|ref|NP_841578.1| conserved hypothetical protein [Nit... 34 0.73
gi|47937470|gb|AAH72043.1| LOC432330 protein [Xenopus laevis] 33 0.95
gi|28211163|ref|NP_782107.1| methyl-accepting chemotaxis-like pr... 33 0.95
gi|27263154|emb|CAD59446.1| structural maintenance of chromosome... 33 0.95
gi|15897827|ref|NP_342432.1| Hypothetical protein SSO0947 [Sulfo... 33 1.2
gi|15899766|ref|NP_344371.1| Hypothetical protein SSO3061 [Sulfo... 33 1.2
gi|29250049|gb|EAA41549.1| GLP_546_13955_10599 [Giardia lamblia ... 33 1.2
gi|22297672|ref|NP_680919.1| ORF_ID:tll0128~hypothetical protein... 33 1.2
gi|15605353|ref|NP_220139.1| CHLPN 76kDa Homolog [Chlamydia trac... 33 1.6
gi|46370922|gb|AAS90234.1| CHLPN 76 kD like-protein [Chlamydia t... 33 1.6
gi|46370926|gb|AAS90236.1| CHLPN 76 kD like-protein [Chlamydia t... 33 1.6
gi|23509096|ref|NP_701764.1| hypothetical protein [Plasmodium fa... 33 1.6
gi|45383263|ref|NP_989782.1| UNC5-like protein 3 [Gallus gallus]... 32 2.1
gi|29246650|gb|EAA38239.1| GLP_72_28964_21126 [Giardia lamblia A... 32 2.1
gi|50284899|ref|XP_444877.1| unnamed protein product [Candida gl... 32 2.1
gi|46431250|gb|EAK90848.1| hypothetical protein CaO19.2629 [Cand... 32 2.1
gi|39580315|emb|CAE56050.1| Hypothetical protein CBG23621 [Caeno... 32 2.1
gi|15606061|ref|NP_213438.1| chromosome assembly protein homolog... 32 2.1
gi|48859214|ref|ZP_00313152.1| COG0840: Methyl-accepting chemota... 32 2.8
gi|50121568|ref|YP_050735.1| seryl-tRNA synthetase [Erwinia caro... 32 2.8
gi|16933525|ref|NP_003719.2| unc5C; homolog of C. elegans transm... 32 2.8
gi|3789765|gb|AAC67491.1| transmembrane receptor UNC5C [Homo sap... 32 2.8
gi|15904033|ref|NP_359583.1| Hypothetical protein [Streptococcus... 32 2.8
gi|15237772|ref|NP_200696.1| hypothetical protein [Arabidopsis t... 32 2.8
gi|2854208|gb|AAC02621.1| miranda [Drosophila melanogaster] 32 2.8
gi|7511964|pir||T00029 Miranda protein - fruit fly (Drosophila m... 32 2.8
gi|38505837|ref|NP_942455.1| slr6012 [Synechocystis sp. PCC 6803... 32 2.8
gi|17137436|ref|NP_477292.1| CG12249-PB [Drosophila melanogaster... 32 2.8
gi|46105599|ref|XP_380558.1| hypothetical protein FG00382.1 [Gib... 32 2.8
gi|17137434|ref|NP_477291.1| CG12249-PA [Drosophila melanogaster... 32 2.8
gi|50307407|ref|XP_453682.1| unnamed protein product [Kluyveromy... 32 2.8
gi|27805181|emb|CAD58849.2| SMC3 protein [Takifugu rubripes] 32 2.8
gi|47214763|emb|CAG01298.1| unnamed protein product [Tetraodon n... 32 2.8
gi|31980916|ref|NP_061204.2| guanylate nucleotide binding protei... 32 2.8
gi|23508889|ref|NP_701557.1| hypothetical protein [Plasmodium fa... 32 3.6
gi|50749152|ref|XP_421507.1| PREDICTED: similar to stimulatory G... 32 3.6
gi|50748027|ref|XP_421078.1| PREDICTED: similar to golgi-associa... 32 3.6
gi|39653215|gb|AAR29265.1| pollen-specific lysine-rich protein S... 32 3.6
gi|15079014|ref|NP_149765.1| 302L [Invertebrate iridescent virus... 32 3.6
gi|23481838|gb|EAA17995.1| hypothetical protein [Plasmodium yoel... 32 3.6
gi|48102332|ref|XP_392766.1| similar to 309 kDa centrosomal prot... 32 3.6
gi|23483537|gb|EAA19173.1| hypothetical protein [Plasmodium yoel... 32 3.6
gi|20978622|sp|Q96YR5|RA50_SULTO DNA double-strand break repair ... 31 4.7
gi|7509482|pir||T26558 hypothetical protein Y24F12A.a - Caenorha... 31 4.7
gi|15901994|ref|NP_346598.1| conserved domain protein [Streptoco... 31 4.7
gi|45198658|ref|NP_985687.1| AFR140Cp [Eremothecium gossypii] >g... 31 4.7
gi|41222035|ref|XP_371874.1| similar to Matn2-prov protein [Homo... 31 4.7
gi|39593798|emb|CAE62091.1| Hypothetical protein CBG06117 [Caeno... 31 4.7
gi|17543028|ref|NP_502187.1| rag protein (4M368) [Caenorhabditis... 31 4.7
gi|50291017|ref|XP_447941.1| unnamed protein product [Candida gl... 31 4.7
gi|30020428|ref|NP_832059.1| Exonuclease SbcC [Bacillus cereus A... 31 4.7
gi|29248476|gb|EAA40009.1| GLP_572_37897_39453 [Giardia lamblia ... 31 4.7
gi|32455348|ref|NP_862359.1| unknown [Helicobacter pylori] >gnl|... 31 4.7
gi|29245534|gb|EAA37167.1| GLP_42_17299_17664 [Giardia lamblia A... 31 4.7
gi|45550695|ref|NP_649557.2| CG2919-PA [Drosophila melanogaster]... 31 4.7
gi|11499153|ref|NP_070387.1| chromosome segregation protein (smc... 31 4.7
gi|15922434|ref|NP_378103.1| 882aa long hypothetical purine NTPa... 31 4.7
gi|29245994|gb|EAA37608.1| GLP_448_12867_13895 [Giardia lamblia ... 31 4.7
gi|42658209|ref|XP_295195.4| similar to Matn2-prov protein [Homo... 31 4.7
gi|29826905|ref|NP_821539.1| putative IS4 family transposase [St... 31 6.1
gi|32450573|gb|AAH54173.1| Unknown (protein for IMAGE:6875131) [... 31 6.1
gi|41146959|ref|XP_030300.6| netrin receptor Unc5h1 [Homo sapiens] 31 6.1
gi|48857505|ref|ZP_00311503.1| COG3547: Transposase and inactiva... 31 6.1
gi|47550693|ref|NP_999854.1| chondroitin sulfate proteoglycan 6 ... 31 6.1
gi|22901943|gb|AAN10131.1| breast cancer 2 [Pan troglodytes] 31 6.1
gi|46370912|gb|AAS90229.1| CHLPN 76 kD like-protein [Chlamydia t... 31 6.1
gi|37725926|gb|AAO38041.1| reticulocyte binding-like protein 4 [... 31 6.1
gi|27467337|ref|NP_763974.1| pyrimidine nucleoside transporter [... 31 6.1
gi|34784159|gb|AAH58084.1| Unc5a protein [Mus musculus] 31 6.1
gi|16116616|emb|CAA98995.2| 214K23.1 (breast cancer 2, early ons... 31 6.1
gi|14424438|sp|P51587|BRC2_HUMAN Breast cancer type 2 susceptibi... 31 6.1
gi|4502451|ref|NP_000050.1| breast cancer 2, early onset; Fancon... 31 6.1
gi|37675289|gb|AAQ97181.1| breast cancer 2, early onset [Homo sa... 31 6.1
gi|1177438|emb|CAA64484.1| brca2 [Homo sapiens] 31 6.1
gi|15645880|ref|NP_208058.1| NADH-ubiquinone oxidoreductase, NQO... 31 6.1
gi|46370914|gb|AAS90230.1| CHLPN 76 kD like-protein [Chlamydia t... 31 6.1
gi|23510096|ref|NP_702762.1| Hypothetical GTP-binding protein [P... 31 6.1
gi|11527033|gb|AAG36875.1| golgin-80 [Manduca sexta] 31 6.1
gi|40226528|gb|AAH09333.2| UNC5A protein [Homo sapiens] 31 6.1
gi|46370916|gb|AAS90231.1| CHLPN 76 kD like-protein [Chlamydia t... 31 6.1
gi|23346571|ref|NP_694771.1| netrin receptor Unc5h1; unc5 homolo... 31 6.1
gi|11559980|ref|NP_071542.1| transmembrane receptor Unc5H1 [Ratt... 31 6.1
gi|13278154|gb|AAH03921.1| Rabep1 protein [Mus musculus] 30 8.0
gi|14600971|ref|NP_147497.1| hypothetical protein APE0790 [Aerop... 30 8.0
gi|49354323|gb|AAT65051.1| Mem [Bacteriophage phiMFV1] 30 8.0
gi|50058561|ref|YP_044803.1| Mem [Bacteriophage phiMFV1] >gnl|BL... 30 8.0
gi|9279697|dbj|BAB01254.1| centromere protein [Arabidopsis thali... 30 8.0
gi|48859547|ref|ZP_00313480.1| COG0419: ATPase involved in DNA r... 30 8.0
gi|41387142|ref|NP_957101.1| hypothetical protein MGC73369 [Dani... 30 8.0
gi|13241614|gb|AAK16397.1| cystathionine beta-synthase 1 [Trypan... 30 8.0
gi|13241624|gb|AAK16402.1| cystathionine beta-synthase 6 [Trypan... 30 8.0
gi|39997311|ref|NP_953262.1| GAF domain protein [Geobacter sulfu... 30 8.0
gi|46103667|ref|XP_380276.1| hypothetical protein FG00100.1 [Gib... 30 8.0
gi|47186413|emb|CAF93529.1| unnamed protein product [Tetraodon n... 30 8.0
gi|15228859|ref|NP_188918.1| kinase interacting family protein [... 30 8.0
gi|46047435|ref|NP_996769.1| sarcoma antigen NY-SAR-41 [Homo sap... 30 8.0
gi|31203491|ref|XP_310694.1| ENSANGP00000020013 [Anopheles gambi... 30 8.0
gi|24214004|ref|NP_711485.1| conserved hypothetical protein [Lep... 30 8.0
gi|50545793|ref|XP_500435.1| hypothetical protein [Yarrowia lipo... 30 8.0
gi|45658261|ref|YP_002347.1| conserved hypothetical protein [Lep... 30 8.0
gi|19705415|ref|NP_602910.1| DNA gyrase subunit A [Fusobacterium... 30 8.0
gi|34763291|ref|ZP_00144249.1| DNA gyrase subunit A [Fusobacteri... 30 8.0
gi|15223710|ref|NP_175518.1| basic helix-loop-helix (bHLH) famil... 30 8.0
>gi|17534721|ref|NP_494764.1| prefoldin (16.1 kD) (2E617)
[Caenorhabditis elegans]
gi|12230466|sp|Q9N5M2|PFD2_CAEEL Probable prefoldin subunit 2
gi|7206732|gb|AAF39891.1| Hypothetical protein H20J04.5
[Caenorhabditis elegans]
Length = 141
Score = 241 bits (615), Expect = 2e-63
Identities = 126/141 (89%), Positives = 126/141 (89%)
Frame = +1
Query: 1 MSXXXXXXXXXXXXXXXRKVVEKFKALRDQQQDIAAEVTRIEEERREFGRVLEVIKDLEP 180
MS RKVVEKFKALRDQQQDIAAEVTRIEEERREFGRVLEVIKDLEP
Sbjct: 1 MSAAQTAAATPAEQEEQRKVVEKFKALRDQQQDIAAEVTRIEEERREFGRVLEVIKDLEP 60
Query: 181 DQKCFRLISDTLVEYTVKDVIPDLQNNIANLTIVSKQLNDQLVEKGKELNTHKTTHNIRL 360
DQKCFRLISDTLVEYTVKDVIPDLQNNIANLTIVSKQLNDQLVEKGKELNTHKTTHNIRL
Sbjct: 61 DQKCFRLISDTLVEYTVKDVIPDLQNNIANLTIVSKQLNDQLVEKGKELNTHKTTHNIRL 120
Query: 361 LTEKESAELRKAEALGQLPKA 423
LTEKESAELRKAEALGQLPKA
Sbjct: 121 LTEKESAELRKAEALGQLPKA 141