Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= K02E7_7
(960 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|7505153|pir||T32393 hypothetical protein K02E7.4 - Caenorhabd... 651 0.0
gi|32565871|ref|NP_872071.1| predicted CDS, putative cytoplasmic... 475 e-133
gi|32565174|ref|NP_493905.2| putative protein (6.8 kD) (2B361) [... 94 3e-18
gi|17533427|ref|NP_494315.1| tumor necrosis factor protein like ... 88 3e-16
gi|7499686|pir||T32065 hypothetical protein F22E5.8 - Caenorhabd... 88 3e-16
gi|7496212|pir||T31922 hypothetical protein C17F4.4 - Caenorhabd... 87 6e-16
gi|17531929|ref|NP_494485.1| tumor necrosis factor protein like ... 86 1e-15
gi|7510657|pir||T25976 hypothetical protein ZC239.14 - Caenorhab... 83 8e-15
gi|17537787|ref|NP_494479.1| tumor necrosis factor protein like ... 83 8e-15
gi|49035209|gb|AAK72056.2| Hypothetical protein C17F4.8 [Caenorh... 81 4e-14
gi|17537789|ref|NP_494481.1| tumor necrosis factor protein like ... 79 1e-13
gi|17531265|ref|NP_494230.1| tumor necrosis factor protein like ... 77 4e-13
gi|17532341|ref|NP_494196.1| binding protein 1 like family membe... 77 6e-13
gi|17534921|ref|NP_493993.1| k+ channel tetramerisation containi... 75 3e-12
gi|17537777|ref|NP_494476.1| tumor necrosis factor protein like ... 74 5e-12
gi|7497242|pir||T33590 hypothetical protein C40A11.6 - Caenorhab... 71 3e-11
gi|17533423|ref|NP_494320.1| tumor necrosis factor protein like ... 71 3e-11
gi|17532347|ref|NP_494197.1| tumor necrosis factor alpha-inducib... 71 3e-11
gi|34365970|gb|AAB66172.2| Hypothetical protein F22E5.6 [Caenorh... 71 3e-11
gi|32565260|ref|NP_494198.2| k+ channel tetramerisation containi... 71 4e-11
gi|33285212|gb|AAC68760.3| Hypothetical protein C40A11.2 [Caenor... 71 4e-11
gi|7497238|pir||T33591 hypothetical protein C40A11.2 - Caenorhab... 71 4e-11
gi|39584625|emb|CAE72378.1| Hypothetical protein CBG19532 [Caeno... 70 7e-11
gi|17532349|ref|NP_494199.1| tumor necrosis factor protein like ... 70 7e-11
gi|17537783|ref|NP_494473.1| tumor necrosis factor protein like ... 69 2e-10
gi|39579832|emb|CAE56658.1| Hypothetical protein CBG24423 [Caeno... 69 2e-10
gi|17537791|ref|NP_494482.1| tumor necrosis factor alpha-induced... 68 3e-10
gi|39591890|emb|CAE71468.1| Hypothetical protein CBG18386 [Caeno... 67 5e-10
gi|10863937|ref|NP_066960.1| tumor necrosis factor, alpha-induce... 67 5e-10
gi|482321|pir||A41784 tumor necrosis factor-alpha-induced protei... 67 5e-10
gi|33636730|ref|NP_891995.1| tumor necrosis factor, alpha-induce... 65 2e-09
gi|13994353|ref|NP_114160.1| potassium channel tetramerisation d... 64 7e-09
gi|14042295|dbj|BAB55188.1| unnamed protein product [Homo sapiens] 64 7e-09
gi|32309479|gb|AAP79438.1| tumor necrosis factor alpha-induced p... 63 9e-09
gi|3114713|gb|AAC78826.1| Edp1 protein [Mus musculus] >gnl|BL_OR... 63 9e-09
gi|47224923|emb|CAG06493.1| unnamed protein product [Tetraodon n... 63 9e-09
gi|29725637|ref|NP_080421.2| potassium channel tetramerization d... 63 1e-08
gi|47087317|ref|NP_998643.1| zgc:63846 [Danio rerio] >gnl|BL_ORD... 63 1e-08
gi|47027968|gb|AAT09002.1| potassium channel tetramerization dom... 63 1e-08
gi|50756506|ref|XP_415191.1| PREDICTED: similar to potassium cha... 63 1e-08
gi|41054225|ref|NP_956093.1| tumor necrosis factor, alpha-induce... 62 2e-08
gi|17532343|ref|NP_494195.1| tumor necrosis factor protein like ... 62 3e-08
gi|31543878|ref|NP_033421.2| tumor necrosis factor, alpha-induce... 62 3e-08
gi|49035198|gb|AAC68758.2| Hypothetical protein C40A11.4 [Caenor... 61 4e-08
gi|50603619|gb|AAH77866.1| Unknown (protein for MGC:80602) [Xeno... 60 6e-08
gi|7510660|pir||T25980 hypothetical protein ZC239.17 - Caenorhab... 60 6e-08
gi|7510656|pir||T25977 hypothetical protein ZC239.13 - Caenorhab... 60 7e-08
gi|39581661|emb|CAE57169.1| Hypothetical protein CBG00003 [Caeno... 60 1e-07
gi|50758428|ref|XP_415918.1| PREDICTED: similar to tumor necrosi... 59 1e-07
gi|31216443|ref|XP_316233.1| ENSANGP00000017088 [Anopheles gambi... 59 1e-07
gi|50755761|ref|XP_414889.1| PREDICTED: similar to Potassium cha... 59 1e-07
gi|38454208|ref|NP_942031.1| PDIP1 [Rattus norvegicus] >gnl|BL_O... 59 1e-07
gi|17552822|ref|NP_499312.1| tumor necrosis factor protein like ... 59 1e-07
gi|17563898|ref|NP_507324.1| tumor necrosis factor protein like ... 59 2e-07
gi|17531267|ref|NP_494231.1| tumor necrosis factor alpha-induced... 59 2e-07
gi|12847892|dbj|BAB27750.1| unnamed protein product [Mus musculus] 59 2e-07
gi|37359818|dbj|BAC97887.1| mKIAA0176 protein [Mus musculus] 58 3e-07
gi|30794420|ref|NP_081284.1| potassium channel tetramerisation d... 58 3e-07
gi|17534883|ref|NP_494291.1| k+ channel tetramerisation containi... 58 3e-07
gi|49035126|gb|AAB66105.2| Hypothetical protein K02F6.5 [Caenorh... 58 3e-07
gi|17534877|ref|NP_494292.1| k+ channel tetramerisation containi... 58 3e-07
gi|27370096|ref|NP_766335.1| potassium channel tetramerisation d... 58 3e-07
gi|32564774|ref|NP_494474.2| k+ channel tetramerisation containi... 58 4e-07
gi|17534879|ref|NP_494290.1| polymerase delta-interacting protei... 58 4e-07
gi|7510665|pir||T25971 hypothetical protein ZC239.6 - Caenorhabd... 58 4e-07
gi|47226516|emb|CAG08532.1| unnamed protein product [Tetraodon n... 58 4e-07
gi|9506651|ref|NP_061865.1| potassium channel tetramerisation do... 57 5e-07
gi|33300420|emb|CAE17930.1| Hypothetical protein T08G3.13 [Caeno... 57 5e-07
gi|48106238|ref|XP_396071.1| similar to ENSANGP00000017088 [Apis... 57 5e-07
gi|34875337|ref|XP_343985.1| similar to KCTD2 protein [Rattus no... 57 6e-07
gi|30578412|ref|NP_849194.1| potassium channel tetramerisation d... 57 6e-07
gi|15072406|gb|AAK27301.1| TNFAIP1-like protein [Homo sapiens] 57 6e-07
gi|19921650|ref|NP_610165.1| CG10465-PA [Drosophila melanogaster... 57 8e-07
gi|47225999|emb|CAG04373.1| unnamed protein product [Tetraodon n... 57 8e-07
gi|50604158|gb|AAH77515.1| Unknown (protein for MGC:82704) [Xeno... 56 1e-06
gi|34870500|ref|XP_220224.2| similar to RIKEN cDNA 2610030N08 [R... 56 1e-06
gi|50370190|gb|AAH76863.1| Unknown (protein for MGC:84606) [Xeno... 56 1e-06
gi|16152040|gb|AAL14962.1| polymerase delta-interacting protein ... 56 1e-06
gi|46309467|ref|NP_996932.1| Unknown (protein for MGC:77244); wu... 55 3e-06
gi|39596122|emb|CAE69758.1| Hypothetical protein CBG16039 [Caeno... 54 4e-06
gi|17537779|ref|NP_494475.1| polymerase delta-interacting protei... 54 5e-06
gi|50403777|sp|Q14681|KDD2_HUMAN Potassium channel tetramerisati... 54 5e-06
gi|23272394|gb|AAH33329.1| KCTD2 protein [Homo sapiens] 54 5e-06
gi|34304089|ref|NP_899108.1| potassium channel tetramerisation d... 54 5e-06
gi|1136412|dbj|BAA11493.1| KIAA0176 [Homo sapiens] 54 5e-06
gi|39597204|emb|CAE59431.1| Hypothetical protein CBG02803 [Caeno... 53 9e-06
gi|47217614|emb|CAG03011.1| unnamed protein product [Tetraodon n... 53 9e-06
gi|50728786|ref|XP_416282.1| PREDICTED: similar to hypothetical ... 53 1e-05
gi|38048469|gb|AAR10137.1| similar to Drosophila melanogaster CG... 53 1e-05
gi|50745453|ref|XP_420119.1| PREDICTED: similar to Hypothetical ... 52 2e-05
gi|38077843|ref|XP_110121.4| expressed sequence AA414907 [Mus mu... 52 2e-05
gi|21410256|gb|AAH31038.1| FLJ12242 protein [Homo sapiens] 52 2e-05
gi|13489099|ref|NP_078957.1| hypothetical protein FLJ12242 [Homo... 52 2e-05
gi|39585069|emb|CAE62720.1| Hypothetical protein CBG06877 [Caeno... 52 2e-05
gi|34866908|ref|XP_217075.2| similar to hypothetical protein FLJ... 52 2e-05
gi|41150574|ref|XP_372680.1| similar to Hypothetical protein KIA... 52 3e-05
gi|17533315|ref|NP_496768.1| tumor necrosis factor alpha-induced... 52 3e-05
gi|3292929|emb|CAA19832.1| EG:196F3.2 [Drosophila melanogaster] 50 6e-05
gi|39588595|emb|CAE58118.1| Hypothetical protein CBG01205 [Caeno... 50 6e-05
gi|24639124|ref|NP_569926.2| CG32810-PB [Drosophila melanogaster... 50 6e-05
gi|29840923|gb|AAP05924.1| similar to NM_031954 MSTP028 protein ... 50 1e-04
gi|17533435|ref|NP_494318.1| k+ channel tetramerisation containi... 48 3e-04
gi|17533433|ref|NP_494317.1| tumor necrosis factor protein like ... 48 3e-04
gi|49035170|gb|AAB66175.2| Hypothetical protein F22E5.11 [Caenor... 48 3e-04
gi|17861850|gb|AAL39402.1| GM03763p [Drosophila melanogaster] 47 5e-04
gi|31204239|ref|XP_311068.1| ENSANGP00000019957 [Anopheles gambi... 47 8e-04
gi|17551116|ref|NP_508239.1| k+ channel tetramerisation containi... 46 0.001
gi|47228587|emb|CAG05407.1| unnamed protein product [Tetraodon n... 45 0.002
gi|49903979|gb|AAH76416.1| Zgc:101020 protein [Danio rerio] 45 0.002
gi|47196248|emb|CAF89012.1| unnamed protein product [Tetraodon n... 45 0.002
gi|27503738|gb|AAH42482.1| KCTD7 protein [Homo sapiens] 45 0.003
gi|26325874|dbj|BAC26691.1| unnamed protein product [Mus musculus] 45 0.003
gi|23308551|ref|NP_694578.1| potassium channel tetramerisation d... 45 0.003
gi|27369698|ref|NP_766097.1| potassium channel tetramerisation d... 45 0.003
gi|34872042|ref|XP_341069.1| similar to RIKEN cDNA 9430010P06 [R... 45 0.003
gi|48099351|ref|XP_394892.1| similar to ENSANGP00000004083 [Apis... 45 0.003
gi|17537773|ref|NP_494478.1| tumor necrosis factor alpha-induced... 44 0.004
gi|50759524|ref|XP_417677.1| PREDICTED: similar to potassium cha... 44 0.004
gi|17537775|ref|NP_494477.1| k+ channel tetramerisation containi... 44 0.004
gi|31201379|ref|XP_309637.1| ENSANGP00000004083 [Anopheles gambi... 44 0.004
gi|28571504|ref|NP_649465.3| CG14647-PA [Drosophila melanogaster... 44 0.005
gi|39592492|emb|CAE63569.1| Hypothetical protein CBG08057 [Caeno... 44 0.005
gi|19354519|gb|AAH24588.1| Similar to hypothetical protein MGC23... 44 0.005
gi|38088808|ref|XP_133614.2| similar to hypothetical protein MGC... 44 0.005
gi|46329875|gb|AAH68518.1| Potassium channel tetramerisation dom... 44 0.007
gi|39753959|ref|NP_060104.2| potassium channel tetramerisation d... 44 0.007
gi|34875254|ref|XP_344427.1| similar to AA675328 protein [Rattus... 44 0.007
gi|50400984|sp|Q80UN1|KDD9_MOUSE Potassium channel tetramerisati... 44 0.007
gi|34857847|ref|XP_218935.2| similar to hypothetical protein MGC... 44 0.007
gi|13027592|ref|NP_076419.1| hypothetical protein MGC2376 [Homo ... 43 0.009
gi|30186134|gb|AAH51544.1| Kctd7 protein [Mus musculus] 43 0.012
gi|50776278|ref|XP_423258.1| PREDICTED: similar to potassium cha... 43 0.012
gi|46249626|gb|AAH68871.1| MGC82296 protein [Xenopus laevis] 43 0.012
gi|15232005|ref|NP_187515.1| potassium channel tetramerisation d... 42 0.016
gi|13365905|dbj|BAB39326.1| hypothetical protein [Macaca fascicu... 42 0.016
gi|26449912|dbj|BAC42077.1| unknown protein [Arabidopsis thaliana] 42 0.016
gi|7503596|pir||T22320 hypothetical protein F46G10.1 - Caenorhab... 42 0.021
gi|24645528|ref|NP_649952.1| CG9467-PA [Drosophila melanogaster]... 42 0.027
gi|25152459|ref|NP_510217.2| DNA segment Chr 1 ERATO Doi 8 expre... 42 0.027
gi|21699030|ref|NP_619617.1| Sh3kbp1 binding protein 1; SETA bin... 41 0.035
gi|38494368|gb|AAH61477.1| Sh3kbp1 binding protein 1 [Mus musculus] 41 0.035
gi|10834652|gb|AAG23756.1| PP203 [Homo sapiens] 41 0.035
gi|19923917|ref|NP_612401.1| hypothetical protein BC007653 [Homo... 41 0.035
gi|47222945|emb|CAF99101.1| unnamed protein product [Tetraodon n... 41 0.046
gi|42657241|ref|XP_098368.4| KIAA1317 protein [Homo sapiens] 40 0.060
gi|47221392|emb|CAF97310.1| unnamed protein product [Tetraodon n... 40 0.060
gi|50755256|ref|XP_425217.1| PREDICTED: similar to KIAA1317 prot... 40 0.060
gi|34879324|ref|XP_225971.2| similar to KIAA1317 protein [Rattus... 40 0.060
gi|7243015|dbj|BAA92555.1| KIAA1317 protein [Homo sapiens] 40 0.060
gi|38083670|ref|XP_356997.1| similar to KIAA1317 protein [Mus mu... 40 0.060
gi|26335191|dbj|BAC31296.1| unnamed protein product [Mus musculus] 40 0.078
gi|34877405|ref|XP_344238.1| similar to hypothetical protein BC0... 40 0.078
gi|47211108|emb|CAF94964.1| unnamed protein product [Tetraodon n... 40 0.078
gi|21397267|gb|AAM51831.1| Putative FH protein interacting prote... 40 0.078
gi|26349785|dbj|BAC38532.1| unnamed protein product [Mus musculus] 40 0.078
gi|50731299|ref|XP_417221.1| PREDICTED: similar to hypothetical ... 40 0.078
gi|31982195|ref|NP_780728.2| potassium channel tetramerisation d... 40 0.078
gi|26335653|dbj|BAC31527.1| unnamed protein product [Mus musculus] 40 0.078
gi|38198663|ref|NP_938167.1| potassium channel tetramerisation d... 40 0.10
gi|47216460|emb|CAG02111.1| unnamed protein product [Tetraodon n... 40 0.10
gi|15240437|ref|NP_200311.1| potassium channel tetramerisation d... 39 0.13
gi|39596745|emb|CAE63364.1| Hypothetical protein CBG07773 [Caeno... 39 0.13
gi|30696554|ref|NP_851193.1| potassium channel tetramerisation d... 39 0.13
gi|50294876|ref|XP_449849.1| unnamed protein product [Candida gl... 39 0.13
gi|26333089|dbj|BAC30262.1| unnamed protein product [Mus musculus] 39 0.17
gi|46229461|gb|EAK90279.1| POZ+kelch domain protein with kelch r... 39 0.17
gi|35903041|ref|NP_919386.1| leftover [Danio rerio] >gnl|BL_ORD_... 39 0.17
gi|47217603|emb|CAG02530.1| unnamed protein product [Tetraodon n... 39 0.17
gi|17564592|ref|NP_505177.1| k+ channel tetramerisation containi... 39 0.17
gi|22760899|dbj|BAC11374.1| unnamed protein product [Homo sapiens] 39 0.23
gi|47219253|emb|CAG11715.1| unnamed protein product [Tetraodon n... 39 0.23
gi|47217202|emb|CAG11038.1| unnamed protein product [Tetraodon n... 39 0.23
gi|46228821|gb|EAK89691.1| POZ domain protein, related to tetram... 38 0.30
gi|50422867|ref|XP_460011.1| unnamed protein product [Debaryomyc... 38 0.30
gi|22761296|dbj|BAC11531.1| unnamed protein product [Homo sapiens] 38 0.30
gi|18606121|gb|AAH22893.1| KCTD6 protein [Homo sapiens] 38 0.30
gi|50754483|ref|XP_414405.1| PREDICTED: similar to potassium cha... 38 0.30
gi|34869548|ref|XP_223921.2| similar to hypothetical protein MGC... 38 0.30
gi|33871013|gb|AAH13868.1| KCTD3 protein [Homo sapiens] 38 0.39
gi|38181770|gb|AAH61458.1| Kctd3 protein [Mus musculus] 38 0.39
gi|46255026|ref|NP_057205.2| potassium channel tetramerisation d... 38 0.39
gi|5360115|gb|AAD42876.1| NY-REN-45 antigen [Homo sapiens] 38 0.39
gi|27369936|ref|NP_766238.1| potassium channel tetramerisation d... 38 0.39
gi|34881138|ref|XP_223057.2| similar to RIKEN cDNA E330032J19 [R... 38 0.39
gi|50288509|ref|XP_446684.1| unnamed protein product [Candida gl... 37 0.51
gi|50731305|ref|XP_425657.1| PREDICTED: similar to KCTD11 protei... 37 0.51
gi|50539726|ref|NP_001002329.1| zgc:91884 [Danio rerio] >gnl|BL_... 37 0.51
gi|47223165|emb|CAG11300.1| unnamed protein product [Tetraodon n... 37 0.51
gi|30425146|ref|NP_780638.1| potassium channel tetramerisation d... 37 0.66
gi|23509069|ref|NP_701737.1| hypothetical protein [Plasmodium fa... 37 0.66
gi|49104945|ref|XP_411293.1| hypothetical protein AN7156.2 [Aspe... 37 0.66
gi|29789207|ref|NP_082058.1| potassium channel tetramerisation d... 37 0.66
gi|34857778|ref|XP_214992.2| similar to glucosyltransferase [Rat... 37 0.86
gi|28828292|gb|AAO50956.1| hypothetical protein [Dictyostelium d... 37 0.86
gi|23346589|ref|NP_694783.1| retinoic acid, EGF, and NGF upregul... 36 1.1
gi|34871653|ref|XP_343924.1| similar to REN [Rattus norvegicus] 36 1.1
gi|37534712|ref|NP_921658.1| putative FH protein interacting pro... 36 1.1
gi|39581604|emb|CAE58389.1| Hypothetical protein CBG01518 [Caeno... 36 1.1
gi|15921163|ref|NP_376832.1| 704aa long hypothetical glycosyltra... 36 1.5
gi|42659746|ref|XP_374915.1| similar to KCTD11 protein [Homo sap... 36 1.5
gi|49076548|ref|XP_402237.1| hypothetical protein UM04622.1 [Ust... 36 1.5
gi|31203331|ref|XP_310614.1| ENSANGP00000019366 [Anopheles gambi... 35 1.9
gi|15235765|ref|NP_194823.1| potassium channel tetramerisation d... 35 1.9
gi|50345110|ref|NP_001002224.1| zgc:92463 [Danio rerio] >gnl|BL_... 35 1.9
gi|23508797|ref|NP_701465.1| 50S ribosomal protein L1, putative ... 35 1.9
gi|15604315|ref|NP_220831.1| ATP-DEPENDENT PROTEASE LA (lon) [R... 35 1.9
gi|18404701|ref|NP_565886.1| AMP deaminase, putative / myoadenyl... 35 2.5
gi|49115408|gb|AAH73355.1| Unknown (protein for MGC:80773) [Xeno... 35 2.5
gi|47211185|emb|CAF92412.1| unnamed protein product [Tetraodon n... 35 2.5
gi|47222919|emb|CAF99075.1| unnamed protein product [Tetraodon n... 35 2.5
gi|5922018|gb|AAD56303.1| AMP deaminase isoform L [Homo sapiens] 35 2.5
gi|7497086|pir||T33075 hypothetical protein C35E7.4 - Caenorhabd... 35 2.5
gi|7484807|pir||T01259 AMP deaminase homolog F16M14.21 - Arabido... 35 2.5
gi|42661083|ref|XP_085689.4| similar to KCTD11 protein [Homo sap... 35 2.5
gi|644509|gb|AAA62126.1| AMP deaminase isoform L splicing variant 35 2.5
gi|22267966|gb|AAH16662.2| Ampd2 protein [Mus musculus] 35 2.5
gi|608499|gb|AAC50308.1| AMP deaminase 35 2.5
gi|345738|pir||A44313 AMP deaminase (EC 3.5.4.6) isoform L - hum... 35 2.5
gi|178547|gb|AAA62127.1| AMP deaminase isoform L 35 2.5
gi|34147621|ref|NP_631895.1| adenosine monophosphate deaminase 2... 35 2.5
gi|21311925|ref|NP_083055.1| adenosine monophosphate deaminase 2... 35 2.5
gi|18044361|gb|AAH19929.1| KCTD11 protein [Homo sapiens] 35 2.5
gi|21264318|ref|NP_004028.3| adenosine monophosphate deaminase 2... 35 2.5
gi|36958609|gb|AAQ87077.1| Putative 4,5,-dihydroxyphthalate dehy... 35 3.3
gi|23490772|gb|EAA22466.1| unnamed protein product, putative [Pl... 35 3.3
gi|23508260|ref|NP_700929.1| hypothetical protein [Plasmodium fa... 35 3.3
gi|47229629|emb|CAG06825.1| unnamed protein product [Tetraodon n... 34 4.3
gi|50400892|sp|Q6WVG3|KD12_MOUSE Potassium channel tetramerisati... 34 4.3
gi|27732763|ref|XP_232766.1| similar to RIKEN cDNA 2410081M15 [R... 34 4.3
gi|47230535|emb|CAF99728.1| unnamed protein product [Tetraodon n... 34 4.3
gi|50731109|ref|XP_417170.1| PREDICTED: similar to Kelch repeat ... 34 4.3
gi|23477994|gb|EAA15202.1| L1P family of ribosomal proteins, put... 34 4.3
gi|34898232|ref|NP_910462.1| putative AMP deaminase [Oryza sativ... 34 4.3
gi|39590888|emb|CAE65262.1| Hypothetical protein CBG10153 [Caeno... 34 5.6
gi|50306727|ref|XP_453337.1| unnamed protein product [Kluyveromy... 34 5.6
gi|15929609|gb|AAH15239.1| ZBTB8 protein [Homo sapiens] >gnl|BL_... 34 5.6
gi|23957586|gb|AAN40800.1| BTB/POZ and zinc-finger domains facto... 34 5.6
gi|15224105|ref|NP_180001.1| potassium channel tetramerisation d... 34 5.6
gi|26245405|gb|AAN77376.1| BTB/POZ and zinc-finger domain contai... 34 5.6
gi|23488912|gb|EAA21434.1| Drosophila melanogaster CG12263 gene ... 33 7.3
gi|21741755|emb|CAD39781.1| OSJNBa0060B20.9 [Oryza sativa (japon... 33 7.3
gi|17160889|gb|AAH17614.1| RIKEN cDNA 2410081M15 [Mus musculus] 33 7.3
gi|21312080|ref|NP_082879.1| RIKEN cDNA 2410081M15 [Mus musculus... 33 7.3
gi|13812012|ref|NP_113143.1| hypothetical protein [Guillardia th... 33 7.3
gi|34875533|ref|XP_344451.1| similar to leftover [Rattus norvegi... 33 7.3
gi|19923973|ref|NP_612453.1| potassium channel tetramerisation d... 33 7.3
gi|47220171|emb|CAG07312.1| unnamed protein product [Tetraodon n... 33 7.3
gi|13512594|gb|AAK28688.1| unknown function U3 [Ehrlichia canis] 33 9.6
gi|23482435|gb|EAA18421.1| CCAAT-box DNA binding protein subunit... 33 9.6
gi|47578123|ref|NP_808383.2| potassium channel tetramerisation d... 33 9.6
gi|13508137|ref|NP_110086.1| conserved hypothetical protein [Myc... 33 9.6
gi|23619368|ref|NP_705330.1| conserved protein, putative [Plasmo... 33 9.6
gi|42453761|ref|ZP_00153668.1| hypothetical protein Rick062401 [... 33 9.6
gi|26330728|dbj|BAC29094.1| unnamed protein product [Mus musculus] 33 9.6
>gi|7505153|pir||T32393 hypothetical protein K02E7.4 -
Caenorhabditis elegans
Length = 319
Score = 651 bits (1679), Expect = 0.0
Identities = 319/319 (100%), Positives = 319/319 (100%)
Frame = +1
Query: 1 MRRIRVQRSQSHHLHPLYPVIRLSIQCIIQRLESDFEFHIKLGIQFPVAQNSIFLDFFHF 180
MRRIRVQRSQSHHLHPLYPVIRLSIQCIIQRLESDFEFHIKLGIQFPVAQNSIFLDFFHF
Sbjct: 1 MRRIRVQRSQSHHLHPLYPVIRLSIQCIIQRLESDFEFHIKLGIQFPVAQNSIFLDFFHF 60
Query: 181 FQLEKDESGCIFIDRSPKHFDIILNYMRDGDVTVTKNHEEVMAEAKFYLLEELVKLCKPV 360
FQLEKDESGCIFIDRSPKHFDIILNYMRDGDVTVTKNHEEVMAEAKFYLLEELVKLCKPV
Sbjct: 61 FQLEKDESGCIFIDRSPKHFDIILNYMRDGDVTVTKNHEEVMAEAKFYLLEELVKLCKPV 120
Query: 361 LPSRGFKISIINDEQLLQILAEEPLKGVYRDSNNFQNFFSKLLNFSEKNDNAYENGWSAR 540
LPSRGFKISIINDEQLLQILAEEPLKGVYRDSNNFQNFFSKLLNFSEKNDNAYENGWSAR
Sbjct: 121 LPSRGFKISIINDEQLLQILAEEPLKGVYRDSNNFQNFFSKLLNFSEKNDNAYENGWSAR 180
Query: 541 IITWPAGPYKVIPGPSGNDIGETNVDFSERLDNFVSEFLKTHVQMLSVEEQYKLFMNSTN 720
IITWPAGPYKVIPGPSGNDIGETNVDFSERLDNFVSEFLKTHVQMLSVEEQYKLFMNSTN
Sbjct: 181 IITWPAGPYKVIPGPSGNDIGETNVDFSERLDNFVSEFLKTHVQMLSVEEQYKLFMNSTN 240
Query: 721 FMFKISNLRSLNPDFQVFFVLKNLKMFYFLSQIQGFMFKYVPQKGTKFSNSNFFYRPKIK 900
FMFKISNLRSLNPDFQVFFVLKNLKMFYFLSQIQGFMFKYVPQKGTKFSNSNFFYRPKIK
Sbjct: 241 FMFKISNLRSLNPDFQVFFVLKNLKMFYFLSQIQGFMFKYVPQKGTKFSNSNFFYRPKIK 300
Query: 901 FLNFYVASFSSSFLYHYFK 957
FLNFYVASFSSSFLYHYFK
Sbjct: 301 FLNFYVASFSSSFLYHYFK 319