Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= K02B12_8
         (1272 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17508013|ref|NP_492310.1| ADP-ribosylation factor GTPase acti...   673   0.0
gi|39595608|emb|CAE67110.1| Hypothetical protein CBG12524 [Caeno...   580   e-164
gi|8922652|ref|NP_060679.1| ADP-ribosylation factor GTPase activ...   252   2e-65
gi|26326517|dbj|BAC27002.1| unnamed protein product [Mus musculus]    251   3e-65
gi|50758783|ref|XP_417415.1| PREDICTED: similar to ADP-ribosylat...   250   4e-65
gi|31542139|ref|NP_665703.2| ADP-ribosylation factor GTPase acti...   249   7e-65
gi|21489979|ref|NP_659558.1| ADP-ribosylation factor 1 GTPase ac...   249   1e-64
gi|37604182|gb|AAH59817.1| Arfgap1 protein [Mus musculus]             248   2e-64
gi|45708401|gb|AAH06085.1| ARFGAP1 protein [Homo sapiens] >gnl|B...   248   2e-64
gi|27923732|sp|Q9EPJ9|ARG1_MOUSE ADP-ribosylation factor GTPase ...   246   8e-64
gi|47477812|gb|AAH70895.1| Arfgap1 protein [Rattus norvegicus]        244   2e-63
gi|28416436|ref|NP_783202.1| ADP-ribosylation factor GTPase acti...   244   2e-63
gi|50415496|gb|AAH78102.1| Unknown (protein for MGC:83573) [Xeno...   244   4e-63
gi|47227290|emb|CAF96839.1| unnamed protein product [Tetraodon n...   236   7e-61
gi|24663283|ref|NP_524040.2| CG4237-PA [Drosophila melanogaster]...   202   1e-50
gi|2286211|gb|AAB64300.1| putative ARF1 GTPase activating protei...   201   2e-50
gi|31217790|ref|XP_316504.1| ENSANGP00000004294 [Anopheles gambi...   198   3e-49
gi|48099874|ref|XP_394952.1| similar to CG4237-PA [Apis mellifera]    196   1e-48
gi|50256126|gb|EAL18853.1| hypothetical protein CNBI1140 [Crypto...   146   1e-33
gi|14041841|dbj|BAB55009.1| unnamed protein product [Homo sapiens]    143   8e-33
gi|15224315|ref|NP_181291.1| arabidopsis pde1 suppressor 1 prote...   134   5e-30
gi|15231865|ref|NP_190939.1| ARF GAP-like zinc finger-containing...   132   1e-29
gi|10441356|gb|AAG17006.1| ARF GAP-like zinc finger-containing p...   132   1e-29
gi|45185066|ref|NP_982783.1| ABL164Cp [Eremothecium gossypii] >g...   125   2e-27
gi|19075686|ref|NP_588186.1| zinc finger protein, gcs1 homolog, ...   124   4e-27
gi|50307815|ref|XP_453901.1| unnamed protein product [Kluyveromy...   122   2e-26
gi|32415924|ref|XP_328440.1| hypothetical protein [Neurospora cr...   121   3e-26
gi|50288337|ref|XP_446597.1| unnamed protein product [Candida gl...   120   5e-26
gi|50547821|ref|XP_501380.1| hypothetical protein [Yarrowia lipo...   120   7e-26
gi|42557538|emb|CAE84440.1| putative Gcs1 protein [Kluyveromyces...   119   1e-25
gi|46435254|gb|EAK94640.1| hypothetical protein CaO19.11167 [Can...   119   2e-25
gi|46435289|gb|EAK94674.1| hypothetical protein CaO19.3683 [Cand...   119   2e-25
gi|50418377|ref|XP_457776.1| unnamed protein product [Debaryomyc...   118   3e-25
gi|38110364|gb|EAA56094.1| hypothetical protein MG01745.4 [Magna...   115   2e-24
gi|45387621|ref|NP_991160.1| ADP-ribosylation factor GTPase acti...   110   7e-23
gi|45709895|gb|AAH67611.1| Zgc:85765 protein [Danio rerio]            110   7e-23
gi|6319975|ref|NP_010055.1| Zn-finger-containing protein that fu...   110   9e-23
gi|37537094|ref|NP_922849.1| unknown protein [Oryza sativa (japo...   110   9e-23
gi|18414983|ref|NP_567543.1| human Rev interacting-like family p...   109   1e-22
gi|13430530|gb|AAK25887.1| unknown protein [Arabidopsis thaliana]     109   1e-22
gi|7487780|pir||T05075 hypothetical protein T6K21.70 - Arabidops...   109   1e-22
gi|15237500|ref|NP_199487.1| human Rev interacting-like family p...   109   2e-22
gi|18403775|ref|NP_565801.1| human Rev interacting-like family p...   108   4e-22
gi|42571059|ref|NP_973603.1| human Rev interacting-like family p...   108   4e-22
gi|49089254|ref|XP_406359.1| hypothetical protein AN2222.2 [Aspe...   106   1e-21
gi|29126345|gb|AAO66537.1| putative zinc finger protein [Oryza s...   106   1e-21
gi|24668642|ref|NP_649409.1| CG6838-PA [Drosophila melanogaster]...   105   2e-21
gi|30841021|ref|NP_079721.2| ADP-ribosylation factor GTPase acti...   105   2e-21
gi|21263413|sp|Q9D8S3|ARG3_MOUSE ADP-ribosylation factor GTPase-...   105   2e-21
gi|26344620|dbj|BAC35959.1| unnamed protein product [Mus musculu...   105   2e-21
gi|47216383|emb|CAG02441.1| unnamed protein product [Tetraodon n...   105   3e-21
gi|31213355|ref|XP_315621.1| ENSANGP00000007262 [Anopheles gambi...   103   9e-21
gi|21263420|sp|Q9NP61|ARG3_HUMAN ADP-ribosylation factor GTPase-...   103   1e-20
gi|20070255|ref|NP_055385.2| ADP-ribosylation factor GTPase acti...   103   1e-20
gi|31543983|ref|NP_115765.2| zinc finger protein 289, ID1 regula...   102   1e-20
gi|21739968|emb|CAD39004.1| hypothetical protein [Homo sapiens]       102   1e-20
gi|39596875|emb|CAE59102.1| Hypothetical protein CBG02397 [Caeno...   102   2e-20
gi|29841278|gb|AAP06310.1| similar to GenBank Accession Number B...   102   2e-20
gi|34856538|ref|XP_342463.1| similar to zinc finger protein 289 ...   102   3e-20
gi|13529563|gb|AAH05495.1| Zinc finger protein 289 [Mus musculus]     101   4e-20
gi|12963847|ref|NP_076343.1| zinc finger protein 289 [Mus muscul...   101   4e-20
gi|12844436|dbj|BAB26362.1| unnamed protein product [Mus musculus]    101   4e-20
gi|7498564|pir||T15963 hypothetical protein F07F6.4 - Caenorhabd...   100   6e-20
gi|25153991|ref|NP_495029.2| zinc finger protein 289 (57.9 kD) (...   100   6e-20
gi|50549563|ref|XP_502252.1| hypothetical protein [Yarrowia lipo...   100   7e-20
gi|46227983|gb|EAK88903.1| ARF GAP-like zinc finger-containing p...   100   7e-20
gi|14042190|dbj|BAB55144.1| unnamed protein product [Homo sapiens]    100   1e-19
gi|27695479|gb|AAH41750.1| Arfgap3-prov protein [Xenopus laevis]      100   1e-19
gi|50748115|ref|XP_421112.1| PREDICTED: similar to zinc finger p...   100   1e-19
gi|38085091|ref|XP_132765.2| similar to zinc finger protein 289 ...   100   1e-19
gi|50255931|gb|EAL18661.1| hypothetical protein CNBI3610 [Crypto...    99   3e-19
gi|23478539|gb|EAA15599.1| ADP-ribosylation factor GTPase-activa...    97   8e-19
gi|3676478|gb|AAC61985.1| ADP-ribosylation factor GTPase-activat...    97   1e-18
gi|48109992|ref|XP_393119.1| similar to ENSANGP00000007262 [Apis...    97   1e-18
gi|11071796|emb|CAC14640.1| ArfGap-like zinc finger protein [Lei...    95   4e-18
gi|46136393|ref|XP_389888.1| hypothetical protein FG09712.1 [Gib...    94   5e-18
gi|50418851|ref|XP_457946.1| unnamed protein product [Debaryomyc...    93   1e-17
gi|23509120|ref|NP_701788.1| ADP-ribosylation factor GTPase-acti...    93   2e-17
gi|38110043|gb|EAA55821.1| hypothetical protein MG01472.4 [Magna...    93   2e-17
gi|28850371|gb|AAM08466.2| similar to Plasmodium falciparum (iso...    92   2e-17
gi|32420969|ref|XP_330928.1| hypothetical protein [Neurospora cr...    92   3e-17
gi|9294154|dbj|BAB02056.1| unnamed protein product [Arabidopsis ...    92   3e-17
gi|29245791|gb|EAA37412.1| GLP_383_11014_11505 [Giardia lamblia ...    91   6e-17
gi|15229090|ref|NP_188393.1| human Rev interacting-like family p...    91   6e-17
gi|23478251|gb|EAA15387.1| zinc finger protein Glo3-like, putati...    90   1e-16
gi|46439448|gb|EAK98766.1| hypothetical protein CaO19.12900 [Can...    90   1e-16
gi|19074855|ref|NP_586361.1| ZINC FINGER PROTEIN [Encephalitozoo...    90   1e-16
gi|49097420|ref|XP_410170.1| hypothetical protein AN6033.2 [Aspe...    89   2e-16
gi|45200818|ref|NP_986388.1| AGL279Cp [Eremothecium gossypii] >g...    89   2e-16
gi|510449|emb|CAA56046.1| GLO3 [Saccharomyces cerevisiae]              89   2e-16
gi|6320969|ref|NP_011048.1| Zinc-finger-containing protein with ...    89   2e-16
gi|49067699|ref|XP_398139.1| hypothetical protein UM00524.1 [Ust...    89   2e-16
gi|28829090|gb|AAO51654.1| similar to Homo sapiens (Human). KIAA...    88   4e-16
gi|50288193|ref|XP_446525.1| unnamed protein product [Candida gl...    87   8e-16
gi|172687|gb|AAA62404.1| SPX18                                         87   1e-15
gi|23612959|ref|NP_704498.1| hypothetical protein [Plasmodium fa...    86   1e-15
gi|19115755|ref|NP_594843.1| GCS1/GLO3/SPS18 family zinc finger ...    86   1e-15
gi|39591833|emb|CAE71411.1| Hypothetical protein CBG18321 [Caeno...    86   2e-15
gi|34898734|ref|NP_910713.1| contains ESTs C28562(C61610),C25917...    86   2e-15
gi|6324125|ref|NP_014195.1| sporulation-specific protein; Sps18p...    86   2e-15
gi|49257975|gb|AAH74142.1| Unknown (protein for MGC:81879) [Xeno...    86   2e-15
gi|21618169|gb|AAM67219.1| ARF GAP-like zinc finger-containing p...    86   2e-15
gi|47937993|gb|AAH71454.1| Unknown (protein for IMAGE:6900493) [...    86   2e-15
gi|10441352|gb|AAG17004.1| ARF GAP-like zinc finger-containing p...    86   2e-15
gi|18423615|ref|NP_568807.1| ARF GAP-like zinc finger-containing...    86   2e-15
gi|50308505|ref|XP_454255.1| unnamed protein product [Kluyveromy...    86   2e-15
gi|47213547|emb|CAG13268.1| unnamed protein product [Tetraodon n...    85   3e-15
gi|49116707|gb|AAH73437.1| Unknown (protein for IMAGE:5516053) [...    85   4e-15
gi|28077013|ref|NP_082810.1| stromal membrane-associated protein...    84   5e-15
gi|21264558|ref|NP_068759.2| stromal membrane-associated protein...    84   7e-15
gi|10435055|dbj|BAB14473.1| unnamed protein product [Homo sapiens]     84   7e-15
gi|46227185|gb|EAK88135.1| arfgap'arfgap like finger domain cont...    84   7e-15
gi|34189699|gb|AAH08672.1| SMAP1 protein [Homo sapiens]                84   7e-15
gi|17555530|ref|NP_499364.1| ARF -containing protein (51.9 kD) (...    84   9e-15
gi|13561010|emb|CAC36277.1| bA160A9.3.1 (novel protein, isoform ...    84   9e-15
gi|23273590|gb|AAH36123.1| SMAP1 protein [Homo sapiens]                84   9e-15
gi|16303736|gb|AAL14714.1| stromal membrane-associated protein S...    84   9e-15
gi|47229419|emb|CAF99407.1| unnamed protein product [Tetraodon n...    83   1e-14
gi|49388351|dbj|BAD25461.1| putative zinc finger and C2 domain p...    82   2e-14
gi|32412326|ref|XP_326643.1| hypothetical protein [Neurospora cr...    82   3e-14
gi|50417734|gb|AAH77937.1| Unknown (protein for MGC:80897) [Xeno...    82   3e-14
gi|50759804|ref|XP_417789.1| PREDICTED: similar to hypothetical ...    81   5e-14
gi|34870909|ref|XP_216529.2| similar to hypothetical protein AL1...    81   5e-14
gi|25407332|pir||A85067 hypothetical protein AT4g05330 [imported...    81   6e-14
gi|34853981|ref|XP_342613.1| similar to MR1-interacting protein ...    81   6e-14
gi|31981560|ref|NP_598477.2| RIKEN cDNA 1810031K02 [Mus musculus...    81   6e-14
gi|18412932|ref|NP_567292.1| zinc finger and C2 domain protein, ...    81   6e-14
gi|28317046|gb|AAO39542.1| RE07016p [Drosophila melanogaster]          80   8e-14
gi|24584217|ref|NP_723849.1| CG31811-PB [Drosophila melanogaster...    80   8e-14
gi|24584226|ref|NP_723850.1| CG31811-PC [Drosophila melanogaster...    80   8e-14
gi|47271204|gb|AAT27272.1| RE36656p [Drosophila melanogaster]          80   8e-14
gi|7287794|gb|AAF44832.1| symbol=BG:DS08220.1; cDNA=method:''sim...    80   8e-14
gi|23943872|ref|NP_073570.1| hypothetical protein AL133206 [Homo...    80   8e-14
gi|7650487|gb|AAF66064.1| Centaurin Gamma 1A [Drosophila melanog...    80   8e-14
gi|24584224|ref|NP_523562.2| CG31811-PA [Drosophila melanogaster...    80   8e-14
gi|50555994|ref|XP_505405.1| hypothetical protein [Yarrowia lipo...    80   1e-13
gi|21594052|gb|AAM65970.1| putative GTPase activating protein [A...    80   1e-13
gi|18415638|ref|NP_567620.1| zinc finger and C2 domain protein (...    80   1e-13
gi|49080830|ref|XP_403890.1| hypothetical protein UM06275.1 [Ust...    80   1e-13
gi|31240049|ref|XP_320438.1| ENSANGP00000016918 [Anopheles gambi...    79   2e-13
gi|21755825|dbj|BAC04766.1| unnamed protein product [Homo sapiens]     79   2e-13
gi|16799069|ref|NP_114152.2| centaurin, gamma 3; MRIP-1 protein ...    79   2e-13
gi|10241722|emb|CAC09448.1| hypothetical protein [Homo sapiens]        79   2e-13
gi|29476829|gb|AAH48300.1| CENTG3 protein [Homo sapiens]               79   2e-13
gi|50312541|ref|XP_456306.1| unnamed protein product [Kluyveromy...    79   2e-13
gi|47076964|dbj|BAD18418.1| unnamed protein product [Homo sapiens]     79   2e-13
gi|21411458|gb|AAH31173.1| Centg3 protein [Mus musculus]               79   2e-13
gi|26348040|dbj|BAC37668.1| unnamed protein product [Mus musculus]     79   2e-13
gi|49072718|ref|XP_400648.1| hypothetical protein UM03033.1 [Ust...    79   2e-13
gi|27923745|sp|Q96P47|CEG3_HUMAN Centaurin gamma 3 >gnl|BL_ORD_I...    79   2e-13
gi|21040229|ref|NP_631892.1| centaurin, gamma 3; MR1-interacting...    79   2e-13
gi|14042076|dbj|BAB55097.1| unnamed protein product [Homo sapiens]     79   2e-13
gi|6807591|emb|CAB70912.1| hypothetical protein [Homo sapiens]         79   3e-13
gi|50794700|ref|XP_423713.1| PREDICTED: similar to centaurin, ga...    79   3e-13
gi|47212345|emb|CAF94957.1| unnamed protein product [Tetraodon n...    78   5e-13
gi|28850396|gb|AAM08488.2| similar to Arabidopsis thaliana (Mous...    77   9e-13
gi|7023161|dbj|BAA91862.1| unnamed protein product [Homo sapiens]      77   9e-13
gi|40789044|dbj|BAA83051.2| KIAA1099 protein [Homo sapiens]            77   9e-13
gi|47123063|gb|AAH70738.1| MGC83730 protein [Xenopus laevis]           77   9e-13
gi|7662484|ref|NP_055729.1| centaurin, gamma 2; Arf GAP with GTP...    77   9e-13
gi|46436147|gb|EAK95515.1| hypothetical protein CaO19.1396 [Cand...    77   9e-13
gi|6648206|gb|AAF21204.1| putative GTPase activating protein [Ar...    77   9e-13
gi|30680493|ref|NP_187451.2| zinc finger and C2 domain protein, ...    77   9e-13
gi|24651922|ref|NP_610424.1| CG8243-PA [Drosophila melanogaster]...    77   9e-13
gi|20152063|gb|AAM11391.1| RE02759p [Drosophila melanogaster]          77   9e-13
gi|47230025|emb|CAG10439.1| unnamed protein product [Tetraodon n...    77   1e-12
gi|42659500|ref|XP_374807.1| similar to ARF GTPase-activating pr...    76   1e-12
gi|37360242|dbj|BAC98099.1| mKIAA1099 protein [Mus musculus]           76   1e-12
gi|49088502|ref|XP_406068.1| hypothetical protein AN1931.2 [Aspe...    76   1e-12
gi|30017461|ref|NP_835220.1| centaurin, gamma 2 [Mus musculus] >...    76   1e-12
gi|48102225|ref|XP_392754.1| similar to CG6742-PA [Apis mellifera]     76   1e-12
gi|50260352|gb|EAL23011.1| hypothetical protein CNBA7780 [Crypto...    76   1e-12
gi|50759237|ref|XP_417581.1| PREDICTED: similar to Centaurin, be...    76   2e-12
gi|21428352|gb|AAM49836.1| GM06875p [Drosophila melanogaster]          76   2e-12
gi|17738139|ref|NP_524458.1| CG6742-PA [Drosophila melanogaster]...    76   2e-12
gi|47220354|emb|CAF98453.1| unnamed protein product [Tetraodon n...    76   2e-12
gi|47210555|emb|CAF93523.1| unnamed protein product [Tetraodon n...    76   2e-12
gi|26330696|dbj|BAC29078.1| unnamed protein product [Mus musculus]     76   2e-12
gi|28571836|ref|NP_732826.2| CG6742-PB [Drosophila melanogaster]...    76   2e-12
gi|17861564|gb|AAL39259.1| GH12888p [Drosophila melanogaster]          76   2e-12
gi|47077675|dbj|BAD18718.1| FLJ00312 protein [Homo sapiens]            75   3e-12
gi|37077982|sp|Q9ULH1|DDF1_HUMAN 130-kDa phosphatidylinositol 4,...    75   3e-12
gi|34866540|ref|XP_235296.2| similar to mKIAA1249 protein [Rattu...    75   3e-12
gi|4063616|gb|AAC98350.1| ADP-ribosylation factor-directed GTPas...    75   3e-12
gi|18916856|dbj|BAB85561.1| KIAA1975 protein [Homo sapiens]            75   3e-12
gi|33859534|ref|NP_034156.1| development and differentiation enh...    75   3e-12
gi|46094081|ref|NP_060952.2| development and differentiation enh...    75   3e-12
gi|6330854|dbj|BAA86563.1| KIAA1249 protein [Homo sapiens]             75   3e-12
gi|28981429|gb|AAH48818.1| Ddef1 protein [Mus musculus]                75   3e-12
gi|42659348|ref|XP_370567.2| KIAA1975 protein [Homo sapiens]           75   3e-12
gi|50257847|gb|EAL20548.1| hypothetical protein CNBE4680 [Crypto...    75   3e-12
gi|28972686|dbj|BAC65759.1| mKIAA1249 protein [Mus musculus]           75   3e-12
gi|34873104|ref|XP_233719.2| similar to CENTB5 protein [Rattus n...    75   3e-12
gi|19263343|ref|NP_597703.1| centaurin, gamma-like family, membe...    75   3e-12
gi|41149212|ref|XP_084445.8| similar to ARF GTPase-activating pr...    75   3e-12
gi|38105886|gb|EAA52262.1| hypothetical protein MG04954.4 [Magna...    75   3e-12
gi|31239015|ref|XP_319921.1| ENSANGP00000005278 [Anopheles gambi...    75   3e-12
gi|42659314|ref|XP_374801.1| similar to ARF GTPase-activating pr...    75   3e-12
gi|42659394|ref|XP_374799.1| similar to ARF GTPase-activating pr...    75   3e-12
gi|47213252|emb|CAF92913.1| unnamed protein product [Tetraodon n...    75   4e-12
gi|47123082|gb|AAH70750.1| MGC83760 protein [Xenopus laevis]           75   4e-12
gi|12697977|dbj|BAB21807.1| KIAA1716 protein [Homo sapiens]            75   4e-12
gi|38079084|ref|XP_131838.3| centaurin, beta 5 [Mus musculus]          75   4e-12
gi|46402197|ref|NP_997106.1| centaurin, beta 5 [Mus musculus] >g...    75   4e-12
gi|50414011|ref|XP_457351.1| unnamed protein product [Debaryomyc...    75   4e-12
gi|30109272|gb|AAH51194.1| CENTB5 protein [Homo sapiens]               75   4e-12
gi|47212738|emb|CAF90052.1| unnamed protein product [Tetraodon n...    75   4e-12
gi|28422704|gb|AAH47001.1| CENTB5 protein [Homo sapiens]               75   4e-12
gi|16945966|ref|NP_085152.1| centaurin, beta 5 [Homo sapiens] >g...    75   4e-12
gi|19112800|ref|NP_596008.1| putative gtpase activating protein....    74   6e-12
gi|47217474|emb|CAG10243.1| unnamed protein product [Tetraodon n...    74   6e-12
gi|47212317|emb|CAF89615.1| unnamed protein product [Tetraodon n...    74   6e-12
gi|46136933|ref|XP_390158.1| hypothetical protein FG09982.1 [Gib...    74   6e-12
gi|37551204|ref|XP_170525.2| similar to ARF GTPase-activating pr...    74   6e-12
gi|28461267|ref|NP_787015.1| development and differentiation enh...    74   7e-12
gi|50510473|dbj|BAD32222.1| mKIAA0400 protein [Mus musculus]           74   1e-11
gi|34863212|ref|XP_343040.1| similar to development- and differe...    74   1e-11
gi|38648787|gb|AAH63308.1| DDEF2 protein [Homo sapiens]                74   1e-11
gi|45187789|ref|NP_984012.1| ADL084Wp [Eremothecium gossypii] >g...    74   1e-11
gi|19114360|ref|NP_593448.1| putative gtpase activating protein ...    74   1e-11
gi|40788243|dbj|BAA23696.2| KIAA0400 [Homo sapiens]                    74   1e-11
gi|38094509|ref|XP_150333.5| similar to development- and differe...    74   1e-11
gi|40789069|dbj|BAA06418.2| KIAA0050 [Homo sapiens]                    74   1e-11
gi|46397411|sp|Q7SIG6|DDF2_MOUSE Development and differentiation...    74   1e-11
gi|47229056|emb|CAG03808.1| unnamed protein product [Tetraodon n...    74   1e-11
gi|4502249|ref|NP_003878.1| development- and differentiation-enh...    74   1e-11
gi|15219822|ref|NP_176283.1| ARF GTPase-activating domain-contai...    74   1e-11
gi|19386828|dbj|BAB86206.1| putative zinc finger and C2 domain p...    74   1e-11
gi|6730310|pdb|1DCQ|A Chain A, Crystal Structure Of The Arf-Gap ...    74   1e-11
gi|7661880|ref|NP_055531.1| centaurin beta1; Arf GAP with coiled...    74   1e-11
gi|29476839|gb|AAH48341.1| CTGLF1 protein [Homo sapiens]               73   1e-11
gi|42659415|ref|XP_370554.2| similar to ARF GTPase-activating pr...    73   1e-11
gi|46227994|gb|EAK88914.1| gata/ArfGAP, putative [Cryptosporidiu...    73   1e-11
gi|22766903|gb|AAH37481.1| Centb1 protein [Mus musculus]               73   1e-11
gi|27881415|ref|NP_722483.2| centaurin, beta 1 [Mus musculus] >g...    73   1e-11
gi|31199009|ref|XP_308452.1| ENSANGP00000018350 [Anopheles gambi...    73   2e-11
gi|32405192|ref|XP_323209.1| hypothetical protein [Neurospora cr...    73   2e-11
gi|23478603|gb|EAA15645.1| homeobox-containing protein [Plasmodi...    72   2e-11
gi|50732044|ref|XP_425945.1| PREDICTED: similar to Ddef1 protein...    72   2e-11
gi|50417708|gb|AAH77879.1| Unknown (protein for MGC:80649) [Xeno...    72   2e-11
gi|46135967|ref|XP_389675.1| hypothetical protein FG09499.1 [Gib...    72   2e-11
gi|50292755|ref|XP_448810.1| unnamed protein product [Candida gl...    72   2e-11
gi|37359746|dbj|BAC97851.1| mKIAA0041 protein [Mus musculus]           72   3e-11
gi|38080666|ref|XP_358819.1| similar to mKIAA0041 protein [Mus m...    72   3e-11
gi|50755479|ref|XP_414759.1| PREDICTED: similar to centaurin, al...    72   3e-11
gi|37590722|gb|AAH59321.1| MGC69045 protein [Xenopus laevis]           72   3e-11
gi|38014511|gb|AAH60484.1| MGC68712 protein [Xenopus laevis]           72   3e-11
gi|45735988|dbj|BAD13017.1| putative zinc finger and C2 domain p...    72   3e-11
gi|38079739|ref|XP_193836.3| RIKEN cDNA 9530039J15 [Mus musculus]      72   3e-11
gi|29249253|gb|EAA40769.1| GLP_608_56961_57905 [Giardia lamblia ...    72   4e-11
gi|47220682|emb|CAG11751.1| unnamed protein product [Tetraodon n...    72   4e-11
gi|6322145|ref|NP_012220.1| ADP-ribosylation factor (ARF) GTPase...    72   4e-11
gi|50752255|ref|XP_422706.1| PREDICTED: similar to ACAP2 [Gallus...    72   4e-11
gi|49116666|gb|AAH73417.1| Unknown (protein for MGC:80883) [Xeno...    72   4e-11
gi|28385994|gb|AAH46455.1| Similar to centaurin, beta 2 [Mus mus...    72   4e-11
gi|7661962|ref|NP_055585.1| centaurin, gamma 1; centaurin gamma1...    71   5e-11
gi|17986212|gb|AAC39522.2| KIAA0167 [Homo sapiens]                     71   5e-11
gi|25989575|gb|AAM97540.1| PI 3-kinase enhancer long isoform [Ho...    71   5e-11
gi|4225948|emb|CAA10736.1| centaurin gamma 1A [Caenorhabditis el...    71   5e-11
gi|32564722|ref|NP_499350.2| CeNTaurin, gamma 1 (105.4 kD) (cnt-...    71   5e-11
gi|27529706|dbj|BAA05064.2| KIAA0041 [Homo sapiens]                    71   5e-11
gi|7509671|pir||T26737 hypothetical protein Y39A1A.15a - Caenorh...    71   5e-11
gi|47118409|gb|AAT11274.1| ACAP2 [Oryctolagus cuniculus]               71   5e-11
gi|39932727|sp|Q15057|CEB2_HUMAN Centaurin beta 2 (Cnt-b2)             71   5e-11
gi|4688902|emb|CAB41450.1| centaurin beta2 [Homo sapiens]              71   5e-11
gi|40254842|ref|NP_036419.2| centaurin, beta 2; centaurin beta2;...    71   5e-11
gi|7509672|pir||T26738 hypothetical protein Y39A1A.15b - Caenorh...    71   5e-11
gi|47230091|emb|CAG10505.1| unnamed protein product [Tetraodon n...    71   5e-11
gi|7509673|pir||T26743 hypothetical protein Y39A1A.15c - Caenorh...    71   5e-11
gi|4225950|emb|CAA10737.1| centaurin gamma 1B [Caenorhabditis el...    71   5e-11
gi|17555716|ref|NP_499351.1| CeNTaurin, gamma 1 (123.1 kD) (cnt-...    71   5e-11
gi|40788892|dbj|BAA11484.2| KIAA0167 protein [Homo sapiens]            71   5e-11
gi|47777426|gb|AAT38060.1| putative zinc finger protein [Oryza s...    71   6e-11
gi|50744970|ref|XP_426197.1| PREDICTED: similar to stromal membr...    71   6e-11
gi|31198405|ref|XP_308150.1| ENSANGP00000020738 [Anopheles gambi...    70   8e-11
gi|41149339|ref|XP_058335.8| similar to ARF GTPase-activating pr...    70   8e-11
gi|25989573|gb|AAM97539.1| PI 3-kinase enhancer long isoform [Ra...    70   8e-11
gi|38090993|ref|XP_137397.3| similar to PI 3-kinase enhancer lon...    70   8e-11
gi|39591850|emb|CAE71428.1| Hypothetical protein CBG18339 [Caeno...    70   1e-10
gi|47225747|emb|CAG08090.1| unnamed protein product [Tetraodon n...    70   1e-10
gi|47200459|emb|CAF87550.1| unnamed protein product [Tetraodon n...    70   1e-10
gi|30684352|ref|NP_196834.2| ARF GTPase-activating domain-contai...    69   2e-10
gi|27806235|ref|NP_776938.1| centaurin, alpha 1 [Bos taurus] >gn...    69   2e-10
gi|11358303|pir||T48577 hypothetical protein T31B5.120 - Arabido...    69   2e-10
gi|47224775|emb|CAG00369.1| unnamed protein product [Tetraodon n...    69   2e-10
gi|11362839|pir||T43808 zinc finger protein [imported] - Encepha...    69   2e-10
gi|30681946|ref|NP_172556.2| ARF GTPase-activating domain-contai...    69   3e-10
gi|25402625|pir||D86242 hypothetical protein [imported] - Arabid...    69   3e-10
gi|38175545|dbj|BAD01238.1| putative ARF GTPase-activating domai...    68   4e-10
gi|15240398|ref|NP_201004.1| ARF GTPase-activating domain-contai...    68   4e-10
gi|31203135|ref|XP_310516.1| ENSANGP00000017294 [Anopheles gambi...    68   5e-10
gi|50540504|ref|NP_001002715.1| zgc:92360 [Danio rerio] >gnl|BL_...    67   7e-10
gi|46125485|ref|XP_387296.1| hypothetical protein FG07120.1 [Gib...    67   9e-10
gi|49388165|dbj|BAD25291.1| putative ADP-ribosylation factor-dir...    67   9e-10
gi|39591489|emb|CAE73543.1| Hypothetical protein CBG21011 [Caeno...    67   9e-10
gi|47217305|emb|CAG12513.1| unnamed protein product [Tetraodon n...    67   9e-10
gi|19923540|ref|NP_060177.2| up-regulated in liver cancer 1; sim...    67   1e-09
gi|38173784|gb|AAH60786.1| Up-regulated in liver cancer 1 [Homo ...    67   1e-09
gi|11359957|pir||T46305 hypothetical protein DKFZp434D1411.1 - h...    67   1e-09
gi|49071514|ref|XP_400046.1| hypothetical protein UM02431.1 [Ust...    66   2e-09
gi|47212712|emb|CAF90510.1| unnamed protein product [Tetraodon n...    66   2e-09
gi|48140501|ref|XP_397124.1| similar to Ddef1 protein [Apis mell...    66   2e-09
gi|19173494|ref|NP_597297.1| putative zinc finger protein [Encep...    66   2e-09
gi|45361417|ref|NP_989286.1| hypothetical protein MGC76109 [Xeno...    65   3e-09
gi|49523056|gb|AAH75518.1| MGC76109 protein [Xenopus tropicalis]       65   3e-09
gi|11359444|pir||T49496 hypothetical protein B14D6.480 [imported...    65   3e-09
gi|19424252|ref|NP_598251.1| centaurin, alpha 1 [Rattus norvegic...    65   3e-09
gi|49093900|ref|XP_408411.1| hypothetical protein AN4274.2 [Aspe...    65   3e-09
gi|1435195|gb|AAC52683.1| centaurin alpha                              65   4e-09
gi|4200342|emb|CAA07581.1| centaurin beta [Rattus norvegicus] >g...    65   4e-09
gi|38081360|ref|XP_355658.1| similar to centaurin, alpha 1 [Mus ...    65   4e-09
gi|4225944|emb|CAA10734.1| centaurin beta 1A [Caenorhabditis ele...    64   6e-09
gi|17536947|ref|NP_496569.1| CeNTaurin, beta (90.6 kD) (cnt-1) [...    64   6e-09
gi|6806913|ref|NP_006860.1| centaurin, alpha 1; centaurin-alpha ...    64   6e-09
gi|6434439|emb|CAA19462.2| Hypothetical protein Y17G7B.15b [Caen...    64   6e-09
gi|32564605|ref|NP_496570.3| CeNTaurin, beta (81.4 kD) (cnt-1) [...    64   6e-09
gi|47523536|ref|NP_999391.1| inositol(1,3,4,5)tetrakisphosphate ...    64   6e-09
gi|7509429|pir||T26508 hypothetical protein Y17G7B.15 - Caenorha...    64   6e-09
gi|24586503|ref|NP_610354.2| CG30372-PA [Drosophila melanogaster...    64   8e-09
gi|38078894|ref|XP_131741.3| similar to up-regulated in liver ca...    64   8e-09
gi|7486586|pir||T04947 hypothetical protein F7J7.100 - Arabidops...    63   1e-08
gi|6468309|emb|CAB61580.1| hypothetical protein [Homo sapiens]         63   2e-08
gi|50750123|ref|XP_421880.1| PREDICTED: similar to centaurin, ga...    62   2e-08
gi|50728768|ref|XP_416275.1| PREDICTED: similar to IP4/PIP3 bind...    62   3e-08
gi|19112689|ref|NP_595897.1| csx2 protein [Schizosaccharomyces p...    62   3e-08
gi|47219048|emb|CAG00187.1| unnamed protein product [Tetraodon n...    62   4e-08
gi|50422807|ref|XP_459980.1| unnamed protein product [Debaryomyc...    61   5e-08
gi|50757819|ref|XP_415661.1| PREDICTED: similar to Centaurin-alp...    61   5e-08
gi|38110186|gb|EAA55946.1| hypothetical protein MG01597.4 [Magna...    61   6e-08
gi|21707306|gb|AAH33758.1| Centaurin-alpha 2 protein [Homo sapiens]    60   1e-07
gi|8923763|ref|NP_060874.1| centaurin-alpha 2 protein [Homo sapi...    60   1e-07
gi|47209145|emb|CAF91605.1| unnamed protein product [Tetraodon n...    59   2e-07
gi|47214064|emb|CAG00722.1| unnamed protein product [Tetraodon n...    59   2e-07
gi|46443186|gb|EAL02470.1| hypothetical protein CaO19.10568 [Can...    59   3e-07
gi|14329676|emb|CAC40651.1| centaurin beta [Homo sapiens]              59   3e-07
gi|9910340|ref|NP_064486.1| Centaurin-alpha2 protein [Rattus nor...    57   7e-07
gi|26006859|ref|NP_742145.1| centaurin, alpha 2 [Mus musculus] >...    57   9e-07
gi|45680425|gb|AAS75226.1| unknown protein [Oryza sativa (japoni...    57   1e-06
gi|20197515|gb|AAD15467.2| unknown protein [Arabidopsis thaliana]      57   1e-06
gi|25411567|pir||G84517 hypothetical protein At2g14490 [imported...    57   1e-06
gi|46437807|gb|EAK97147.1| hypothetical protein CaO19.13751 [Can...    56   2e-06
gi|28573879|ref|NP_610599.3| CG16728-PA [Drosophila melanogaster...    56   2e-06
gi|6320732|ref|NP_010812.1| ADP-ribosylation factor (ARF) GTPase...    56   2e-06
gi|47223628|emb|CAF99237.1| unnamed protein product [Tetraodon n...    56   2e-06
gi|45185633|ref|NP_983349.1| ACL055Wp [Eremothecium gossypii] >g...    56   2e-06
gi|50288879|ref|XP_446869.1| unnamed protein product [Candida gl...    55   4e-06
gi|30680774|ref|NP_172344.2| ARF GAP-like zinc finger-containing...    55   4e-06
gi|7485983|pir||T00722 hypothetical protein F22O13.17 - Arabidop...    55   4e-06
gi|30680768|ref|NP_850941.1| ARF GAP-like zinc finger-containing...    55   4e-06
gi|47212847|emb|CAF95237.1| unnamed protein product [Tetraodon n...    55   5e-06
gi|47226504|emb|CAG08520.1| unnamed protein product [Tetraodon n...    55   5e-06
gi|50255563|gb|EAL18296.1| hypothetical protein CNBJ2190 [Crypto...    54   6e-06
gi|20521656|dbj|BAA34502.2| KIAA0782 protein [Homo sapiens]            54   6e-06
gi|45199244|ref|NP_986273.1| AFR725Cp [Eremothecium gossypii] >g...    54   6e-06
gi|28850338|gb|AAO53121.1| hypothetical protein [Dictyostelium d...    54   6e-06
gi|27923746|sp|Q96P48|CED2_HUMAN Centaurin delta 2 (Cnt-d2) >gnl...    54   6e-06
gi|16975484|ref|NP_056057.1| centaurin delta 2 isoform b; ARF-GA...    54   6e-06
gi|21264597|ref|NP_631920.1| centaurin delta 2 isoform a; ARF-GA...    54   6e-06
gi|29387351|gb|AAH48196.1| GIT1 protein [Homo sapiens]                 54   8e-06
gi|34878015|ref|XP_223437.2| similar to PARX protein [Rattus nor...    54   8e-06
gi|37655161|ref|NP_081456.2| centaurin, delta 2 isoform 1 [Mus m...    54   8e-06
gi|13929158|ref|NP_114002.1| G protein-coupled receptor kinase i...    54   8e-06
gi|45501011|gb|AAH67358.1| GIT1 protein [Homo sapiens]                 54   8e-06
gi|41393573|ref|NP_054749.2| G protein-coupled receptor kinase i...    54   8e-06
gi|4691726|gb|AAD28046.1| ARF GTPase-activating protein GIT1 [Ho...    54   8e-06
gi|37360090|dbj|BAC98023.1| mKIAA0782 protein [Mus musculus]           54   8e-06
gi|19115065|ref|NP_594153.1| hypothetical GTPase activating prot...    54   8e-06
gi|22328591|ref|NP_193071.2| human Rev interacting-like protein-...    54   1e-05
gi|50747160|ref|XP_426346.1| PREDICTED: similar to centaurin del...    54   1e-05
gi|12060548|gb|AAG48161.1| p95-APP2 [Gallus gallus]                    54   1e-05
gi|45383009|ref|NP_989537.1| G protein-coupled receptor kinase-i...    54   1e-05
gi|27695319|gb|AAH43062.1| Git2 protein [Mus musculus]                 53   1e-05
gi|31199847|ref|XP_308871.1| ENSANGP00000007736 [Anopheles gambi...    53   1e-05
gi|49116662|gb|AAH73412.1| Unknown (protein for MGC:80878) [Xeno...    53   1e-05
gi|29421176|dbj|BAA25506.2| KIAA0580 protein [Homo sapiens]            53   1e-05
gi|34447227|ref|NP_062808.2| G protein-coupled receptor kinase-i...    53   1e-05
gi|47077691|dbj|BAD18726.1| FLJ00357 protein [Homo sapiens]            53   1e-05
gi|21264592|ref|NP_056045.2| centaurin delta 1 isoform a; PARX p...    53   1e-05
gi|16974764|gb|AAL32459.1| PARX protein [Homo sapiens]                 53   1e-05
gi|16118245|gb|AAL12170.1| ARAP2 [Homo sapiens]                        53   1e-05
gi|18203126|sp|Q9JLQ2|GIT2_MOUSE ARF GTPase-activating protein G...    53   1e-05
gi|7513028|pir||T00342 hypothetical protein KIAA0580 - human (fr...    53   1e-05
gi|34872665|ref|XP_222231.2| similar to Git2 protein [Rattus nor...    53   1e-05
gi|45383548|ref|NP_989627.1| G protein-coupled receptor kinase i...    53   1e-05
gi|47212642|emb|CAF92954.1| unnamed protein product [Tetraodon n...    53   2e-05
gi|47156967|gb|AAT12346.1| putative zinc finger protein-like pro...    52   2e-05
gi|18700711|gb|AAL78678.1| dual-specificity Rho- and Arf-GTPase ...    52   3e-05
gi|27885015|ref|NP_631945.1| ARF-GAP, RHO-GAP, ankyrin repeat an...    52   3e-05
gi|45829821|gb|AAH68145.1| ARF-GAP, RHO-GAP, ankyrin repeat and ...    52   3e-05
gi|47208970|emb|CAF92925.1| unnamed protein product [Tetraodon n...    52   3e-05
gi|26343231|dbj|BAC35272.1| unnamed protein product [Mus musculus]     52   3e-05
gi|34878832|ref|XP_341603.1| similar to ARF-GAP, RHO-GAP, ankyri...    52   3e-05
gi|17149830|ref|NP_476510.1| G protein-coupled receptor kinase-i...    51   5e-05
gi|20521834|dbj|BAA09769.2| The KIAA0148 gene product is related...    51   5e-05
gi|21237786|ref|NP_055591.2| G protein-coupled receptor kinase-i...    51   5e-05
gi|30585067|gb|AAP36806.1| Homo sapiens G protein-coupled recept...    51   5e-05
gi|21237794|ref|NP_631940.1| G protein-coupled receptor kinase-i...    51   5e-05
gi|49065562|emb|CAG38599.1| GIT2 [Homo sapiens]                        51   5e-05
gi|17149832|ref|NP_476511.1| G protein-coupled receptor kinase-i...    51   5e-05
gi|26331890|dbj|BAC29675.1| unnamed protein product [Mus musculus]     51   7e-05
gi|47210894|emb|CAF90404.1| unnamed protein product [Tetraodon n...    50   9e-05
gi|6321257|ref|NP_011334.1| Contains a zinc-finger in the N-term...    50   9e-05
gi|18000295|gb|AAL54909.1| IP4/PIP3 binding protein-like protein...    50   1e-04
gi|49387900|dbj|BAD25003.1| human Rev interacting-like protein-l...    50   1e-04
gi|48102438|ref|XP_395358.1| similar to ENSANGP00000007736 [Apis...    50   1e-04
gi|49387899|dbj|BAD25002.1| ZIGA2 protein-like [Oryza sativa (ja...    50   1e-04
gi|21264337|ref|NP_071926.4| ARF-GAP, RHO-GAP, ankyrin repeat an...    49   2e-04
gi|47214065|emb|CAG00723.1| unnamed protein product [Tetraodon n...    49   2e-04
gi|50550125|ref|XP_502535.1| hypothetical protein [Yarrowia lipo...    49   3e-04
gi|47682845|gb|AAH70736.1| MGC83726 protein [Xenopus laevis]           48   6e-04
gi|34909220|ref|NP_915957.1| putative ARF GAP-like zinc finger-c...    47   0.001
gi|34784857|gb|AAH56768.1| HIV-1 Rev binding protein [Danio rerio]     46   0.002
gi|41055720|ref|NP_956129.1| HIV-1 Rev binding protein [Danio re...    46   0.002
gi|38091496|ref|XP_126291.5| similar to G protein-coupled recept...    46   0.002
gi|38570132|ref|NP_004495.2| HIV-1 Rev binding protein; Rab, Rev...    46   0.002
gi|26325842|dbj|BAC26675.1| unnamed protein product [Mus musculus]     46   0.002
gi|33563260|ref|NP_034602.1| HIV-1 Rev binding protein [Mus musc...    46   0.002
gi|950051|emb|CAA61667.1| nucleoporin-like protein [Homo sapiens]      46   0.002
gi|47227956|emb|CAF97585.1| unnamed protein product [Tetraodon n...    46   0.002
gi|31236158|ref|XP_319366.1| ENSANGP00000012183 [Anopheles gambi...    45   0.003
gi|50293251|ref|XP_449037.1| unnamed protein product [Candida gl...    45   0.004
gi|50306009|ref|XP_452966.1| unnamed protein product [Kluyveromy...    45   0.005
gi|34871387|ref|XP_222017.2| similar to RIKEN cDNA A630095P14 [R...    44   0.008
gi|26340146|dbj|BAC33736.1| unnamed protein product [Mus musculus]     44   0.008
gi|14424764|gb|AAH09393.1| HRBL protein [Homo sapiens]                 44   0.011
gi|21704138|ref|NP_663541.1| HIV-1 Rev-binding protein-like prot...    44   0.011
gi|30039690|ref|NP_835456.1| HIV-1 Rev-binding protein-like prot...    44   0.011
gi|39582118|emb|CAE60795.1| Hypothetical protein CBG04486 [Caeno...    44   0.011
gi|49035762|sp|O95081|HRBL_HUMAN HIV-1 Rev binding protein-like ...    44   0.011
gi|4102709|gb|AAD01550.1| RAB-R protein [Homo sapiens]                 44   0.011
gi|21361326|ref|NP_006067.2| HIV-1 Rev-binding protein-like prot...    44   0.011
gi|39644456|gb|AAH04874.2| CENTB5 protein [Homo sapiens]               43   0.018
gi|7499099|pir||T20898 hypothetical protein F14F3.2 - Caenorhabd...    43   0.018
gi|25147080|ref|NP_509761.2| G protein-coupled receptor kinase-i...    43   0.018
gi|34859394|ref|XP_230701.2| similar to HIV-1 Rev binding protei...    43   0.018
gi|41053619|ref|NP_956882.1| hypothetical protein MGC66055 [Dani...    42   0.031
gi|3834641|gb|AAC71035.1| Drongo [Drosophila melanogaster]             41   0.053
gi|17137344|ref|NP_477239.1| CG3365-PB [Drosophila melanogaster]...    41   0.069
gi|29245305|gb|EAA36952.1| GLP_333_15386_14190 [Giardia lamblia ...    39   0.20
gi|34876999|ref|XP_343609.1| similar to HIV-1 Rev binding protei...    39   0.34
gi|9802557|gb|AAF99759.1| F22O13.16 [Arabidopsis thaliana]             37   0.76
gi|47216462|emb|CAG02113.1| unnamed protein product [Tetraodon n...    37   1.3
gi|34858812|ref|XP_341896.1| similar to KIAA0782 protein [Rattus...    37   1.3
gi|22532289|gb|AAM97883.1| envelope glycoprotein [Human immunode...    34   8.4
gi|24647644|ref|NP_650611.1| CG4090-PA [Drosophila melanogaster]...    34   8.4


>gi|17508013|ref|NP_492310.1| ADP-ribosylation factor GTPase
            activating protein 1 (45.7 kD) (1J104) [Caenorhabditis
            elegans]
 gi|7505110|pir||T23223 hypothetical protein K02B12.7 - Caenorhabditis
            elegans
 gi|3878163|emb|CAB00036.1| Hypothetical protein K02B12.7
            [Caenorhabditis elegans]
          Length = 423

 Score =  673 bits (1737), Expect = 0.0
 Identities = 345/423 (81%), Positives = 345/423 (81%)
 Frame = -1

Query: 1272 MASPRTRRVLKELRPCDDNNFCFECEANNPQWVSVSYGIWICLECSGIHRSLGVHLSFVR 1093
            MASPRTRRVLKELRPCDDNNFCFECEANNPQWVSVSYGIWICLECSGIHRSLGVHLSFVR
Sbjct: 1    MASPRTRRVLKELRPCDDNNFCFECEANNPQWVSVSYGIWICLECSGIHRSLGVHLSFVR 60

Query: 1092 SVTMDKWKDIELAKMKAGGNRKFAEFLQSQPDYKEKWTIQEKYNSRAAALFRDKVACEAE 913
            SVTMDKWKDIELAKMKAGGNRKFAEFLQSQPDYKEKWTIQEKYNSRAAALFRDKVACEAE
Sbjct: 61   SVTMDKWKDIELAKMKAGGNRKFAEFLQSQPDYKEKWTIQEKYNSRAAALFRDKVACEAE 120

Query: 912  GREWSQSTSPAANYVPPTLGGMSSQSKPTXXXXXXXXXXXXXXXXXXXXXXXGDGAYSTQ 733
            GREWSQSTSPAANYVPPTLGGMSSQSKPT                       GDGAYSTQ
Sbjct: 121  GREWSQSTSPAANYVPPTLGGMSSQSKPTNKSSGNSSLGSYYGGNSSYSQSTGDGAYSTQ 180

Query: 732  DSNSKYQGFGNTGYVPNQSNSGDDLLXXXXXXXXXXXXXXSKGASQAAAMAKDVGIQAQQ 553
            DSNSKYQGFGNTGYVPNQSNSGDDLL              SKGASQAAAMAKDVGIQAQQ
Sbjct: 181  DSNSKYQGFGNTGYVPNQSNSGDDLLAGAMSGLSMGWSMLSKGASQAAAMAKDVGIQAQQ 240

Query: 552  KASQLSENVSQNNSLFGGVANKASEVGTKSWDGLSSFVKSPSLNAFSGILAKTGYEDFXX 373
            KASQLSENVSQNNSLFGGVANKASEVGTKSWDGLSSFVKSPSLNAFSGILAKTGYEDF
Sbjct: 241  KASQLSENVSQNNSLFGGVANKASEVGTKSWDGLSSFVKSPSLNAFSGILAKTGYEDFGG 300

Query: 372  XXXXXXXXXSQNEFNDWLKQSNLPRGTTEGGDHLSNXXXXXXXXXXXXXXXERSVKPVQS 193
                     SQNEFNDWLKQSNLPRGTTEGGDHLSN               ERSVKPVQS
Sbjct: 301  GGGGMSGSSSQNEFNDWLKQSNLPRGTTEGGDHLSNEELKPTEPVETKKKKERSVKPVQS 360

Query: 192  KEKVTAENVEDDDSSSTITQFESSFNKPKTTAPRLXXXXXXXXXXXXXXXKGWDDDAWDL 13
            KEKVTAENVEDDDSSSTITQFESSFNKPKTTAPRL               KGWDDDAWDL
Sbjct: 361  KEKVTAENVEDDDSSSTITQFESSFNKPKTTAPRLAPVAAAPPKKKEEKAKGWDDDAWDL 420

Query: 12   LNQ 4
            LNQ
Sbjct: 421  LNQ 423




[DB home][top]