Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= K02B12_8
(1272 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17508013|ref|NP_492310.1| ADP-ribosylation factor GTPase acti... 673 0.0
gi|39595608|emb|CAE67110.1| Hypothetical protein CBG12524 [Caeno... 580 e-164
gi|8922652|ref|NP_060679.1| ADP-ribosylation factor GTPase activ... 252 2e-65
gi|26326517|dbj|BAC27002.1| unnamed protein product [Mus musculus] 251 3e-65
gi|50758783|ref|XP_417415.1| PREDICTED: similar to ADP-ribosylat... 250 4e-65
gi|31542139|ref|NP_665703.2| ADP-ribosylation factor GTPase acti... 249 7e-65
gi|21489979|ref|NP_659558.1| ADP-ribosylation factor 1 GTPase ac... 249 1e-64
gi|37604182|gb|AAH59817.1| Arfgap1 protein [Mus musculus] 248 2e-64
gi|45708401|gb|AAH06085.1| ARFGAP1 protein [Homo sapiens] >gnl|B... 248 2e-64
gi|27923732|sp|Q9EPJ9|ARG1_MOUSE ADP-ribosylation factor GTPase ... 246 8e-64
gi|47477812|gb|AAH70895.1| Arfgap1 protein [Rattus norvegicus] 244 2e-63
gi|28416436|ref|NP_783202.1| ADP-ribosylation factor GTPase acti... 244 2e-63
gi|50415496|gb|AAH78102.1| Unknown (protein for MGC:83573) [Xeno... 244 4e-63
gi|47227290|emb|CAF96839.1| unnamed protein product [Tetraodon n... 236 7e-61
gi|24663283|ref|NP_524040.2| CG4237-PA [Drosophila melanogaster]... 202 1e-50
gi|2286211|gb|AAB64300.1| putative ARF1 GTPase activating protei... 201 2e-50
gi|31217790|ref|XP_316504.1| ENSANGP00000004294 [Anopheles gambi... 198 3e-49
gi|48099874|ref|XP_394952.1| similar to CG4237-PA [Apis mellifera] 196 1e-48
gi|50256126|gb|EAL18853.1| hypothetical protein CNBI1140 [Crypto... 146 1e-33
gi|14041841|dbj|BAB55009.1| unnamed protein product [Homo sapiens] 143 8e-33
gi|15224315|ref|NP_181291.1| arabidopsis pde1 suppressor 1 prote... 134 5e-30
gi|15231865|ref|NP_190939.1| ARF GAP-like zinc finger-containing... 132 1e-29
gi|10441356|gb|AAG17006.1| ARF GAP-like zinc finger-containing p... 132 1e-29
gi|45185066|ref|NP_982783.1| ABL164Cp [Eremothecium gossypii] >g... 125 2e-27
gi|19075686|ref|NP_588186.1| zinc finger protein, gcs1 homolog, ... 124 4e-27
gi|50307815|ref|XP_453901.1| unnamed protein product [Kluyveromy... 122 2e-26
gi|32415924|ref|XP_328440.1| hypothetical protein [Neurospora cr... 121 3e-26
gi|50288337|ref|XP_446597.1| unnamed protein product [Candida gl... 120 5e-26
gi|50547821|ref|XP_501380.1| hypothetical protein [Yarrowia lipo... 120 7e-26
gi|42557538|emb|CAE84440.1| putative Gcs1 protein [Kluyveromyces... 119 1e-25
gi|46435254|gb|EAK94640.1| hypothetical protein CaO19.11167 [Can... 119 2e-25
gi|46435289|gb|EAK94674.1| hypothetical protein CaO19.3683 [Cand... 119 2e-25
gi|50418377|ref|XP_457776.1| unnamed protein product [Debaryomyc... 118 3e-25
gi|38110364|gb|EAA56094.1| hypothetical protein MG01745.4 [Magna... 115 2e-24
gi|45387621|ref|NP_991160.1| ADP-ribosylation factor GTPase acti... 110 7e-23
gi|45709895|gb|AAH67611.1| Zgc:85765 protein [Danio rerio] 110 7e-23
gi|6319975|ref|NP_010055.1| Zn-finger-containing protein that fu... 110 9e-23
gi|37537094|ref|NP_922849.1| unknown protein [Oryza sativa (japo... 110 9e-23
gi|18414983|ref|NP_567543.1| human Rev interacting-like family p... 109 1e-22
gi|13430530|gb|AAK25887.1| unknown protein [Arabidopsis thaliana] 109 1e-22
gi|7487780|pir||T05075 hypothetical protein T6K21.70 - Arabidops... 109 1e-22
gi|15237500|ref|NP_199487.1| human Rev interacting-like family p... 109 2e-22
gi|18403775|ref|NP_565801.1| human Rev interacting-like family p... 108 4e-22
gi|42571059|ref|NP_973603.1| human Rev interacting-like family p... 108 4e-22
gi|49089254|ref|XP_406359.1| hypothetical protein AN2222.2 [Aspe... 106 1e-21
gi|29126345|gb|AAO66537.1| putative zinc finger protein [Oryza s... 106 1e-21
gi|24668642|ref|NP_649409.1| CG6838-PA [Drosophila melanogaster]... 105 2e-21
gi|30841021|ref|NP_079721.2| ADP-ribosylation factor GTPase acti... 105 2e-21
gi|21263413|sp|Q9D8S3|ARG3_MOUSE ADP-ribosylation factor GTPase-... 105 2e-21
gi|26344620|dbj|BAC35959.1| unnamed protein product [Mus musculu... 105 2e-21
gi|47216383|emb|CAG02441.1| unnamed protein product [Tetraodon n... 105 3e-21
gi|31213355|ref|XP_315621.1| ENSANGP00000007262 [Anopheles gambi... 103 9e-21
gi|21263420|sp|Q9NP61|ARG3_HUMAN ADP-ribosylation factor GTPase-... 103 1e-20
gi|20070255|ref|NP_055385.2| ADP-ribosylation factor GTPase acti... 103 1e-20
gi|31543983|ref|NP_115765.2| zinc finger protein 289, ID1 regula... 102 1e-20
gi|21739968|emb|CAD39004.1| hypothetical protein [Homo sapiens] 102 1e-20
gi|39596875|emb|CAE59102.1| Hypothetical protein CBG02397 [Caeno... 102 2e-20
gi|29841278|gb|AAP06310.1| similar to GenBank Accession Number B... 102 2e-20
gi|34856538|ref|XP_342463.1| similar to zinc finger protein 289 ... 102 3e-20
gi|13529563|gb|AAH05495.1| Zinc finger protein 289 [Mus musculus] 101 4e-20
gi|12963847|ref|NP_076343.1| zinc finger protein 289 [Mus muscul... 101 4e-20
gi|12844436|dbj|BAB26362.1| unnamed protein product [Mus musculus] 101 4e-20
gi|7498564|pir||T15963 hypothetical protein F07F6.4 - Caenorhabd... 100 6e-20
gi|25153991|ref|NP_495029.2| zinc finger protein 289 (57.9 kD) (... 100 6e-20
gi|50549563|ref|XP_502252.1| hypothetical protein [Yarrowia lipo... 100 7e-20
gi|46227983|gb|EAK88903.1| ARF GAP-like zinc finger-containing p... 100 7e-20
gi|14042190|dbj|BAB55144.1| unnamed protein product [Homo sapiens] 100 1e-19
gi|27695479|gb|AAH41750.1| Arfgap3-prov protein [Xenopus laevis] 100 1e-19
gi|50748115|ref|XP_421112.1| PREDICTED: similar to zinc finger p... 100 1e-19
gi|38085091|ref|XP_132765.2| similar to zinc finger protein 289 ... 100 1e-19
gi|50255931|gb|EAL18661.1| hypothetical protein CNBI3610 [Crypto... 99 3e-19
gi|23478539|gb|EAA15599.1| ADP-ribosylation factor GTPase-activa... 97 8e-19
gi|3676478|gb|AAC61985.1| ADP-ribosylation factor GTPase-activat... 97 1e-18
gi|48109992|ref|XP_393119.1| similar to ENSANGP00000007262 [Apis... 97 1e-18
gi|11071796|emb|CAC14640.1| ArfGap-like zinc finger protein [Lei... 95 4e-18
gi|46136393|ref|XP_389888.1| hypothetical protein FG09712.1 [Gib... 94 5e-18
gi|50418851|ref|XP_457946.1| unnamed protein product [Debaryomyc... 93 1e-17
gi|23509120|ref|NP_701788.1| ADP-ribosylation factor GTPase-acti... 93 2e-17
gi|38110043|gb|EAA55821.1| hypothetical protein MG01472.4 [Magna... 93 2e-17
gi|28850371|gb|AAM08466.2| similar to Plasmodium falciparum (iso... 92 2e-17
gi|32420969|ref|XP_330928.1| hypothetical protein [Neurospora cr... 92 3e-17
gi|9294154|dbj|BAB02056.1| unnamed protein product [Arabidopsis ... 92 3e-17
gi|29245791|gb|EAA37412.1| GLP_383_11014_11505 [Giardia lamblia ... 91 6e-17
gi|15229090|ref|NP_188393.1| human Rev interacting-like family p... 91 6e-17
gi|23478251|gb|EAA15387.1| zinc finger protein Glo3-like, putati... 90 1e-16
gi|46439448|gb|EAK98766.1| hypothetical protein CaO19.12900 [Can... 90 1e-16
gi|19074855|ref|NP_586361.1| ZINC FINGER PROTEIN [Encephalitozoo... 90 1e-16
gi|49097420|ref|XP_410170.1| hypothetical protein AN6033.2 [Aspe... 89 2e-16
gi|45200818|ref|NP_986388.1| AGL279Cp [Eremothecium gossypii] >g... 89 2e-16
gi|510449|emb|CAA56046.1| GLO3 [Saccharomyces cerevisiae] 89 2e-16
gi|6320969|ref|NP_011048.1| Zinc-finger-containing protein with ... 89 2e-16
gi|49067699|ref|XP_398139.1| hypothetical protein UM00524.1 [Ust... 89 2e-16
gi|28829090|gb|AAO51654.1| similar to Homo sapiens (Human). KIAA... 88 4e-16
gi|50288193|ref|XP_446525.1| unnamed protein product [Candida gl... 87 8e-16
gi|172687|gb|AAA62404.1| SPX18 87 1e-15
gi|23612959|ref|NP_704498.1| hypothetical protein [Plasmodium fa... 86 1e-15
gi|19115755|ref|NP_594843.1| GCS1/GLO3/SPS18 family zinc finger ... 86 1e-15
gi|39591833|emb|CAE71411.1| Hypothetical protein CBG18321 [Caeno... 86 2e-15
gi|34898734|ref|NP_910713.1| contains ESTs C28562(C61610),C25917... 86 2e-15
gi|6324125|ref|NP_014195.1| sporulation-specific protein; Sps18p... 86 2e-15
gi|49257975|gb|AAH74142.1| Unknown (protein for MGC:81879) [Xeno... 86 2e-15
gi|21618169|gb|AAM67219.1| ARF GAP-like zinc finger-containing p... 86 2e-15
gi|47937993|gb|AAH71454.1| Unknown (protein for IMAGE:6900493) [... 86 2e-15
gi|10441352|gb|AAG17004.1| ARF GAP-like zinc finger-containing p... 86 2e-15
gi|18423615|ref|NP_568807.1| ARF GAP-like zinc finger-containing... 86 2e-15
gi|50308505|ref|XP_454255.1| unnamed protein product [Kluyveromy... 86 2e-15
gi|47213547|emb|CAG13268.1| unnamed protein product [Tetraodon n... 85 3e-15
gi|49116707|gb|AAH73437.1| Unknown (protein for IMAGE:5516053) [... 85 4e-15
gi|28077013|ref|NP_082810.1| stromal membrane-associated protein... 84 5e-15
gi|21264558|ref|NP_068759.2| stromal membrane-associated protein... 84 7e-15
gi|10435055|dbj|BAB14473.1| unnamed protein product [Homo sapiens] 84 7e-15
gi|46227185|gb|EAK88135.1| arfgap'arfgap like finger domain cont... 84 7e-15
gi|34189699|gb|AAH08672.1| SMAP1 protein [Homo sapiens] 84 7e-15
gi|17555530|ref|NP_499364.1| ARF -containing protein (51.9 kD) (... 84 9e-15
gi|13561010|emb|CAC36277.1| bA160A9.3.1 (novel protein, isoform ... 84 9e-15
gi|23273590|gb|AAH36123.1| SMAP1 protein [Homo sapiens] 84 9e-15
gi|16303736|gb|AAL14714.1| stromal membrane-associated protein S... 84 9e-15
gi|47229419|emb|CAF99407.1| unnamed protein product [Tetraodon n... 83 1e-14
gi|49388351|dbj|BAD25461.1| putative zinc finger and C2 domain p... 82 2e-14
gi|32412326|ref|XP_326643.1| hypothetical protein [Neurospora cr... 82 3e-14
gi|50417734|gb|AAH77937.1| Unknown (protein for MGC:80897) [Xeno... 82 3e-14
gi|50759804|ref|XP_417789.1| PREDICTED: similar to hypothetical ... 81 5e-14
gi|34870909|ref|XP_216529.2| similar to hypothetical protein AL1... 81 5e-14
gi|25407332|pir||A85067 hypothetical protein AT4g05330 [imported... 81 6e-14
gi|34853981|ref|XP_342613.1| similar to MR1-interacting protein ... 81 6e-14
gi|31981560|ref|NP_598477.2| RIKEN cDNA 1810031K02 [Mus musculus... 81 6e-14
gi|18412932|ref|NP_567292.1| zinc finger and C2 domain protein, ... 81 6e-14
gi|28317046|gb|AAO39542.1| RE07016p [Drosophila melanogaster] 80 8e-14
gi|24584217|ref|NP_723849.1| CG31811-PB [Drosophila melanogaster... 80 8e-14
gi|24584226|ref|NP_723850.1| CG31811-PC [Drosophila melanogaster... 80 8e-14
gi|47271204|gb|AAT27272.1| RE36656p [Drosophila melanogaster] 80 8e-14
gi|7287794|gb|AAF44832.1| symbol=BG:DS08220.1; cDNA=method:''sim... 80 8e-14
gi|23943872|ref|NP_073570.1| hypothetical protein AL133206 [Homo... 80 8e-14
gi|7650487|gb|AAF66064.1| Centaurin Gamma 1A [Drosophila melanog... 80 8e-14
gi|24584224|ref|NP_523562.2| CG31811-PA [Drosophila melanogaster... 80 8e-14
gi|50555994|ref|XP_505405.1| hypothetical protein [Yarrowia lipo... 80 1e-13
gi|21594052|gb|AAM65970.1| putative GTPase activating protein [A... 80 1e-13
gi|18415638|ref|NP_567620.1| zinc finger and C2 domain protein (... 80 1e-13
gi|49080830|ref|XP_403890.1| hypothetical protein UM06275.1 [Ust... 80 1e-13
gi|31240049|ref|XP_320438.1| ENSANGP00000016918 [Anopheles gambi... 79 2e-13
gi|21755825|dbj|BAC04766.1| unnamed protein product [Homo sapiens] 79 2e-13
gi|16799069|ref|NP_114152.2| centaurin, gamma 3; MRIP-1 protein ... 79 2e-13
gi|10241722|emb|CAC09448.1| hypothetical protein [Homo sapiens] 79 2e-13
gi|29476829|gb|AAH48300.1| CENTG3 protein [Homo sapiens] 79 2e-13
gi|50312541|ref|XP_456306.1| unnamed protein product [Kluyveromy... 79 2e-13
gi|47076964|dbj|BAD18418.1| unnamed protein product [Homo sapiens] 79 2e-13
gi|21411458|gb|AAH31173.1| Centg3 protein [Mus musculus] 79 2e-13
gi|26348040|dbj|BAC37668.1| unnamed protein product [Mus musculus] 79 2e-13
gi|49072718|ref|XP_400648.1| hypothetical protein UM03033.1 [Ust... 79 2e-13
gi|27923745|sp|Q96P47|CEG3_HUMAN Centaurin gamma 3 >gnl|BL_ORD_I... 79 2e-13
gi|21040229|ref|NP_631892.1| centaurin, gamma 3; MR1-interacting... 79 2e-13
gi|14042076|dbj|BAB55097.1| unnamed protein product [Homo sapiens] 79 2e-13
gi|6807591|emb|CAB70912.1| hypothetical protein [Homo sapiens] 79 3e-13
gi|50794700|ref|XP_423713.1| PREDICTED: similar to centaurin, ga... 79 3e-13
gi|47212345|emb|CAF94957.1| unnamed protein product [Tetraodon n... 78 5e-13
gi|28850396|gb|AAM08488.2| similar to Arabidopsis thaliana (Mous... 77 9e-13
gi|7023161|dbj|BAA91862.1| unnamed protein product [Homo sapiens] 77 9e-13
gi|40789044|dbj|BAA83051.2| KIAA1099 protein [Homo sapiens] 77 9e-13
gi|47123063|gb|AAH70738.1| MGC83730 protein [Xenopus laevis] 77 9e-13
gi|7662484|ref|NP_055729.1| centaurin, gamma 2; Arf GAP with GTP... 77 9e-13
gi|46436147|gb|EAK95515.1| hypothetical protein CaO19.1396 [Cand... 77 9e-13
gi|6648206|gb|AAF21204.1| putative GTPase activating protein [Ar... 77 9e-13
gi|30680493|ref|NP_187451.2| zinc finger and C2 domain protein, ... 77 9e-13
gi|24651922|ref|NP_610424.1| CG8243-PA [Drosophila melanogaster]... 77 9e-13
gi|20152063|gb|AAM11391.1| RE02759p [Drosophila melanogaster] 77 9e-13
gi|47230025|emb|CAG10439.1| unnamed protein product [Tetraodon n... 77 1e-12
gi|42659500|ref|XP_374807.1| similar to ARF GTPase-activating pr... 76 1e-12
gi|37360242|dbj|BAC98099.1| mKIAA1099 protein [Mus musculus] 76 1e-12
gi|49088502|ref|XP_406068.1| hypothetical protein AN1931.2 [Aspe... 76 1e-12
gi|30017461|ref|NP_835220.1| centaurin, gamma 2 [Mus musculus] >... 76 1e-12
gi|48102225|ref|XP_392754.1| similar to CG6742-PA [Apis mellifera] 76 1e-12
gi|50260352|gb|EAL23011.1| hypothetical protein CNBA7780 [Crypto... 76 1e-12
gi|50759237|ref|XP_417581.1| PREDICTED: similar to Centaurin, be... 76 2e-12
gi|21428352|gb|AAM49836.1| GM06875p [Drosophila melanogaster] 76 2e-12
gi|17738139|ref|NP_524458.1| CG6742-PA [Drosophila melanogaster]... 76 2e-12
gi|47220354|emb|CAF98453.1| unnamed protein product [Tetraodon n... 76 2e-12
gi|47210555|emb|CAF93523.1| unnamed protein product [Tetraodon n... 76 2e-12
gi|26330696|dbj|BAC29078.1| unnamed protein product [Mus musculus] 76 2e-12
gi|28571836|ref|NP_732826.2| CG6742-PB [Drosophila melanogaster]... 76 2e-12
gi|17861564|gb|AAL39259.1| GH12888p [Drosophila melanogaster] 76 2e-12
gi|47077675|dbj|BAD18718.1| FLJ00312 protein [Homo sapiens] 75 3e-12
gi|37077982|sp|Q9ULH1|DDF1_HUMAN 130-kDa phosphatidylinositol 4,... 75 3e-12
gi|34866540|ref|XP_235296.2| similar to mKIAA1249 protein [Rattu... 75 3e-12
gi|4063616|gb|AAC98350.1| ADP-ribosylation factor-directed GTPas... 75 3e-12
gi|18916856|dbj|BAB85561.1| KIAA1975 protein [Homo sapiens] 75 3e-12
gi|33859534|ref|NP_034156.1| development and differentiation enh... 75 3e-12
gi|46094081|ref|NP_060952.2| development and differentiation enh... 75 3e-12
gi|6330854|dbj|BAA86563.1| KIAA1249 protein [Homo sapiens] 75 3e-12
gi|28981429|gb|AAH48818.1| Ddef1 protein [Mus musculus] 75 3e-12
gi|42659348|ref|XP_370567.2| KIAA1975 protein [Homo sapiens] 75 3e-12
gi|50257847|gb|EAL20548.1| hypothetical protein CNBE4680 [Crypto... 75 3e-12
gi|28972686|dbj|BAC65759.1| mKIAA1249 protein [Mus musculus] 75 3e-12
gi|34873104|ref|XP_233719.2| similar to CENTB5 protein [Rattus n... 75 3e-12
gi|19263343|ref|NP_597703.1| centaurin, gamma-like family, membe... 75 3e-12
gi|41149212|ref|XP_084445.8| similar to ARF GTPase-activating pr... 75 3e-12
gi|38105886|gb|EAA52262.1| hypothetical protein MG04954.4 [Magna... 75 3e-12
gi|31239015|ref|XP_319921.1| ENSANGP00000005278 [Anopheles gambi... 75 3e-12
gi|42659314|ref|XP_374801.1| similar to ARF GTPase-activating pr... 75 3e-12
gi|42659394|ref|XP_374799.1| similar to ARF GTPase-activating pr... 75 3e-12
gi|47213252|emb|CAF92913.1| unnamed protein product [Tetraodon n... 75 4e-12
gi|47123082|gb|AAH70750.1| MGC83760 protein [Xenopus laevis] 75 4e-12
gi|12697977|dbj|BAB21807.1| KIAA1716 protein [Homo sapiens] 75 4e-12
gi|38079084|ref|XP_131838.3| centaurin, beta 5 [Mus musculus] 75 4e-12
gi|46402197|ref|NP_997106.1| centaurin, beta 5 [Mus musculus] >g... 75 4e-12
gi|50414011|ref|XP_457351.1| unnamed protein product [Debaryomyc... 75 4e-12
gi|30109272|gb|AAH51194.1| CENTB5 protein [Homo sapiens] 75 4e-12
gi|47212738|emb|CAF90052.1| unnamed protein product [Tetraodon n... 75 4e-12
gi|28422704|gb|AAH47001.1| CENTB5 protein [Homo sapiens] 75 4e-12
gi|16945966|ref|NP_085152.1| centaurin, beta 5 [Homo sapiens] >g... 75 4e-12
gi|19112800|ref|NP_596008.1| putative gtpase activating protein.... 74 6e-12
gi|47217474|emb|CAG10243.1| unnamed protein product [Tetraodon n... 74 6e-12
gi|47212317|emb|CAF89615.1| unnamed protein product [Tetraodon n... 74 6e-12
gi|46136933|ref|XP_390158.1| hypothetical protein FG09982.1 [Gib... 74 6e-12
gi|37551204|ref|XP_170525.2| similar to ARF GTPase-activating pr... 74 6e-12
gi|28461267|ref|NP_787015.1| development and differentiation enh... 74 7e-12
gi|50510473|dbj|BAD32222.1| mKIAA0400 protein [Mus musculus] 74 1e-11
gi|34863212|ref|XP_343040.1| similar to development- and differe... 74 1e-11
gi|38648787|gb|AAH63308.1| DDEF2 protein [Homo sapiens] 74 1e-11
gi|45187789|ref|NP_984012.1| ADL084Wp [Eremothecium gossypii] >g... 74 1e-11
gi|19114360|ref|NP_593448.1| putative gtpase activating protein ... 74 1e-11
gi|40788243|dbj|BAA23696.2| KIAA0400 [Homo sapiens] 74 1e-11
gi|38094509|ref|XP_150333.5| similar to development- and differe... 74 1e-11
gi|40789069|dbj|BAA06418.2| KIAA0050 [Homo sapiens] 74 1e-11
gi|46397411|sp|Q7SIG6|DDF2_MOUSE Development and differentiation... 74 1e-11
gi|47229056|emb|CAG03808.1| unnamed protein product [Tetraodon n... 74 1e-11
gi|4502249|ref|NP_003878.1| development- and differentiation-enh... 74 1e-11
gi|15219822|ref|NP_176283.1| ARF GTPase-activating domain-contai... 74 1e-11
gi|19386828|dbj|BAB86206.1| putative zinc finger and C2 domain p... 74 1e-11
gi|6730310|pdb|1DCQ|A Chain A, Crystal Structure Of The Arf-Gap ... 74 1e-11
gi|7661880|ref|NP_055531.1| centaurin beta1; Arf GAP with coiled... 74 1e-11
gi|29476839|gb|AAH48341.1| CTGLF1 protein [Homo sapiens] 73 1e-11
gi|42659415|ref|XP_370554.2| similar to ARF GTPase-activating pr... 73 1e-11
gi|46227994|gb|EAK88914.1| gata/ArfGAP, putative [Cryptosporidiu... 73 1e-11
gi|22766903|gb|AAH37481.1| Centb1 protein [Mus musculus] 73 1e-11
gi|27881415|ref|NP_722483.2| centaurin, beta 1 [Mus musculus] >g... 73 1e-11
gi|31199009|ref|XP_308452.1| ENSANGP00000018350 [Anopheles gambi... 73 2e-11
gi|32405192|ref|XP_323209.1| hypothetical protein [Neurospora cr... 73 2e-11
gi|23478603|gb|EAA15645.1| homeobox-containing protein [Plasmodi... 72 2e-11
gi|50732044|ref|XP_425945.1| PREDICTED: similar to Ddef1 protein... 72 2e-11
gi|50417708|gb|AAH77879.1| Unknown (protein for MGC:80649) [Xeno... 72 2e-11
gi|46135967|ref|XP_389675.1| hypothetical protein FG09499.1 [Gib... 72 2e-11
gi|50292755|ref|XP_448810.1| unnamed protein product [Candida gl... 72 2e-11
gi|37359746|dbj|BAC97851.1| mKIAA0041 protein [Mus musculus] 72 3e-11
gi|38080666|ref|XP_358819.1| similar to mKIAA0041 protein [Mus m... 72 3e-11
gi|50755479|ref|XP_414759.1| PREDICTED: similar to centaurin, al... 72 3e-11
gi|37590722|gb|AAH59321.1| MGC69045 protein [Xenopus laevis] 72 3e-11
gi|38014511|gb|AAH60484.1| MGC68712 protein [Xenopus laevis] 72 3e-11
gi|45735988|dbj|BAD13017.1| putative zinc finger and C2 domain p... 72 3e-11
gi|38079739|ref|XP_193836.3| RIKEN cDNA 9530039J15 [Mus musculus] 72 3e-11
gi|29249253|gb|EAA40769.1| GLP_608_56961_57905 [Giardia lamblia ... 72 4e-11
gi|47220682|emb|CAG11751.1| unnamed protein product [Tetraodon n... 72 4e-11
gi|6322145|ref|NP_012220.1| ADP-ribosylation factor (ARF) GTPase... 72 4e-11
gi|50752255|ref|XP_422706.1| PREDICTED: similar to ACAP2 [Gallus... 72 4e-11
gi|49116666|gb|AAH73417.1| Unknown (protein for MGC:80883) [Xeno... 72 4e-11
gi|28385994|gb|AAH46455.1| Similar to centaurin, beta 2 [Mus mus... 72 4e-11
gi|7661962|ref|NP_055585.1| centaurin, gamma 1; centaurin gamma1... 71 5e-11
gi|17986212|gb|AAC39522.2| KIAA0167 [Homo sapiens] 71 5e-11
gi|25989575|gb|AAM97540.1| PI 3-kinase enhancer long isoform [Ho... 71 5e-11
gi|4225948|emb|CAA10736.1| centaurin gamma 1A [Caenorhabditis el... 71 5e-11
gi|32564722|ref|NP_499350.2| CeNTaurin, gamma 1 (105.4 kD) (cnt-... 71 5e-11
gi|27529706|dbj|BAA05064.2| KIAA0041 [Homo sapiens] 71 5e-11
gi|7509671|pir||T26737 hypothetical protein Y39A1A.15a - Caenorh... 71 5e-11
gi|47118409|gb|AAT11274.1| ACAP2 [Oryctolagus cuniculus] 71 5e-11
gi|39932727|sp|Q15057|CEB2_HUMAN Centaurin beta 2 (Cnt-b2) 71 5e-11
gi|4688902|emb|CAB41450.1| centaurin beta2 [Homo sapiens] 71 5e-11
gi|40254842|ref|NP_036419.2| centaurin, beta 2; centaurin beta2;... 71 5e-11
gi|7509672|pir||T26738 hypothetical protein Y39A1A.15b - Caenorh... 71 5e-11
gi|47230091|emb|CAG10505.1| unnamed protein product [Tetraodon n... 71 5e-11
gi|7509673|pir||T26743 hypothetical protein Y39A1A.15c - Caenorh... 71 5e-11
gi|4225950|emb|CAA10737.1| centaurin gamma 1B [Caenorhabditis el... 71 5e-11
gi|17555716|ref|NP_499351.1| CeNTaurin, gamma 1 (123.1 kD) (cnt-... 71 5e-11
gi|40788892|dbj|BAA11484.2| KIAA0167 protein [Homo sapiens] 71 5e-11
gi|47777426|gb|AAT38060.1| putative zinc finger protein [Oryza s... 71 6e-11
gi|50744970|ref|XP_426197.1| PREDICTED: similar to stromal membr... 71 6e-11
gi|31198405|ref|XP_308150.1| ENSANGP00000020738 [Anopheles gambi... 70 8e-11
gi|41149339|ref|XP_058335.8| similar to ARF GTPase-activating pr... 70 8e-11
gi|25989573|gb|AAM97539.1| PI 3-kinase enhancer long isoform [Ra... 70 8e-11
gi|38090993|ref|XP_137397.3| similar to PI 3-kinase enhancer lon... 70 8e-11
gi|39591850|emb|CAE71428.1| Hypothetical protein CBG18339 [Caeno... 70 1e-10
gi|47225747|emb|CAG08090.1| unnamed protein product [Tetraodon n... 70 1e-10
gi|47200459|emb|CAF87550.1| unnamed protein product [Tetraodon n... 70 1e-10
gi|30684352|ref|NP_196834.2| ARF GTPase-activating domain-contai... 69 2e-10
gi|27806235|ref|NP_776938.1| centaurin, alpha 1 [Bos taurus] >gn... 69 2e-10
gi|11358303|pir||T48577 hypothetical protein T31B5.120 - Arabido... 69 2e-10
gi|47224775|emb|CAG00369.1| unnamed protein product [Tetraodon n... 69 2e-10
gi|11362839|pir||T43808 zinc finger protein [imported] - Encepha... 69 2e-10
gi|30681946|ref|NP_172556.2| ARF GTPase-activating domain-contai... 69 3e-10
gi|25402625|pir||D86242 hypothetical protein [imported] - Arabid... 69 3e-10
gi|38175545|dbj|BAD01238.1| putative ARF GTPase-activating domai... 68 4e-10
gi|15240398|ref|NP_201004.1| ARF GTPase-activating domain-contai... 68 4e-10
gi|31203135|ref|XP_310516.1| ENSANGP00000017294 [Anopheles gambi... 68 5e-10
gi|50540504|ref|NP_001002715.1| zgc:92360 [Danio rerio] >gnl|BL_... 67 7e-10
gi|46125485|ref|XP_387296.1| hypothetical protein FG07120.1 [Gib... 67 9e-10
gi|49388165|dbj|BAD25291.1| putative ADP-ribosylation factor-dir... 67 9e-10
gi|39591489|emb|CAE73543.1| Hypothetical protein CBG21011 [Caeno... 67 9e-10
gi|47217305|emb|CAG12513.1| unnamed protein product [Tetraodon n... 67 9e-10
gi|19923540|ref|NP_060177.2| up-regulated in liver cancer 1; sim... 67 1e-09
gi|38173784|gb|AAH60786.1| Up-regulated in liver cancer 1 [Homo ... 67 1e-09
gi|11359957|pir||T46305 hypothetical protein DKFZp434D1411.1 - h... 67 1e-09
gi|49071514|ref|XP_400046.1| hypothetical protein UM02431.1 [Ust... 66 2e-09
gi|47212712|emb|CAF90510.1| unnamed protein product [Tetraodon n... 66 2e-09
gi|48140501|ref|XP_397124.1| similar to Ddef1 protein [Apis mell... 66 2e-09
gi|19173494|ref|NP_597297.1| putative zinc finger protein [Encep... 66 2e-09
gi|45361417|ref|NP_989286.1| hypothetical protein MGC76109 [Xeno... 65 3e-09
gi|49523056|gb|AAH75518.1| MGC76109 protein [Xenopus tropicalis] 65 3e-09
gi|11359444|pir||T49496 hypothetical protein B14D6.480 [imported... 65 3e-09
gi|19424252|ref|NP_598251.1| centaurin, alpha 1 [Rattus norvegic... 65 3e-09
gi|49093900|ref|XP_408411.1| hypothetical protein AN4274.2 [Aspe... 65 3e-09
gi|1435195|gb|AAC52683.1| centaurin alpha 65 4e-09
gi|4200342|emb|CAA07581.1| centaurin beta [Rattus norvegicus] >g... 65 4e-09
gi|38081360|ref|XP_355658.1| similar to centaurin, alpha 1 [Mus ... 65 4e-09
gi|4225944|emb|CAA10734.1| centaurin beta 1A [Caenorhabditis ele... 64 6e-09
gi|17536947|ref|NP_496569.1| CeNTaurin, beta (90.6 kD) (cnt-1) [... 64 6e-09
gi|6806913|ref|NP_006860.1| centaurin, alpha 1; centaurin-alpha ... 64 6e-09
gi|6434439|emb|CAA19462.2| Hypothetical protein Y17G7B.15b [Caen... 64 6e-09
gi|32564605|ref|NP_496570.3| CeNTaurin, beta (81.4 kD) (cnt-1) [... 64 6e-09
gi|47523536|ref|NP_999391.1| inositol(1,3,4,5)tetrakisphosphate ... 64 6e-09
gi|7509429|pir||T26508 hypothetical protein Y17G7B.15 - Caenorha... 64 6e-09
gi|24586503|ref|NP_610354.2| CG30372-PA [Drosophila melanogaster... 64 8e-09
gi|38078894|ref|XP_131741.3| similar to up-regulated in liver ca... 64 8e-09
gi|7486586|pir||T04947 hypothetical protein F7J7.100 - Arabidops... 63 1e-08
gi|6468309|emb|CAB61580.1| hypothetical protein [Homo sapiens] 63 2e-08
gi|50750123|ref|XP_421880.1| PREDICTED: similar to centaurin, ga... 62 2e-08
gi|50728768|ref|XP_416275.1| PREDICTED: similar to IP4/PIP3 bind... 62 3e-08
gi|19112689|ref|NP_595897.1| csx2 protein [Schizosaccharomyces p... 62 3e-08
gi|47219048|emb|CAG00187.1| unnamed protein product [Tetraodon n... 62 4e-08
gi|50422807|ref|XP_459980.1| unnamed protein product [Debaryomyc... 61 5e-08
gi|50757819|ref|XP_415661.1| PREDICTED: similar to Centaurin-alp... 61 5e-08
gi|38110186|gb|EAA55946.1| hypothetical protein MG01597.4 [Magna... 61 6e-08
gi|21707306|gb|AAH33758.1| Centaurin-alpha 2 protein [Homo sapiens] 60 1e-07
gi|8923763|ref|NP_060874.1| centaurin-alpha 2 protein [Homo sapi... 60 1e-07
gi|47209145|emb|CAF91605.1| unnamed protein product [Tetraodon n... 59 2e-07
gi|47214064|emb|CAG00722.1| unnamed protein product [Tetraodon n... 59 2e-07
gi|46443186|gb|EAL02470.1| hypothetical protein CaO19.10568 [Can... 59 3e-07
gi|14329676|emb|CAC40651.1| centaurin beta [Homo sapiens] 59 3e-07
gi|9910340|ref|NP_064486.1| Centaurin-alpha2 protein [Rattus nor... 57 7e-07
gi|26006859|ref|NP_742145.1| centaurin, alpha 2 [Mus musculus] >... 57 9e-07
gi|45680425|gb|AAS75226.1| unknown protein [Oryza sativa (japoni... 57 1e-06
gi|20197515|gb|AAD15467.2| unknown protein [Arabidopsis thaliana] 57 1e-06
gi|25411567|pir||G84517 hypothetical protein At2g14490 [imported... 57 1e-06
gi|46437807|gb|EAK97147.1| hypothetical protein CaO19.13751 [Can... 56 2e-06
gi|28573879|ref|NP_610599.3| CG16728-PA [Drosophila melanogaster... 56 2e-06
gi|6320732|ref|NP_010812.1| ADP-ribosylation factor (ARF) GTPase... 56 2e-06
gi|47223628|emb|CAF99237.1| unnamed protein product [Tetraodon n... 56 2e-06
gi|45185633|ref|NP_983349.1| ACL055Wp [Eremothecium gossypii] >g... 56 2e-06
gi|50288879|ref|XP_446869.1| unnamed protein product [Candida gl... 55 4e-06
gi|30680774|ref|NP_172344.2| ARF GAP-like zinc finger-containing... 55 4e-06
gi|7485983|pir||T00722 hypothetical protein F22O13.17 - Arabidop... 55 4e-06
gi|30680768|ref|NP_850941.1| ARF GAP-like zinc finger-containing... 55 4e-06
gi|47212847|emb|CAF95237.1| unnamed protein product [Tetraodon n... 55 5e-06
gi|47226504|emb|CAG08520.1| unnamed protein product [Tetraodon n... 55 5e-06
gi|50255563|gb|EAL18296.1| hypothetical protein CNBJ2190 [Crypto... 54 6e-06
gi|20521656|dbj|BAA34502.2| KIAA0782 protein [Homo sapiens] 54 6e-06
gi|45199244|ref|NP_986273.1| AFR725Cp [Eremothecium gossypii] >g... 54 6e-06
gi|28850338|gb|AAO53121.1| hypothetical protein [Dictyostelium d... 54 6e-06
gi|27923746|sp|Q96P48|CED2_HUMAN Centaurin delta 2 (Cnt-d2) >gnl... 54 6e-06
gi|16975484|ref|NP_056057.1| centaurin delta 2 isoform b; ARF-GA... 54 6e-06
gi|21264597|ref|NP_631920.1| centaurin delta 2 isoform a; ARF-GA... 54 6e-06
gi|29387351|gb|AAH48196.1| GIT1 protein [Homo sapiens] 54 8e-06
gi|34878015|ref|XP_223437.2| similar to PARX protein [Rattus nor... 54 8e-06
gi|37655161|ref|NP_081456.2| centaurin, delta 2 isoform 1 [Mus m... 54 8e-06
gi|13929158|ref|NP_114002.1| G protein-coupled receptor kinase i... 54 8e-06
gi|45501011|gb|AAH67358.1| GIT1 protein [Homo sapiens] 54 8e-06
gi|41393573|ref|NP_054749.2| G protein-coupled receptor kinase i... 54 8e-06
gi|4691726|gb|AAD28046.1| ARF GTPase-activating protein GIT1 [Ho... 54 8e-06
gi|37360090|dbj|BAC98023.1| mKIAA0782 protein [Mus musculus] 54 8e-06
gi|19115065|ref|NP_594153.1| hypothetical GTPase activating prot... 54 8e-06
gi|22328591|ref|NP_193071.2| human Rev interacting-like protein-... 54 1e-05
gi|50747160|ref|XP_426346.1| PREDICTED: similar to centaurin del... 54 1e-05
gi|12060548|gb|AAG48161.1| p95-APP2 [Gallus gallus] 54 1e-05
gi|45383009|ref|NP_989537.1| G protein-coupled receptor kinase-i... 54 1e-05
gi|27695319|gb|AAH43062.1| Git2 protein [Mus musculus] 53 1e-05
gi|31199847|ref|XP_308871.1| ENSANGP00000007736 [Anopheles gambi... 53 1e-05
gi|49116662|gb|AAH73412.1| Unknown (protein for MGC:80878) [Xeno... 53 1e-05
gi|29421176|dbj|BAA25506.2| KIAA0580 protein [Homo sapiens] 53 1e-05
gi|34447227|ref|NP_062808.2| G protein-coupled receptor kinase-i... 53 1e-05
gi|47077691|dbj|BAD18726.1| FLJ00357 protein [Homo sapiens] 53 1e-05
gi|21264592|ref|NP_056045.2| centaurin delta 1 isoform a; PARX p... 53 1e-05
gi|16974764|gb|AAL32459.1| PARX protein [Homo sapiens] 53 1e-05
gi|16118245|gb|AAL12170.1| ARAP2 [Homo sapiens] 53 1e-05
gi|18203126|sp|Q9JLQ2|GIT2_MOUSE ARF GTPase-activating protein G... 53 1e-05
gi|7513028|pir||T00342 hypothetical protein KIAA0580 - human (fr... 53 1e-05
gi|34872665|ref|XP_222231.2| similar to Git2 protein [Rattus nor... 53 1e-05
gi|45383548|ref|NP_989627.1| G protein-coupled receptor kinase i... 53 1e-05
gi|47212642|emb|CAF92954.1| unnamed protein product [Tetraodon n... 53 2e-05
gi|47156967|gb|AAT12346.1| putative zinc finger protein-like pro... 52 2e-05
gi|18700711|gb|AAL78678.1| dual-specificity Rho- and Arf-GTPase ... 52 3e-05
gi|27885015|ref|NP_631945.1| ARF-GAP, RHO-GAP, ankyrin repeat an... 52 3e-05
gi|45829821|gb|AAH68145.1| ARF-GAP, RHO-GAP, ankyrin repeat and ... 52 3e-05
gi|47208970|emb|CAF92925.1| unnamed protein product [Tetraodon n... 52 3e-05
gi|26343231|dbj|BAC35272.1| unnamed protein product [Mus musculus] 52 3e-05
gi|34878832|ref|XP_341603.1| similar to ARF-GAP, RHO-GAP, ankyri... 52 3e-05
gi|17149830|ref|NP_476510.1| G protein-coupled receptor kinase-i... 51 5e-05
gi|20521834|dbj|BAA09769.2| The KIAA0148 gene product is related... 51 5e-05
gi|21237786|ref|NP_055591.2| G protein-coupled receptor kinase-i... 51 5e-05
gi|30585067|gb|AAP36806.1| Homo sapiens G protein-coupled recept... 51 5e-05
gi|21237794|ref|NP_631940.1| G protein-coupled receptor kinase-i... 51 5e-05
gi|49065562|emb|CAG38599.1| GIT2 [Homo sapiens] 51 5e-05
gi|17149832|ref|NP_476511.1| G protein-coupled receptor kinase-i... 51 5e-05
gi|26331890|dbj|BAC29675.1| unnamed protein product [Mus musculus] 51 7e-05
gi|47210894|emb|CAF90404.1| unnamed protein product [Tetraodon n... 50 9e-05
gi|6321257|ref|NP_011334.1| Contains a zinc-finger in the N-term... 50 9e-05
gi|18000295|gb|AAL54909.1| IP4/PIP3 binding protein-like protein... 50 1e-04
gi|49387900|dbj|BAD25003.1| human Rev interacting-like protein-l... 50 1e-04
gi|48102438|ref|XP_395358.1| similar to ENSANGP00000007736 [Apis... 50 1e-04
gi|49387899|dbj|BAD25002.1| ZIGA2 protein-like [Oryza sativa (ja... 50 1e-04
gi|21264337|ref|NP_071926.4| ARF-GAP, RHO-GAP, ankyrin repeat an... 49 2e-04
gi|47214065|emb|CAG00723.1| unnamed protein product [Tetraodon n... 49 2e-04
gi|50550125|ref|XP_502535.1| hypothetical protein [Yarrowia lipo... 49 3e-04
gi|47682845|gb|AAH70736.1| MGC83726 protein [Xenopus laevis] 48 6e-04
gi|34909220|ref|NP_915957.1| putative ARF GAP-like zinc finger-c... 47 0.001
gi|34784857|gb|AAH56768.1| HIV-1 Rev binding protein [Danio rerio] 46 0.002
gi|41055720|ref|NP_956129.1| HIV-1 Rev binding protein [Danio re... 46 0.002
gi|38091496|ref|XP_126291.5| similar to G protein-coupled recept... 46 0.002
gi|38570132|ref|NP_004495.2| HIV-1 Rev binding protein; Rab, Rev... 46 0.002
gi|26325842|dbj|BAC26675.1| unnamed protein product [Mus musculus] 46 0.002
gi|33563260|ref|NP_034602.1| HIV-1 Rev binding protein [Mus musc... 46 0.002
gi|950051|emb|CAA61667.1| nucleoporin-like protein [Homo sapiens] 46 0.002
gi|47227956|emb|CAF97585.1| unnamed protein product [Tetraodon n... 46 0.002
gi|31236158|ref|XP_319366.1| ENSANGP00000012183 [Anopheles gambi... 45 0.003
gi|50293251|ref|XP_449037.1| unnamed protein product [Candida gl... 45 0.004
gi|50306009|ref|XP_452966.1| unnamed protein product [Kluyveromy... 45 0.005
gi|34871387|ref|XP_222017.2| similar to RIKEN cDNA A630095P14 [R... 44 0.008
gi|26340146|dbj|BAC33736.1| unnamed protein product [Mus musculus] 44 0.008
gi|14424764|gb|AAH09393.1| HRBL protein [Homo sapiens] 44 0.011
gi|21704138|ref|NP_663541.1| HIV-1 Rev-binding protein-like prot... 44 0.011
gi|30039690|ref|NP_835456.1| HIV-1 Rev-binding protein-like prot... 44 0.011
gi|39582118|emb|CAE60795.1| Hypothetical protein CBG04486 [Caeno... 44 0.011
gi|49035762|sp|O95081|HRBL_HUMAN HIV-1 Rev binding protein-like ... 44 0.011
gi|4102709|gb|AAD01550.1| RAB-R protein [Homo sapiens] 44 0.011
gi|21361326|ref|NP_006067.2| HIV-1 Rev-binding protein-like prot... 44 0.011
gi|39644456|gb|AAH04874.2| CENTB5 protein [Homo sapiens] 43 0.018
gi|7499099|pir||T20898 hypothetical protein F14F3.2 - Caenorhabd... 43 0.018
gi|25147080|ref|NP_509761.2| G protein-coupled receptor kinase-i... 43 0.018
gi|34859394|ref|XP_230701.2| similar to HIV-1 Rev binding protei... 43 0.018
gi|41053619|ref|NP_956882.1| hypothetical protein MGC66055 [Dani... 42 0.031
gi|3834641|gb|AAC71035.1| Drongo [Drosophila melanogaster] 41 0.053
gi|17137344|ref|NP_477239.1| CG3365-PB [Drosophila melanogaster]... 41 0.069
gi|29245305|gb|EAA36952.1| GLP_333_15386_14190 [Giardia lamblia ... 39 0.20
gi|34876999|ref|XP_343609.1| similar to HIV-1 Rev binding protei... 39 0.34
gi|9802557|gb|AAF99759.1| F22O13.16 [Arabidopsis thaliana] 37 0.76
gi|47216462|emb|CAG02113.1| unnamed protein product [Tetraodon n... 37 1.3
gi|34858812|ref|XP_341896.1| similar to KIAA0782 protein [Rattus... 37 1.3
gi|22532289|gb|AAM97883.1| envelope glycoprotein [Human immunode... 34 8.4
gi|24647644|ref|NP_650611.1| CG4090-PA [Drosophila melanogaster]... 34 8.4
>gi|17508013|ref|NP_492310.1| ADP-ribosylation factor GTPase
activating protein 1 (45.7 kD) (1J104) [Caenorhabditis
elegans]
gi|7505110|pir||T23223 hypothetical protein K02B12.7 - Caenorhabditis
elegans
gi|3878163|emb|CAB00036.1| Hypothetical protein K02B12.7
[Caenorhabditis elegans]
Length = 423
Score = 673 bits (1737), Expect = 0.0
Identities = 345/423 (81%), Positives = 345/423 (81%)
Frame = -1
Query: 1272 MASPRTRRVLKELRPCDDNNFCFECEANNPQWVSVSYGIWICLECSGIHRSLGVHLSFVR 1093
MASPRTRRVLKELRPCDDNNFCFECEANNPQWVSVSYGIWICLECSGIHRSLGVHLSFVR
Sbjct: 1 MASPRTRRVLKELRPCDDNNFCFECEANNPQWVSVSYGIWICLECSGIHRSLGVHLSFVR 60
Query: 1092 SVTMDKWKDIELAKMKAGGNRKFAEFLQSQPDYKEKWTIQEKYNSRAAALFRDKVACEAE 913
SVTMDKWKDIELAKMKAGGNRKFAEFLQSQPDYKEKWTIQEKYNSRAAALFRDKVACEAE
Sbjct: 61 SVTMDKWKDIELAKMKAGGNRKFAEFLQSQPDYKEKWTIQEKYNSRAAALFRDKVACEAE 120
Query: 912 GREWSQSTSPAANYVPPTLGGMSSQSKPTXXXXXXXXXXXXXXXXXXXXXXXGDGAYSTQ 733
GREWSQSTSPAANYVPPTLGGMSSQSKPT GDGAYSTQ
Sbjct: 121 GREWSQSTSPAANYVPPTLGGMSSQSKPTNKSSGNSSLGSYYGGNSSYSQSTGDGAYSTQ 180
Query: 732 DSNSKYQGFGNTGYVPNQSNSGDDLLXXXXXXXXXXXXXXSKGASQAAAMAKDVGIQAQQ 553
DSNSKYQGFGNTGYVPNQSNSGDDLL SKGASQAAAMAKDVGIQAQQ
Sbjct: 181 DSNSKYQGFGNTGYVPNQSNSGDDLLAGAMSGLSMGWSMLSKGASQAAAMAKDVGIQAQQ 240
Query: 552 KASQLSENVSQNNSLFGGVANKASEVGTKSWDGLSSFVKSPSLNAFSGILAKTGYEDFXX 373
KASQLSENVSQNNSLFGGVANKASEVGTKSWDGLSSFVKSPSLNAFSGILAKTGYEDF
Sbjct: 241 KASQLSENVSQNNSLFGGVANKASEVGTKSWDGLSSFVKSPSLNAFSGILAKTGYEDFGG 300
Query: 372 XXXXXXXXXSQNEFNDWLKQSNLPRGTTEGGDHLSNXXXXXXXXXXXXXXXERSVKPVQS 193
SQNEFNDWLKQSNLPRGTTEGGDHLSN ERSVKPVQS
Sbjct: 301 GGGGMSGSSSQNEFNDWLKQSNLPRGTTEGGDHLSNEELKPTEPVETKKKKERSVKPVQS 360
Query: 192 KEKVTAENVEDDDSSSTITQFESSFNKPKTTAPRLXXXXXXXXXXXXXXXKGWDDDAWDL 13
KEKVTAENVEDDDSSSTITQFESSFNKPKTTAPRL KGWDDDAWDL
Sbjct: 361 KEKVTAENVEDDDSSSTITQFESSFNKPKTTAPRLAPVAAAPPKKKEEKAKGWDDDAWDL 420
Query: 12 LNQ 4
LNQ
Sbjct: 421 LNQ 423